Massively http://massively.joystiq.com Massively http://www.blogsmithmedia.com/http://massively.joystiq.com/media/feedlogo.gif Massively http://massively.joystiq.com en-us Copyright 2013 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[Chaos Theory: The Secret World shaken, not stirred]]>http://massively.joystiq.com/2013/05/13/chaos-theory-the-secret-world-shaken-not-stirred/http://massively.joystiq.com/2013/05/13/chaos-theory-the-secret-world-shaken-not-stirred/http://massively.joystiq.com/2013/05/13/chaos-theory-the-secret-world-shaken-not-stirred/#commentsFiled under: , , , , , , ,

Chaos Theory The Secret World shaken, not stirred
For all those who've been trying so hard to predict gloom and doom for The Secret World, I say Nyeh nyeh because the April producer's letter announcing Issue #7 pretty much flies in the face of all your it's-gonna-die whimperings. In fact, I can't believe we still hear them because TSW just keeps getting better and better. Where's the duct tape when you need it...

While it's true we don't have monthly updates anymore (and that's totally understandable, given the restructuring that devs certainly couldn't predict), Secret World fans are still getting frequent, and more importantly extremely fun, updates. Just look at The Vanishing of Tyler Freeborn and The Last Train to Cairo; both of these issues brought interesting new storylines and a decent helping of new features. Some even say these updates introduced the best content so far. With that track record, who can't help but be totally psyched for the upcoming Issue #7?

Continue reading Chaos Theory: The Secret World shaken, not stirred

MassivelyChaos Theory: The Secret World shaken, not stirred originally appeared on Massively on Mon, 13 May 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsauxiliary-weaponsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragonfactionfaction-pvpfantasyfeaturedfuncomhappy-little-flameshorrorilluminatiIssue-7James-Bondmythologynew-DLCnew-weaponopinionpyropyromaniacsci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonupdateMon, 13 May 2013 15:00:00 EST<![CDATA[The Stream Team: MLT edition, May 13 - 19, 2013]]>http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/#commentsFiled under: , , ,

The Stream Team May 13 19, 2013
Nothing beats an MLT, especially when the tomato is nice and ripe! Except maybe Massively TV. MMmm mmmm. Now there's something you can really sink your teeth into -- the wild and crazy antics of your favorite Stream Team hosts! And they've got a menu for all tastes this week, from space adventures to dragons to WWII planes. Of course, it all comes with a side of reruns and a dessert highlight to complete your meal.

So pull up a chair and grab yourself a helping or two... or 10. Hey, there's no limit here; enjoy as much as you like! While you're enjoying the spread, be sure to join in the after-dinner chat in Outtakes.

Continue reading The Stream Team: MLT edition, May 13 - 19, 2013

MassivelyThe Stream Team: MLT edition, May 13 - 19, 2013 originally appeared on Massively on Mon, 13 May 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmoactivisionage-of-conanage-of-conan-unchainedagonanetaocaoc-unchainedarenanetarkark-hunterarkfallaventurinebiowareblizzardblizzard-entertainmentbuy-to-playccpccp-gamescity-of-steamconanconsoleconsolescrypticcryptic-studiosdarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodefiancedfdnddota-2Dragonrealmseaelectronic-artselswordeq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfree-to-playfuncomgoblinguild-warsgwhi-rezhi-rez-studioshistoricalhorrorhyboriainternet-spaceshipslivestreamlivestreaminglivestreamslucasartsmabinogimassively-metamassively-tvmechmechanistmechanist-gamesmechsmechwarriormechwarrior-mmomechwarrior-onlinemetammo-shootermobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmwomythologyncsoftneverwinternexonnexon-americaopen-pvpperfect-worldperfect-world-entertainmentpiranhapiranha-gamesplaneplanesplaystation-3playstation3pollps3pvppwesandboxsci-fantasysci-fisecret-worldshooterskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicsteampunkstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorsyfythe-old-republicthe-secret-worldthe-stream-teamthird-person-shootertortpstransmedia-synergytriontrion-worldstswtvtwitchtwitch-tvunchainedunholy-warswarwarcraftwargaming.netwarplanewarplanesworld-of-warcraftworld-of-warplaneswowwowpxboxMon, 13 May 2013 09:00:00 EST<![CDATA[Chaos Theory: Player projects enhance The Secret World experience]]>http://massively.joystiq.com/2013/05/06/chaos-theory-player-projects-enhance-the-secret-world-experienc/http://massively.joystiq.com/2013/05/06/chaos-theory-player-projects-enhance-the-secret-world-experienc/http://massively.joystiq.com/2013/05/06/chaos-theory-player-projects-enhance-the-secret-world-experienc/#commentsFiled under: , , , , , , , ,

Chaos Theory Player projects enhance The Secret World experience
One of The Secret World's most unique elements makes it ripe for producing immersive experiences, even outside of the game. Set in the modern real world (as opposed to the fantasy or even sci-fi themes prevalent in our MMOverse), a game can more easily blur the line between logged in and logged out. Players can, and do, generate ways to be a part of the game while still out and about in the real world. Today, I'm going to shine a spotlight on two of these projects that use very different methods to continue immersion beyond actual gameplay.

In January, one TSW fan ran an Alternate-Reality Game (ARG) for fellow players. Using Twitter, the forums, email, and even in-game characters, this player orchestrated a full-on investigation for participants to work through. And just recently, a new site offering to immerse players more deeply into the game through imagery was beta-launched. Both projects further player involvement in the world of the game -- the stories, the conspiracies, the histories, and the surroundings -- beyond the actual game. Both received support from Funcom in their efforts to expand the fans' experiences. And both are definitely worth checking out, so I sat down with the creators to get the scoop on the why, the how, and the what's next.

Continue reading Chaos Theory: Player projects enhance The Secret World experience

MassivelyChaos Theory: Player projects enhance The Secret World experience originally appeared on Massively on Mon, 06 May 2013 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsalternate-reality-gameARGbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragonfactionfaction-pvpfantasyfeaturedfuncomhorroriimmersionilluminatiMorteiamythologyopinionpanoramic-viewsPGCplayer-generated-contentsci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonTSWPanoYarrukaMon, 06 May 2013 16:00:00 EST<![CDATA[One Shots: The dark night dashes]]>http://massively.joystiq.com/2013/05/05/one-shots-the-dark-night-dashes/http://massively.joystiq.com/2013/05/05/one-shots-the-dark-night-dashes/http://massively.joystiq.com/2013/05/05/one-shots-the-dark-night-dashes/#commentsFiled under: , , , , , , ,

One Shots The dark night rises
Just because you have passing familiarity with Superman and Batman doesn't mean you know jack about the real superheroes who do all of the dirty work while the headliners steal the signal light. For instance, have you met this guy? If you haven't, let reader Russell make your acquaintance.

"This is my Brawling Juggernaut in DC Universe Online, known by many as Orange Crush," Russell begins with aplomb. "Here he is in pursuit of justice, on the way to laying some Crush down on the villains of our great and beloved Gotham City!"

Will Orange Crush arrive in time? Tune in to the rest of this column after the break!

Continue reading One Shots: The dark night dashes

MassivelyOne Shots: The dark night dashes originally appeared on Massively on Sun, 05 May 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>biowareblueholebluehole-studiosbring-back-one-shotsbuy-to-playconsoleconsolesdc-universedc-universe-onlinedcuoeaelectronic-artsen-masseen-masse-entertainmentf2pfactionfantasyfree-to-playfuncomgalleriesgalleryhorrorlucasartsmythologyone-shotspics-or-it-didnt-happenplaystation-3playstation3ps3reader-screenshotsreader-submissionssci-fantasysci-fiscreenshotscreenshotssecret-worldskill-basedsoesony-online-entertainmentstar-warsstar-wars-the-old-republicsubscriptionlesssuperherosuperheroesswtorterathe-old-republicthe-secret-worldtortswuser-submissionsSun, 05 May 2013 10:00:00 EST<![CDATA[The Secret World celebrates with a bonus weekend]]>http://massively.joystiq.com/2013/05/02/the-secret-world-celebrates-with-a-bonus-weekend/http://massively.joystiq.com/2013/05/02/the-secret-world-celebrates-with-a-bonus-weekend/http://massively.joystiq.com/2013/05/02/the-secret-world-celebrates-with-a-bonus-weekend/#commentsFiled under: , , , , ,

The Secret World celebrates with a bonus weekend
Celebrates what, you might ask? Funcom certainly doesn't need a reason to celebrate as the studio is dubbing this upcoming weekend as a golden weekend in The Secret World, full of prizes and rewards.

First off, for every Ability Point earned this weekend, you get a free bonus point which is stackable with item store Timed Ability Point boosts. You can also earn a free month of membership for every new player you recruit who purchases the game in the next 30 days. And to top it all off, you get 30% extra bonus points every time you purchase Funcom points.

The Secret World's Golden Weekend event runs from this Friday, May 3, at 9am EDT through Sunday, May 5.

MassivelyThe Secret World celebrates with a bonus weekend originally appeared on Massively on Thu, 02 May 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>buy-to-playfactionfantasyfuncomgolden-weekendhorrormythologysci-fantasysecret-worldskill-basedsubscriptionlessthe-secret-worldtswThu, 02 May 2013 18:00:00 EST<![CDATA[The Secret World's Issue #7 goes 007]]>http://massively.joystiq.com/2013/04/30/the-secret-worlds-issue-7-goes-007/http://massively.joystiq.com/2013/04/30/the-secret-worlds-issue-7-goes-007/http://massively.joystiq.com/2013/04/30/the-secret-worlds-issue-7-goes-007/#commentsFiled under: , , , , , , ,

The Secret World's Issue #7 goes 007
April's Game Director letter for The Secret World is hot off the presses, and in it Joel Bylos shared some juicy morsels about the next issue in store for the horror and conspiracy-laced game. He revealed that whereas Issue #6 was spiced with an Indiana Jones flavor, Issue #7 will be sprinkled with a distinct 007 zest. Yes, Bond. James Bond.

Set in Transylvania, Issue #7 directs players to investigate the presence of the werewolves in the area, which ultimately leads them to an Orochi facility secreted away below a glacier in the Carpathian Fangs. Along the way, players get to experience adventures as a secret agent, complete with daring chases (a snowmobile one at that!), dare-devil jumps from exploding bridges, and close shaves with laser beams near sensitive areas. There's also a new auxiliary weapon to brandish -- the flamethrower.

But the new goodies don't stop there. Bylos introduced a new feature that allows for custom streaming of radio stations or playlists directly into the client as well as a some PvP changes including tweaks to the matchmaking system. He concluded with some teasers about Black Ops and Issue #8. For all the details, check out the full letter.

MassivelyThe Secret World's Issue #7 goes 007 originally appeared on Massively on Tue, 30 Apr 2013 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>auxiliary-weaponsbuy-to-playfactionfantasyflamethrowerfuncomhorrorIssue-7James-Bondmythologynew-weaponOrochisci-fantasysecret-worldskill-basedsubscriptionlessthe-secret-worldTransylvaniatswupdateTue, 30 Apr 2013 13:00:00 EST<![CDATA[Chaos Theory: Testing my Secret World DPS makeover]]>http://massively.joystiq.com/2013/04/29/chaos-theory-testing-my-secret-world-dps-makeover/http://massively.joystiq.com/2013/04/29/chaos-theory-testing-my-secret-world-dps-makeover/http://massively.joystiq.com/2013/04/29/chaos-theory-testing-my-secret-world-dps-makeover/#commentsFiled under: , , , , , , , , ,

Chaos Theory Testing my Secret World DPS makeover
It's no secret that The Secret World is just a wee bit different than the majority of MMORPGs out there. Hallelujah for that, right? And one notable area it differs from the rest is how it treats gear and classes. As such, players can't necessarily bring habits and know-how from other titles and translate that into immediate success in TSW. It's no wonder that even good players can sometimes feel stumped or at a loss when navigating through builds. For that very reason, Chaos Theory brought you the first episode of What Not to Wear, a live makeover that focused on sharing hints and tips that non-theorycrafters (like yours truly) could use as a base for forging their own path.

It was a simple makeover really -- just minor changes in my focus and equipment using gear I already had in my bag and abilities I already had access to. Did it help? Did my effectiveness as a damage-dealer increase? The outcome was rather surprising.

Continue reading Chaos Theory: Testing my Secret World DPS makeover

MassivelyChaos Theory: Testing my Secret World DPS makeover originally appeared on Massively on Mon, 29 Apr 2013 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingDPS-guideDPS-makeoverdragonfactionfaction-pvpfantasyfeaturedfuncomhintshorrorilluminatilivestreammythologyopinionpassive-abilitiessci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstips-and-trickstrailertrailerstswtsw-chaos-theorytsw-dragonvideovideoswhat-not-to-wearMon, 29 Apr 2013 20:00:00 EST<![CDATA[The Stream Team: Fuzzy slippers edition, April 29 - May 5, 2013]]>http://massively.joystiq.com/2013/04/29/the-stream-team-fuzzy-slippers-edition-april-29-may-5-2013/http://massively.joystiq.com/2013/04/29/the-stream-team-fuzzy-slippers-edition-april-29-may-5-2013/http://massively.joystiq.com/2013/04/29/the-stream-team-fuzzy-slippers-edition-april-29-may-5-2013/#commentsFiled under: , ,

The Stream Team Fuzzy slippers edition, April 29 May 5, 2013
Comfort food is a pretty universally understood concept. And most folks can also easily envision the security of a blanket a la Linus in the Peanuts cartoons. But what do gamers turn to for stability and comfort during stressful times? I mean, we all know that sometimes games get pretty intense. If you don't believe me, just watch Massively TV! Death and glory, victory and defeat: The Stream Team experiences it all.

Some folks have specific food or drinks on hand for their gaming sessions. I know one gamer with a bobble-head. Me? I've got my fuzzy slippers! Yes, really. When I wear them, glorious victories are all the sweeter and harrowing defeats lose their sting. And I swear they bring me luck. Gaming is just better in fuzzy slippers. If you haven't tried it, I totally encourage you to. Uncertain? Try it, you might like it! Grab a pair and give them a test run while watching this week's shows. Or if you have your own can't-do-without gaming accessory, let us know what it is in the Outtakes.

Continue reading The Stream Team: Fuzzy slippers edition, April 29 - May 5, 2013

MassivelyThe Stream Team: Fuzzy slippers edition, April 29 - May 5, 2013 originally appeared on Massively on Mon, 29 Apr 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmoactivisionall-points-bulletinall-points-bulletin-reloadedanetapbapb-reloadedapbrarenanetbiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playclone-warsclone-wars-adventurescrimecrypticcryptic-studioscwadnddragondragonsdragons-propheteaelectronic-artseq-2eq-iieq2eqiieverquest-2everquest-iif2pfactionfamilyfantasyfeaturedfpsfree-to-playfuncomg1gamersfirstguild-warsguild-wars-2gwgw2Heroes-and-GeneralsHeroes-and-Generalshi-rezhi-rez-studioshistoricalhorrorhousinginfernuminfernum-productionskid-friendlykidskids-mmokingsislekingsisle-entertainmentlivestreamlivestreaminglivestreamslobbylucasartsmassively-metamassively-tvmetaminigamemmo-shootermmofpsmobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftneverwinterperfect-worldperfect-world-entertainmentplaneplanesplanetsideplanetside-2pollps2pvppwerunewakerrunewaker-entertainmentsandboxsci-fantasysci-fisecret-worldshooterskill-basedSmitesoesonysony-online-entertainmentstar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlessswtorThe-Lost-Titansthe-old-republicthe-secret-worldthe-stream-teamtorTorchlight-2torchlight-iitswtwitchtwitch-tvwarWar-Thunderwarcraftwargaming.netWarMage-Battlegroundswarplanewarplaneswizard101world-of-warcraftworld-of-warplaneswowwowpMon, 29 Apr 2013 09:00:00 EST<![CDATA[Some Assembly Required: Community as content]]>http://massively.joystiq.com/2013/04/26/some-assembly-required-community-as-content/http://massively.joystiq.com/2013/04/26/some-assembly-required-community-as-content/http://massively.joystiq.com/2013/04/26/some-assembly-required-community-as-content/#commentsFiled under: , , , , ,

Some Assembly Required Community as content
Not too long ago, I had the opportunity to cover an occasion during which an in-game community came together and created a new player-run annual event. Born as an anniversary follow-up to a service event for the young terminally ill player Ribbitribbit, the new tradition focused on celebrating that very community that pulled together to create him a dream playground within EverQuest II. If the game lacked a sense of community in the game before that original project, it certainly didn't after.

After tugging at my heartstrings for a while, that experience made me reflect on how much our communities are really a cornerstone of player-generated content. How often have you attended or participated in an event or run a mission created by someone other than yourself? And yet, when discussing important tools and elements needed to support player-generated content, we often overlook the necessity of a vibrant community. It's like trying to bake a cake without adding the flour. Or how about this analogy: You can give folks a giant tool box full of a shiny implements and tell them to build a house, but not much will happen without the actual wood and materials! So to foster PGC, games need to foster building communities.

Continue reading Some Assembly Required: Community as content

MassivelySome Assembly Required: Community as content originally appeared on Massively on Fri, 26 Apr 2013 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>aionascensionbuy-to-playcommunitycommunity-buildingcommunity-building-toolseaelectronic-artsendless-trialeq-2eq-iieq2eqiieveeve-fanfesteve-fanfest-2013eve-onlineeve-online-fanfesteve-online-fanfest-2013eventevent-coverageeverquest-2everquest-iif2pfactionfanfestfantasyfeaturedfree-to-playfuncomgame-mechanicshorroricelandin-game-calendarlineagelineage-2lineage-iimassively-event-coveragemythicmythic-entertainmentmythologyncsoftopinionpgcplayer-contentplayer-generated-contentpvprekyjavikrvrsandboxsarsci-fantasysecret-worldskill-basedsoesome-assembly-requiredsonysony-online-entertainmentsubscriptionlessthe-secret-worldtruly-freetswwarwarhammerwarhammer-onlineFri, 26 Apr 2013 16:00:00 EST<![CDATA[The Secret World has a lot of clothing options]]>http://massively.joystiq.com/2013/04/23/the-secret-world-has-a-lot-of-clothing-options/http://massively.joystiq.com/2013/04/23/the-secret-world-has-a-lot-of-clothing-options/http://massively.joystiq.com/2013/04/23/the-secret-world-has-a-lot-of-clothing-options/#commentsFiled under: , , , , , , , ,

tsw dev guide on costumes see team email
If you've played The Secret World for more than five minutes, you're probably aware of the fact that it has some of the most extensive outfit options of any MMORPG on the market. If you're not aware of that fact, well, you're the target audience of Funcom's latest dev blog.

It's all about avatar customization, and it details how TSW's stats are kept separate from clothing items in order to satisfy your inner min-maxer and fashion maven simultaneously. Since the game is set in the modern world, you'll find many authentic styles available to earn in-game or purchase through the cash shop. If you're a fan of the otherworldly, don't fret. There are plenty of sci-fi, steampunk, horror, fantasy, and medieval get-ups as well.

MassivelyThe Secret World has a lot of clothing options originally appeared on Massively on Tue, 23 Apr 2013 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>buy-to-playfactionfantasyfuncomhorrormythologysci-fantasysecret-worldsecret-world-clothingsecret-world-customizationskill-basedsubscriptionlessthe-secret-worldtswtsw-clothingtsw-customizationTue, 23 Apr 2013 13:00:00 EST<![CDATA[Chaos Theory: Perfecting your build in The Secret World]]>http://massively.joystiq.com/2013/04/22/chaos-theory-perfecting-your-build-in-the-secret-world/http://massively.joystiq.com/2013/04/22/chaos-theory-perfecting-your-build-in-the-secret-world/http://massively.joystiq.com/2013/04/22/chaos-theory-perfecting-your-build-in-the-secret-world/#commentsFiled under: , , , , , , ,

Chaos Theory Perfecting your build in The Secret World
After discussing last week that build creation was on the minds of many a Secret World fan, I promised to provide some hints and tips on how to better maximize your performance in game. It truly is a topic relevant to all players, even those who aren't focused on or interested in endgame. After all, even folks (like yours truly) who are in it mainly for the awesome story may find their ability to continue with said story hampered at some point by an insufficient build.

With a limit of only seven active (eight if you have an auxiliary weapon) and seven passive skills available to use at any time, creating a build in The Secret World is not quite like most other MMOs, so you can't just automatically throw on gear of a higher level and call it good. Sure, you can eventually pound your way through many things, but you can save yourself some time and frustration by understanding a bit about how the gear works together with your skills. That's where today's Chaos Theory comes in.

What better way to inform and entertain you than to open myself up for some theorycrafting by someone who has a better knack for it? Using my little Illuminati as our guinea pig, I've bared her gear for all to see and learn what can be done to improve. With that, I welcome you to the first episode of "What Not to Wear in TSW"!

Continue reading Chaos Theory: Perfecting your build in The Secret World

MassivelyChaos Theory: Perfecting your build in The Secret World originally appeared on Massively on Mon, 22 Apr 2013 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbuildsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingDPS-builddragonfactionfaction-pvpfantasyfeaturedfuncomguideguide-to-DPS-buildshorrorilluminatimythologyopinionsci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorytheorycraftingthree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonMon, 22 Apr 2013 19:00:00 EST<![CDATA[One Shots: Yo ho ho!]]>http://massively.joystiq.com/2013/04/21/one-shots-yo-ho-ho/http://massively.joystiq.com/2013/04/21/one-shots-yo-ho-ho/http://massively.joystiq.com/2013/04/21/one-shots-yo-ho-ho/#commentsFiled under: , , , , , , ,

One Shots Yo ho ho!
There's probably no gulf as wide as the one between historical pirates and the pop culture versions that we venerate. As a guy who had a pirate-themed 30th birthday party, I can't say that I'm against our off-kilter brand of scallywags. Neither is reader Phinneas, who sent in our featured screenshot from Pirate101.

"These shots are of the main starting area with my fearsome pirate looking to the horizon for adventures ahead," he writes.

Best of luck to ye, laddie! May the wind be at your back, your enemies in Davey Jones' locker, and a bottle of ginger ale in your belly! Yet pirates are only the beginning of today's adventure through One Shots...

Continue reading One Shots: Yo ho ho!

MassivelyOne Shots: Yo ho ho! originally appeared on Massively on Sun, 21 Apr 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>anetarenanetbiowarebring-back-one-shotsbuy-to-playeaelectronic-artsf2pfactionfamilyfantasyfree-to-playfuncomgalleriesgalleryguild-wars-2gw2horrorkid-friendlykids-mmokingsislekingsisle-entertainmentlucasartsmythologyncsoftone-shotspics-or-it-didnt-happenpiratepirate101piratesreader-screenshotsreader-submissionssci-fantasysci-fiscreenshotscreenshotssecret-worldskill-basedstar-warsstar-wars-the-old-republicsubscriptionlessswtorthe-old-republicthe-secret-worldtortswuser-submissionsSun, 21 Apr 2013 10:00:00 EST<![CDATA[CCP revamping DUST 514's skill system]]>http://massively.joystiq.com/2013/04/18/ccp-revamping-dust-514s-skill-system/http://massively.joystiq.com/2013/04/18/ccp-revamping-dust-514s-skill-system/http://massively.joystiq.com/2013/04/18/ccp-revamping-dust-514s-skill-system/#commentsFiled under: , , , , , , , , , , ,

CCP revamping DUST 514's skill system
DUST 514's May 6th Uprising patch will revamp the sci-fi shooter's skill system. Among the changes are the removal of multiple prerequisite skills and a new node-based skill tree view that will replace the current list-based approach.

CCP is also refunding skill points and ISK and AUR for certain items based on their market value at the time of the respec. "You may have committed to a certain play style, and with an overhauled layout and collection of skills, you may find yourself regretting some of your prior choices," explains DUST creative director Atli Mar Sveinsson on the PlayStation Blog. "We have thus decided that it is far better to respec not only the skills but items as well. In short, you will get your skill points back and the ISK and AUR value of any item that is removed from your inventory."

MassivelyCCP revamping DUST 514's skill system originally appeared on Massively on Thu, 18 Apr 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>atli-mar-sveinssonccpccp-gamesccp-praetorianconsoledustdust-514dust-514-uprisingdust-skillsdust-skll-revampeveeve-onlinefpsmmofpsplaystationplaystation-3ps3sandboxsci-fishooterskill-basedskill-systemuprisingThu, 18 Apr 2013 10:00:00 EST<![CDATA[Chaos Theory: The Secret World community roundup]]>http://massively.joystiq.com/2013/04/15/chaos-theory-the-secret-world-community-roundup/http://massively.joystiq.com/2013/04/15/chaos-theory-the-secret-world-community-roundup/http://massively.joystiq.com/2013/04/15/chaos-theory-the-secret-world-community-roundup/#commentsFiled under: , , , , , ,

Chaos Theory The Secret World community roundup
You've heard me express my thoughts quite a bit over the last couple of months about everything from what I want to see in The Secret World (like housing and an encore to special events) to my experiences with different aspects of the game (such as sabotage missions and Issue #6). Now it's time to share yours! Yes, folks, this week follows in a time-honored tradition of community roundups, where we dive into the topics that are in the forefront of the community's collective mind.

Of course, we can't touch on everything here (that's what official forums are for), but we can explore a smattering of the topics raised. So what are TSW players chattering about lately? Among the ongoing conversations are discussions about veteran rewards, clothing, PvP tournaments, and builds.

Continue reading Chaos Theory: The Secret World community roundup

MassivelyChaos Theory: The Secret World community roundup originally appeared on Massively on Mon, 15 Apr 2013 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbuy-to-playchaos-theoryclothingcommunity-roundupconspiracyconspiracy-thriillerdark-days-are-comingdragonfactionfaction-pvpfantasyfeaturedfuncomhorrorilluminatimythologyopinionPvPsci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorytheory-craftingthree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonveteran-rewardsMon, 15 Apr 2013 19:00:00 EST<![CDATA[New raid included in today's Secret World patch]]>http://massively.joystiq.com/2013/04/15/new-raid-included-in-todays-secret-world-patch/http://massively.joystiq.com/2013/04/15/new-raid-included-in-todays-secret-world-patch/http://massively.joystiq.com/2013/04/15/new-raid-included-in-todays-secret-world-patch/#commentsFiled under: , , , , , ,

New raid included in The Secret World's patch
Amid the general bug squashing and polishing released in today's patch, The Secret World has tucked away a tasty little morsel of content: an all new lair raid encounter. A weak point between realities has been discovered out in the Kingsmouth wreckage, and groups of 10 adventurers can enter the extra-dimensional prison, The Island of Stillborn Stars, to face Eidolon of the Outer Dark.

Bits of housekeeping also included in the patch were fixes to several exploits in lairs, dungeons, and PvP as well as assorted bugs (say goodbye to area spam when anyone nearby uses a reconstructor and black screens after using the Helevator). Players will also find a brand new item for sale at the Envoy of Ca' d'Oro. For a full listing of all the changes, check out the official patch notes.

[Source: Funcom press release]

MassivelyNew raid included in today's Secret World patch originally appeared on Massively on Mon, 15 Apr 2013 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bug-fixesbuy-to-playfactionfantasyfuncomhorrorlairlairsmythologynew-raidpatchsci-fantasysecret-worldskill-basedsubscriptionlessthe-secret-worldtswMon, 15 Apr 2013 14:00:00 EST<![CDATA[The Stream Team: Stepping on tax edition, April 15 - 21, 2013]]>http://massively.joystiq.com/2013/04/15/the-stream-team-stepping-on-tax-edition-april-15-21-2013/http://massively.joystiq.com/2013/04/15/the-stream-team-stepping-on-tax-edition-april-15-21-2013/http://massively.joystiq.com/2013/04/15/the-stream-team-stepping-on-tax-edition-april-15-21-2013/#commentsFiled under: , , , ,

The Stream Team Stepping on tax edition, April 15 21, 2013
'Tis the season! Just... not that season. This isn't one we really want; it's not a season of joyousness and brotherly kindness. No, this one's more akin to scattering LEGOs and thumbtacks all across the floor then dashing barefoot from wall to wall just to hit your head against them over and over. We understand the pain. Truly, we do. And The Stream Team is here for you.

They say nothing's certain in life except death and taxes, but we disagree! We'd totally add Massively TV to that list. Have we ever left you in your times of need? No! And we know you need us now more than ever. We're here to help you, with a full line-up of shows to help ease the pain and take your mind off the traumas that cannot be avoided. So take a load off and check out this week's schedule, catch a few reruns, see the highlight of the week, and take part in our two polls. Then remember, at least this only happens once a year!

Continue reading The Stream Team: Stepping on tax edition, April 15 - 21, 2013

MassivelyThe Stream Team: Stepping on tax edition, April 15 - 21, 2013 originally appeared on Massively on Mon, 15 Apr 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>activisionage-of-wulinage-of-wushuagotaionanetarenanetarkark-hunterarkfallartplayascensionasiabigpointbiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gameschampionschampions-onlinechampschinachinesechinese-mmococonsoleconsolescrypticcryptic-studiosdefianceeaelectronic-artseq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfamilyfantasyfeaturedfrfree-realmsfree-to-playfuncomgame of thronesgame-of-thrones-ascentgame-of-thrones-mmogame-of-thrones-seven-kingdomsgeorge-martingeorge-rr-martingotgot7kgpotatoguild-warsguild-wars-2gvggwgw2hbohi-rezhi-rez-studioshistoricalhorrorinternet-spaceshipskid-friendlykidnappingkidskids-mmokingsislekingsisle-entertainmentlivestreamlivestreaminglivestreamslucasartsmartial-artsmassively-metamassively-tvmetamight-and-magicmight-and-magic-duel-of-championsming-dynastymmo-shootermobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftperfect-worldperfect-world-entertainmentplaneplanesplaystation-3playstation3pollps3pvppwesandboxsci-fantasysci-fisecret-worldseven-kingdomsshooterskill-basedSmitesnail-gamessnail-games-usasoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorsyfytanktankstelonthe-aurora-worldthe-old-republicthe-secret-worldthe-stream-teamthird-person-shootertortpstransmedia-synergytriontrion-worldstruly-freetswtvtwitchtwitch-tvvanguardvanguard-saga-of-heroesvgvillagers-and-heroeswarwarcraftwargaming.netwarplanewarplaneswesteroswizard101world-of-tanksworld-of-warcraftworld-of-warplaneswotwowwowpwushuwuxiaxboxMon, 15 Apr 2013 09:00:00 EST<![CDATA[Chaos Theory: Exploring The Secret World's endgame]]>http://massively.joystiq.com/2013/04/08/chaos-theory-exploring-endgame/http://massively.joystiq.com/2013/04/08/chaos-theory-exploring-endgame/http://massively.joystiq.com/2013/04/08/chaos-theory-exploring-endgame/#commentsFiled under: , , , , , , ,

Chaos Theory Exploring endgame
Throughout my tenure as the Chaos Theory author, I've ruminated on a number of Secret World subjects that personally interest, intrigue, or otherwise affect me. I've covered ARGs, different issue updates, sabotage quests, the conversion to buy-to-play, ambiance, and more. I've even expounded on things I'd like to see in game, like housing and vehicles. But one thing I haven't covered with much detail are areas that don't have much personal relevance to me... yet.

While it makes sense to talk most about my personal experiences, The Secret World offers so much more than what I have delved into. There really are different strokes for different folks, all wrapped up within the one world. So this week we are exploring an area that captures the attention of others if not mine: endgame.

Continue reading Chaos Theory: Exploring The Secret World's endgame

MassivelyChaos Theory: Exploring The Secret World's endgame originally appeared on Massively on Mon, 08 Apr 2013 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragonendgamefactionfaction-pvpfantasyfeaturedfuncomhorrorilluminatimythologynightmare-modenightmare-mode-dungeonsopinionsci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorytheorycraftingthree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonMon, 08 Apr 2013 12:00:00 EST<![CDATA[Grimlands developer turns to Kickstarter to finish post-apoc shooter]]>http://massively.joystiq.com/2013/04/08/grimlands-developer-turns-to-kickstarter-to-finish-post-apoc-sho/http://massively.joystiq.com/2013/04/08/grimlands-developer-turns-to-kickstarter-to-finish-post-apoc-sho/http://massively.joystiq.com/2013/04/08/grimlands-developer-turns-to-kickstarter-to-finish-post-apoc-sho/#commentsFiled under: , , , , , , , ,

Grimlands developer turns to Kickstarter to finish post-apoc shooter
Post-apocalyptic shooter Grimlands may have been canceled by publisher gamigo, but development studio DRAGO isn't giving up on the title just yet. The firm has launched a Kickstarter campaign to raise the funds necessary to finish the project and keep it "true to its original vision."

A press release says that Grimlands was canceled because of gamigo's "strategy shift from development to distribution" in spite of the title's five-year development cycle. DRAGO's Lucjan Mikociak says that Kickstarter is necessary to save the game.

"There is no way around it: Big games need big money. Since gamigo stopped funding us in January, we have survived thanks to friends and family support," Mikociak explains. "However, in order to properly finish the game by year's end, we need further funding of $650,000. After talking to several publishers and investors we feel only Kickstarter allows this without compromising our vision."

Grimlands marries shooter gameplay with stealth and cover mechanics as well as character progression and customization. It also features an extensive crafting system wherein nearly every in-game item is made by players. Gameplay includes an open world, dungeons, PvE and PVP options, and upgradeable vehicles.

MassivelyGrimlands developer turns to Kickstarter to finish post-apoc shooter originally appeared on Massively on Mon, 08 Apr 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>craftingcrowdfundingdragogamigogrimlandsgrimlands-kickstarterkickstarterlucjan-mikociakmmo-shooterpost-apocalypticsci-fishooterskill-basedvehicleswastelandMon, 08 Apr 2013 10:00:00 EST<![CDATA[The Stream Team: Bleepity bleep edition, April 8 - 14, 2013]]>http://massively.joystiq.com/2013/04/08/the-stream-team-bleepity-bleep-edition-april-8-14-2013/http://massively.joystiq.com/2013/04/08/the-stream-team-bleepity-bleep-edition-april-8-14-2013/http://massively.joystiq.com/2013/04/08/the-stream-team-bleepity-bleep-edition-april-8-14-2013/#commentsFiled under: , , ,

The Stream Team Bleepity bleep edition, April 8 14, 2013

It's definitely not a new thing. Throughout the ages, when intense frustration strikes, a colorful epithet can slip past the lips of even the most soft-spoken. Heck, at particularly annoying times, a full string of them has been known fly forth from the most unexpected sources. And we all know that there are plenty of frustration-inducing situations in gaming. So it's not hard to equate swearing with gaming, right?

Of course, we at Massively TV advocate a responsible use of language during our adventures. While there could be a time or a place for the universally known curses, we prefer bursts of creative language skills. And if there's one thing The Stream Team has, it's an abundance of creativity! We've learned it is possible to express frustration while avoiding the censors because censors are mean and carry big, painful sticks! Ouch.

Need proof? Pop into any of the shows scheduled this week or the reruns from last; watch how deftly (or not) our intrepid streamers react to curse-creating incidents. Hope as they might, nothing can go smoothly all the time... or for the very unlucky, at all! A perfect demonstration of this is highlighted in our newest section, a place devoted to showcasing a stream of the week. Catch MJ's colorful repurposing of the English language first-hand in Highlight Reels, then offer your most creative expression in the Outtakes.

Continue reading The Stream Team: Bleepity bleep edition, April 8 - 14, 2013

MassivelyThe Stream Team: Bleepity bleep edition, April 8 - 14, 2013 originally appeared on Massively on Mon, 08 Apr 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2la-mystical-landactionaction-mmoactivisionage-of-wulinage-of-wushuaionanetarenanetarkark-hunterarkfallascensionasiabiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gameschampionschampions-onlinechampschinachinesechinese-mmococonquestconsoleconsolescrypticcryptic-studiosdc-universedc-universe-onlinedcuodefianceDinostormdotadota-2e-sporteaelectronic-artseq-2eq-iieq2eqiiesporteveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfrfree-realmsfree-to-playfuncomgpotatoguild-warsguild-wars-2gvggwgw2heroes-of-newerthhi-rezhi-rez-studioshistoricalhonhorrorinternet-spaceshipskid-friendlykidnappingkidskids-mmolindenlinden-lablivestreamlivestreaminglivestreamslucasartsmartial-artsmassively-metamassively-tvmetaming-dynastymmo-shootermobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftperfect-worldperfect-world-entertainmentplaystation-3playstation3pollps3pvppweraiderzreal-liferiftrift-literift-planes-of-telararvrs2s2-gamessandboxScarlet-Bladesci-fantasysci-fisecond-lifesecret-worldshooterskill-basedslSmitesnail-gamessnail-games-usasoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorsyfytanktanksthe-old-republicthe-secret-worldthe-stream-teamthird-person-shooterthree-faction-pvpthree-way-pvptortpstransmedia-synergytriontrion-worldstruly-freetswtvtwitchtwitch-tvVillagers-andheroesvirtual-worldvirtual-worldswarwarcraftwargaming.networld-of-tanksworld-of-warcraftwotwowwushuwuxiaxboxMon, 08 Apr 2013 09:00:00 EST<![CDATA[Chaos Theory: The wonderful world of sabotage in TSW]]>http://massively.joystiq.com/2013/04/01/chaos-theory-the-wonderful-world-of-sabotage-in-tsw/http://massively.joystiq.com/2013/04/01/chaos-theory-the-wonderful-world-of-sabotage-in-tsw/http://massively.joystiq.com/2013/04/01/chaos-theory-the-wonderful-world-of-sabotage-in-tsw/#commentsFiled under: , , , , ,

Chaos Theory
It's certainly no secret that I love The Secret World's investigation missions. I have mentioned it a time to two (times 20 or so) at different points in articles and livestreams alike. And that's not even counting how many times I regale my friends and family with my investigative exploits. Getting to use skills of the mind more than the fingers is not a regular occurrence in MMORPGs, but it darn well should be! It is a refreshing alternative to pew-pew all the time.

However, investigations aren't the only unique breed of missions I love in TSW. The game has a second kind that involves something other than just going out and showing off your prowess with a weapon. In fact, significant portions of these missions actually eschew the use of weapons entirely, and engaging in combat is a pretty big no-no when completing certain objectives. Welcome to sabotage missions.

Continue reading Chaos Theory: The wonderful world of sabotage in TSW

MassivelyChaos Theory: The wonderful world of sabotage in TSW originally appeared on Massively on Mon, 01 Apr 2013 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsalternative-playstylesATCbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragonfactionfaction-pvpfantasyfeaturedfuncomhorrorilluminatimythologyopinionOrachi-GroupOrochiOrochi-Groupsabotage-missionssci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonMon, 01 Apr 2013 19:00:00 EST<![CDATA[The Stream Team: Fools vs. floppy ears edition, April 1 - 7, 2013]]>http://massively.joystiq.com/2013/04/01/the-stream-team-fools-vs-floppy-ears-edition-april-1-7-201/http://massively.joystiq.com/2013/04/01/the-stream-team-fools-vs-floppy-ears-edition-april-1-7-201/http://massively.joystiq.com/2013/04/01/the-stream-team-fools-vs-floppy-ears-edition-april-1-7-201/#commentsFiled under: , , ,

The Stream Team Fools vs floppy ears edition, April 1 7, 2013
Though infrequent, it does happen: Once in a while two holidays go toe to toe on the calendar. This year, it just so happens that April Fools' Day rides in on the tail of the Easter Bunny. So what do you do when these very different holidays bump up against each other? You do what any self-respecting Stream Team fan does: You watch more Massively TV! Of course, that's pretty much the answer to everything, isn't it?

Some day these two holidays might actually overlap. If that were the case, who do you think would come out on top in a brawl over celebration rights -- that floppy-eared frolicking rabbit known for leaving chocolate or the fool (with or without a bell-tipped hat) who delights in pranking and tricking? After watching Rise of the Guardians, I think my money is on the bunny. Worst case scenario is they team up together and we end up with trick chocolate.

While contemplating this match-up, join us for a week of intense livestreams with your favorite hosts, playing such classics as Fruit Ninja and Fruity Loops Studio.

Continue reading The Stream Team: Fools vs. floppy ears edition, April 1 - 7, 2013

MassivelyThe Stream Team: Fools vs. floppy ears edition, April 1 - 7, 2013 originally appeared on Massively on Mon, 01 Apr 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2lactionaction-mmoactivisionallodsallods-onlineanetApril-Foolsarcane-legendsarenanetastrum-nivalbiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamesconquestconsoleconsolesdc-universedc-universe-onlinedcuodotadota-2e-sporteaEasterelectronic-artseq-2eq-iieq2eqiiesporteveeve-onlineeverquest-2everquest-iif2pfactionfamilyfantasyfeaturedfrfree-realmsfree-to-playFruity-Loops-Studiofuncomgala-netgpotatoguild-warsguild-wars-2gwgw2heroes-of-newerthhi-rezhi-rez-studioshistoricalhonhorrorinternet-spaceshipskid-friendlykidskids-mmokingsislekingsisle-entertainmentlindenlinden-lablivestreamlivestreaminglivestreamslucasartsmail-ru-gamesmail.ru-gamesmailru-gamesmassively-metamassively-tvmetamobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftnew-englandparadoxparadox-interactiveperfect-worldperfect-world-entertainmentpermadeathplaystation-3playstation3pollps3pvppweraiderzreal-liferiftrift-literift-planes-of-telararvrs2s2-gamessalemsandboxscarlet-bladesci-fantasysci-fisecond-lifesecret-worldsegaskill-basedslSmitesoesonysony-online-entertainmentspiral-knightsspreadsheets-onlinestar-warsstar-wars-the-old-republicsteamstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorthe-old-republicthe-secret-worldthe-stream-teamthree-faction-pvpthree-ringsthree-rings-designthree-way-pvptortriontrion-worldstswtwitchtwitch-tvvirtual-worldvirtual-worldswarcraftwizard101world-of-warcraftwowMon, 01 Apr 2013 09:00:00 EST<![CDATA[Rise and Shiny: Revisiting Salem]]>http://massively.joystiq.com/2013/03/31/rise-and-shiny-revisiting-salem/http://massively.joystiq.com/2013/03/31/rise-and-shiny-revisiting-salem/http://massively.joystiq.com/2013/03/31/rise-and-shiny-revisiting-salem/#commentsFiled under: , , , , , , , , , , , , , ,

Salem screenshot
A few months ago, I dived into Salem, a hardcore sandbox MMO that promises actual permadeath. That means if your character is killed while in game, he or she stays dead and loses everything. Not of your possible scores of skills are passed on, all items are lost and your homestead -- similar to a deed in Wurm Online -- can be destroyed. Heck, your homestead can be destroyed even if you're not dead. People can literally block your path, call you names, and attack you over and over. It makes me cry!

Nah, it's not as bad as it sounds. It never is. If there is one thing I have learned over the years, it's that you should really try a game for yourself before you believe everything you hear about it. Don't worry about trolls or griefers because the worst that can happen to you is that you end up leaving the game to find a better one. That's why we're called gamers.

Salem is actually about 50% killer and 50% silliness. I don't want to describe the killer part as "bad" because there is something the game is offering that so many others are not, and that's real danger and actual permadeath.

Continue reading Rise and Shiny: Revisiting Salem

MassivelyRise and Shiny: Revisiting Salem originally appeared on Massively on Sun, 31 Mar 2013 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>beau-hindmanf2pfeaturedffa-pvpfree-for-all-pvpfree-to-playhands-onhardcorelivestreammassively-tvParadox-Interactivepermadeathpvprise-and-shinysalemsalem-the-gameskill-basedstreamsurvivaltwitchtwitch-tvvideoSun, 31 Mar 2013 12:00:00 EST<![CDATA[Chaos Theory: Continuing the Issue #6 journey in The Secret World]]>http://massively.joystiq.com/2013/03/25/chaos-theory-continuing-the-issue-6-journey-in-the-secret-wor/http://massively.joystiq.com/2013/03/25/chaos-theory-continuing-the-issue-6-journey-in-the-secret-wor/http://massively.joystiq.com/2013/03/25/chaos-theory-continuing-the-issue-6-journey-in-the-secret-wor/#commentsFiled under: , , , , , , , , ,

Chaos Theory Continuing the Issue #6 journey in The Secret World
In sharing my thoughts with you last week about The Secret World's newest update, I admitted that I hadn't yet experienced all of it. Even with a head start, there were too few days available to really dig into Issue #6. So unless I wanted to blow through everything like a runaway train without savoring it, there was no way I could pontificate on all aspects of the update at that time.

That was then; this is now. This time around I've had full week to dive in and experience the different aspects of The Last Train to Cairo. Along with finishing up the story (which culminated in boarding the very train the update is named for), I started clawing my way up the PvP ranking ladder, secured my very own whip, and snagged a few veteran rewards. Of course, there is still more to be done; it will be a while before I am up for the challenge of the new raid boss, even with my snazzy new whip. And let's not forget banking up some recruitment bonus points by roping even more friends into The Secret World. Even so, that leaves plenty for us to talk about in today's Chaos Theory.

Continue reading Chaos Theory: Continuing the Issue #6 journey in The Secret World

MassivelyChaos Theory: Continuing the Issue #6 journey in The Secret World originally appeared on Massively on Mon, 25 Mar 2013 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdance-like-Nassirdark-days-are-comingdragonfactionfaction-pvpfantasyfeaturedfuncomhintshorrorilluminatiissue-6Issue-6-The-Last-Train-to-Cairojumping-puzzlesmythologyNassiropinionPvPPvP-rankingsreviewsci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsThe-Last-Train-to-Cairothe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonupdateveteran-rewardsMon, 25 Mar 2013 17:00:00 EST<![CDATA[The Stream Team: GDC edition, March 25 - 31, 2013]]>http://massively.joystiq.com/2013/03/25/the-stream-team-gdc-edition-march-25-31-2013/http://massively.joystiq.com/2013/03/25/the-stream-team-gdc-edition-march-25-31-2013/http://massively.joystiq.com/2013/03/25/the-stream-team-gdc-edition-march-25-31-2013/#commentsFiled under: , , ,

The Stream Team GDC edition, March 25 31, 2013
This week a sizable chunk of the gaming industry descends on downtown San Francisco for the annual Game Developers Convention. And yes, Massively will be there cornering every dev that gets in our sights, convincing them all to answer as many of our burning questions as possible before someone finds and rescues them!

I was even thinking how neat it would be to add these little tête-à-têtes to the Massively TV line up. Alas, I was thwarted; something about "evidence." Ah well, there are still plenty of live shows scheduled and a plethora of reruns to fill out your week while waiting on the GDC news.

If you have any burning questions about your favorite games, add them to the comments below and we'll see how many we can get answers for. And don't miss our two bonus polls at the end.

Continue reading The Stream Team: GDC edition, March 25 - 31, 2013

MassivelyThe Stream Team: GDC edition, March 25 - 31, 2013 originally appeared on Massively on Mon, 25 Mar 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>activisionaionallodsallods-onlineanetarcane-legendsarenanetarkark-hunterarkfallascensionastrum-nivalbiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamesconquestconsoleconsolesdc-universedc-universe-onlinedcuodefiancedotadota-2e-sporteaelectronic-artseq-2eq-iieq2eqiiesporteveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfpsfree-to-playfuncomgala-netgpotatoguild-warsguild-wars-2gwgw2heart-of-the-swarmheroes-of-newerthhi-rezhi-rez-studioshistoricalhonhorrorinternet-spaceshipslivestreamlivestreaminglivestreamslucasartsmail-ru-gamesmail.ru-gamesmailru-gamesmassively-metamassively-tvmetammofpsmobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftnew-englandparadoxparadox-interactivepermadeathplaystation-3playstation3pollps3pvpriftrift-literift-planes-of-telararvrs2s2-gamessalemsandboxsci-fantasysci-fisecret-worldsegaskill-basedSmitesoesonysony-online-entertainmentspiral-knightsspreadsheets-onlinestar-warsstar-wars-the-old-republicstarcraft-2starcraft-2-heart-of-the-swarmstarcraft-iistarcraft-ii-heart-of-the-swarmsteamstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorsyfytelonthe-old-republicthe-secret-worldthe-stream-teamthree-faction-pvpthree-ringsthree-rings-designthree-way-pvptortransmedia-synergytriontrion-worldstruly-freetswtvtwitchtwitch-tvvanguardvanguard-saga-of-heroesvgwarcraftworld-of-warcraftwowxboxMon, 25 Mar 2013 09:00:00 EST<![CDATA[Get a glimpse of The Secret World's work-in-progress Tokyo playfield]]>http://massively.joystiq.com/2013/03/23/get-a-glimpse-of-the-secret-worlds-work-in-progress-tokyo-playf/http://massively.joystiq.com/2013/03/23/get-a-glimpse-of-the-secret-worlds-work-in-progress-tokyo-playf/http://massively.joystiq.com/2013/03/23/get-a-glimpse-of-the-secret-worlds-work-in-progress-tokyo-playf/#commentsFiled under: , , , , ,

Orochi Group HQ
Want a sneak peek at The Secret World's upcoming Tokyo playfield? You only have to sit through a 13-hour train ride to get it! OK, not really, but that's what one enterprising fan did in order to see if Issue #6's Last Train to Cairo would eventually reach its destination. If you haven't played through the new content yet, there's a climatic train sequence that involves a series of boss fights, and since players can be defeated, fall off the train, or otherwise fail to complete their objectives, the train keeps going (and going... and going).

One fan decided to stay on the train for 13 hours to see what would happen, and while she didn't make it to Cairo, she was rewarded with a visit from Funcom game director Joel Bylos near the end of her marathon livestream. Bylos subsequently ported her to the work-in-progress Tokyo zone for an impromptu tour.

Tokyo plays a significant role in TSW's overarching narrative. Players first visit it during the game's subway tutorial sequence, and the shadowy Orochi Group bases its headquarters there. While the preview shows off a rough version of the zone, complete with missing textures and very few NPCs, it also shows off a ginormous playfield and gives TSW fans reason to be excited for upcoming content updates. The Tokyo sequence starts around the 13:47:00 mark of the livestream linked below.

[Thanks Elania!]

MassivelyGet a glimpse of The Secret World's work-in-progress Tokyo playfield originally appeared on Massively on Sat, 23 Mar 2013 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>buy-to-playfactionfantasyfuncomhorrorjoel-byloslast-train-to-cairomythologysci-fantasysecret-worldsecret-world-tokyoskill-basedsubscriptionlessthe-secret-worldthe-secret-world-tokyotokyotswtsw-issue-6tsw-tokyotsw-tokyo-livestreamSat, 23 Mar 2013 17:30:00 EST<![CDATA[Chaos Theory: Hoppin' TSW's train to Cairo]]>http://massively.joystiq.com/2013/03/18/chaos-theory-hoppin-tsws-train-to-cairo/http://massively.joystiq.com/2013/03/18/chaos-theory-hoppin-tsws-train-to-cairo/http://massively.joystiq.com/2013/03/18/chaos-theory-hoppin-tsws-train-to-cairo/#commentsFiled under: , , , , , ,

Chaos Theory Hoppin' that train to Cairo in TSW
It doesn't matter one iota what I had planned to talk about today, regardless of how phenomenal it may have been. The fact that The Last Train to Cairo has pulled into the station means I'm hopping on it! Yes, The Secret World's latest update hit this week with barely a day's warning and (thanks to my lifetime membership), I've been sinking my teeth into it since last Thursday.

However, in the interest of full disclosure, I have to say that I have not boarded the actual train part of the adventure. I had no interest in blowing through the new content in just a couple of days; I prefer to savor the new goodies. But I have delved pretty deeply into it and have a experienced a fair share of Issue #6. So how's the ride so far? Keep reading for a test drive, then come watch as Creative Director Joel Bylos joins me for a livestream tour on Thursday, March 21st at 11:00 a.m. EDT on Massively TV.

Continue reading Chaos Theory: Hoppin' TSW's train to Cairo

MassivelyChaos Theory: Hoppin' TSW's train to Cairo originally appeared on Massively on Mon, 18 Mar 2013 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbugsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragonfactionfaction-pvpfantasyfeaturedfuncomhand-to-handhand-to-hand-combathintshorrorilluminatiIssue-6Issue-6-The-Last-Train-to-Cairomythologynew-contentopinionpatchsabotage-missionssci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsThe-Last-Train-to-Cairothe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonupdatesMon, 18 Mar 2013 14:00:00 EST<![CDATA[Nab a discounted Secret World download with 1200 bonus points on Amazon]]>http://massively.joystiq.com/2013/03/14/nab-a-discounted-secret-world-download-with-1200-bonus-points-on/http://massively.joystiq.com/2013/03/14/nab-a-discounted-secret-world-download-with-1200-bonus-points-on/http://massively.joystiq.com/2013/03/14/nab-a-discounted-secret-world-download-with-1200-bonus-points-on/#commentsFiled under: , , , , ,

Nab a discounted dowload of TSW with 1200 bonus points on Amazon
If you've been waiting for a chance to grab The Secret World and delve into the realm of Templars, Illuminati, and Dragons, now's a good time to go for it. Amazon.com is currently offering the digital download of the conspiracy-laden game for $19.99, a $10 savings off the original price.

However, the deal gets even sweeter -- the purchase includes 1200 bonus points (the same amount members receive each month). These points can be used to obtain the new Issue #6 The Last Train to Cairo DLC that becomes available to non-subscribers on Sunday, March 17th. The DLC costs 1200 bonus points for non-members, 1080 for members, and 960 for grandmasters (lifetime subscribers). Members and grandmasters can purchase and access Issue #6 now.

MassivelyNab a discounted Secret World download with 1200 bonus points on Amazon originally appeared on Massively on Thu, 14 Mar 2013 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>AmazonAmazon.combonus-pointsbuy-to-playfactionfantasyfuncomhorrorissue-6Issue-6-The-Last-Train-to-Cairomythologysalesci-fantasysecret-worldskill-basedspecial-dealsubscriptionlessThe-Last-Train-to-Cairothe-secret-worldtswThu, 14 Mar 2013 14:00:00 EST<![CDATA[The Secret World's Issue #6 launches tomorrow [Updated]]]>http://massively.joystiq.com/2013/03/13/the-secret-worlds-issue-6-launches-tomorrow/http://massively.joystiq.com/2013/03/13/the-secret-worlds-issue-6-launches-tomorrow/http://massively.joystiq.com/2013/03/13/the-secret-worlds-issue-6-launches-tomorrow/#commentsFiled under: , , , , , , ,

The Secret World's Issue #6 launches tomorrow
Folks who don't prowl around on the likes of Twitter may have missed out on a juicy little tidbit -- namely, that The Secret World's next update is coming tomorrow, March 14th. At 8:00 a.m. EDT, servers will go down for a scheduled three-hour maintenance, at which time Issue #6 The Last Train to Cairo will be patched in. Once the content is live, players will be able to add a whip to their weapon collection, dive into the new PvP ranking system, and revel in all the other assorted goodies coming their way.

Previous announcements have noted that paid subscribers will get to access the content before others can purchase the DLC in the store, putting the launch for free players on Saturday the 16th Sunday the 17th.

[Update: Funcom announced members will have a three day headstart instead of two; the launcher notes non-subscribers will be able to buy the DLC at 10:00 a.m EDT on the 17th]

MassivelyThe Secret World's Issue #6 launches tomorrow [Updated] originally appeared on Massively on Wed, 13 Mar 2013 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>buy-to-playfactionfantasyfuncomhorrorissue-6Issue-6-The-Last-Train-to-Cairomythologynew-weaponpatchPvP-ranking-systemsci-fantasysecret-worldskill-basedsubscriptionlessThe-Last-Train-to-Cairothe-secret-worldtswupdatewhipWed, 13 Mar 2013 15:30:00 EST<![CDATA[Latest dev blog delves into the depths of The Secret World endgame]]>http://massively.joystiq.com/2013/03/13/latest-dev-blog-delves-into-the-depths-of-the-secret-world-endga/http://massively.joystiq.com/2013/03/13/latest-dev-blog-delves-into-the-depths-of-the-secret-world-endga/http://massively.joystiq.com/2013/03/13/latest-dev-blog-delves-into-the-depths-of-the-secret-world-endga/#commentsFiled under: , , , , , , ,

Latest dev blog delves into the depths of The Secret World
If your Secret World adventures have thus far only entailed playing through the main story line, according to the latest dev blog you are missing out! The post plumbs the depths of TSW's character development and progression system (the endgame, if you will), detailing what lies in store for players after they turn that last page in the story.

With such a variety of situations and so many different builds to tackle them with, mastering TSW is a very lengthy process. Part of that process entails honing skills and collecting gear by moving to successively harder dungeons. Beyond just acquiring gear, players must also augment their arsenal with crafted kickbacks, stimulants, and pure anima potions. Then there is obtaining glyphs and knowing which one to use when for the best effect. And don't forget about getting ahold of powerful signets that can be added to weapons and talismans.

Of course, with the game's flexibility, there's no one "right way" to do things, so there are plenty of ways to experiment. Want some hints to use on this path to mastery? Check out all the details in the full post.

MassivelyLatest dev blog delves into the depths of The Secret World endgame originally appeared on Massively on Wed, 13 Mar 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>buy-to-playdev-blogdungeonsend-gamefactionfantasyfuncomhorrormythologysci-fantasysecret-worldskill-basedsubscriptionlessthe-secret-worldtswWed, 13 Mar 2013 11:00:00 EST<![CDATA[Chaos Theory: Where in The Secret World is Carmen Sandiego?]]>http://massively.joystiq.com/2013/03/11/chaos-theory-where-in-the-secret-world-is-carmen-sandiego/http://massively.joystiq.com/2013/03/11/chaos-theory-where-in-the-secret-world-is-carmen-sandiego/http://massively.joystiq.com/2013/03/11/chaos-theory-where-in-the-secret-world-is-carmen-sandiego/#commentsFiled under: , , , , ,

Chaos Theory Where in The Secret World is Carmen Sandiego
OK, so I openly admit that the title's reference probably predates the majority of you (unless you've happened upon the Facebook puzzle game, which apparently there is one!), but sometimes oldies are goodies. Or they just have catchy theme songs you can't get out of your head no matter how many decades you try...

So what does the older game featuring the notorious Carmen Sandiego have to do with The Secret World? For starters, it involves solving clues to complete the objective, just as investigations missions do in the newer game. Basically, both involve using your head to continue in the story. And both also use various locales around the world as the backdrop for the adventures. It's this last one specifically that my mind has been mulling over for a bit, especially in light of recent changes.

You see, even with the roadmap sketched out for the release of the next six updates (including Tokyo, woo!), some folks are worried about TSW's smaller centralized team. There is concern that there won't be enough resources to devote to the game and that it will languish. This is so where I come in. Instead of seeing the negative, I see opportunity: Iin order to free up more developer time and energy to focus on the nuts and bolts of creating the game, I'll provide the team with new ideas for future issues. This week, let's see where in the world we'll go.

Continue reading Chaos Theory: Where in The Secret World is Carmen Sandiego?

MassivelyChaos Theory: Where in The Secret World is Carmen Sandiego? originally appeared on Massively on Mon, 11 Mar 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragonfactionfaction-pvpfantasyfeaturedfuncomhorrorilluminatimythologynew-ideasnew-zonesopinionsci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonzone-ideasMon, 11 Mar 2013 10:00:00 EST<![CDATA[The Stream Team: Pot o' gold edition, March 11 - 17, 2013]]>http://massively.joystiq.com/2013/03/11/the-stream-team-pot-o-gold-edition-march-11-17-2013/http://massively.joystiq.com/2013/03/11/the-stream-team-pot-o-gold-edition-march-11-17-2013/http://massively.joystiq.com/2013/03/11/the-stream-team-pot-o-gold-edition-march-11-17-2013/#commentsFiled under: , , , ,

The Stream Team Pot o' gold edition, March 11 17, 2013
It's a magical time: Throughout this week there will be sightings of leprechauns, lucky shamrocks will sprout up everywhere, and folks will be chasing rainbows hoping to find a special treasure. It's also the time I can say "blarney" without everyone looking at me askance! Yup, Saint Paddy's is right around the corner, the day that capstones a week when untold masses find their inner-Irish self. Those brave enough to admit they've adopted the traditions of this time can stand up and be counted in the poll at the end.

Need more to do while awaiting Sunday's revelry and pinch-a-thon? Why not watch a smorgasbord of tomfoolery on Massively TV. You can join your favorite Stream Team hosts in chat or even in game and be a part the trouble they get themselves into! Just check the schedule for the when and the where. You can also catch previous shows at your own convenience and laugh at the crazy antics displayed (and trust us, they are plenty crazy). It's all waiting for you after the break!

Continue reading The Stream Team: Pot o' gold edition, March 11 - 17, 2013

MassivelyThe Stream Team: Pot o' gold edition, March 11 - 17, 2013 originally appeared on Massively on Mon, 11 Mar 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>a-mystical-landaction-mmoactivisionaionanetarenanetascensionbiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamesconquestconsoleconsolescrypticcryptic-studiosdc-universedc-universe-onlinedcuodiablodnddotae-sporteaelectronic-artseq-2eq-iieq2eqiiesporteveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfrfree-realmsfree-to-playfuncomgrinding-geargrinding-gear-gamesguild-wars-2gw2heart-of-the-swarmheroes-of-newerthhi-rezhi-rez-studioshistoricalhonhorrorinternet-spaceshipskartugakid-friendlykidskids-mmoleap-daylight-of-novalivestreamlivestreaminglivestreamslucasartsmassively-metamassively-tvmetamobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftneverwinterpath-of-exileperfect-worldperfect-world-entertainmentplaystation-3playstation3poepollps3pvppweriftrift-literift-planes-of-telararoguelikervrs2s2-gamessandboxsci-fantasysci-fisecret-worldskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstarcraft-2starcraft-2-heart-of-the-swarmstarcraft-iistreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtortanktankstelonthe-old-republicthe-secret-worldthe-stream-teamthree-faction-pvpthree-way-pvptortriontrion-worldstruly-freetswtwitchtwitch-tvvanguardvanguard-saga-of-heroesvgwarwarcraftwargaming.netwarstory-europe-in-flamesworld-of-tanksworld-of-warcraftwotwowMon, 11 Mar 2013 09:00:00 EST<![CDATA[One Shots: Dancing with my homies]]>http://massively.joystiq.com/2013/03/10/one-shots-dancing-with-my-homies/http://massively.joystiq.com/2013/03/10/one-shots-dancing-with-my-homies/http://massively.joystiq.com/2013/03/10/one-shots-dancing-with-my-homies/#commentsFiled under: , , , , , , ,

One Shots Dancing with my homies
First of all, thank you guys so much for responding to our One Shots rallying cry and absolutely flooding us with screenshots! My cup overfloweth, and that's a delightful change of pace for this column. Even though we're quite literally set for months now, please keep sending in your favorite old or new screencaps!

To kick us off this week is Jerry, who's showing off how Anarchy Online can party down with the best of them: "This is Yardsale, a level 220 Trader, dancing with his trader pets in Borealis."

At first glance, I almost thought we were in the Matrix. But even with polygons so sharp that you can cut yourself on them, this title definitely has a style all its own. Hit the jump to see this and other wonders of the screenshotted world.

Continue reading One Shots: Dancing with my homies

MassivelyOne Shots: Dancing with my homies originally appeared on Massively on Sun, 10 Mar 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>anarchy-onlineaobring-back-one-shotsbuy-to-playcity-of-heroescity-of-villainsclassic-mmocohcovcoxf2pfactionfantasyfree-to-playfreedomfrogsterfrogster-americafrogster-interactivefuncomgalleriesgallerygameforgegameforge-berlinhorrormythologyncsoftone-shotsparagonparagon-studiospics-or-it-didnt-happenreader-screenshotsreader-submissionsromrunes-of-magicrunewakerrunewaker-entertainmentsci-fantasysci-fiscreenshotscreenshotssecret-worldskill-basedsubscriptionlesssuperherosuperheroestaboreathe-secret-worldtswuser-submissionsSun, 10 Mar 2013 10:00:00 EST<![CDATA[Funcom's Joel Bylos on the centralized TSW, AoC, and AO team]]>http://massively.joystiq.com/2013/03/07/funcoms-joel-bylos-on-the-centralized-tsw-aoc-and-ao-team/http://massively.joystiq.com/2013/03/07/funcoms-joel-bylos-on-the-centralized-tsw-aoc-and-ao-team/http://massively.joystiq.com/2013/03/07/funcoms-joel-bylos-on-the-centralized-tsw-aoc-and-ao-team/#commentsFiled under: , , , , , , , , , , , , ,

Massively Exclusive Bylos expounds on the centralized team for AO, AoC, and TSW
By now, most MMO gamers are pretty familiar with the fact that Funcom underwent restructuring. But what does that mean; what exactly did it entail? The term "restructuring" in itself signifies changes but does nothing to actually enlighten folks on what the changes are. Other than the fact that Joel Bylos was named creative director for all three of Funcom's titles -- Age of Conan, Anarchy Online, and The Secret World -- and that the team will be in one centralized in location, we know little of the details.

How many developers survived the restructuring and relocated to remain on the team? Is this move foreshadowing one or more games slipping into maintenance mode? How will the coveted dev attention be divvied up? What does the future hold? Devoid of facts, players are left left wondering about how these changes will impact their favorite games.

While chatting with Joel Bylos in an exclusive interview, I was able to ask some of these very questions.

Continue reading Funcom's Joel Bylos on the centralized TSW, AoC, and AO team

MassivelyFuncom's Joel Bylos on the centralized TSW, AoC, and AO team originally appeared on Massively on Thu, 07 Mar 2013 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>age-of-conanage-of-conan-unchainedanarchy-onlineaoaocaoc-unchainedbuy-to-playcentralized-temaclassic-mmoconanf2pfactionfantasyfeaturedfree-to-playfuncomhorrorhyboriainterviewinterviewsJoel-Bylosmassively-exclusiveMassively-exclusive-interviewmassively-exclusive-interviewsmythologyrestructuringsci-fantasysci-fisecret-worldskill-basedsubscriptionlessthe-secret-worldtswunchainedThu, 07 Mar 2013 17:30:00 EST<![CDATA[Did you hear? The Secret World music contest winners announced]]>http://massively.joystiq.com/2013/03/06/did-you-hear-the-secret-world-music-contest-winners-announced/http://massively.joystiq.com/2013/03/06/did-you-hear-the-secret-world-music-contest-winners-announced/http://massively.joystiq.com/2013/03/06/did-you-hear-the-secret-world-music-contest-winners-announced/#commentsFiled under: , , , , , , , ,

Did you hear The Secret World music contest winners announced
A few weeks ago The Secret World offered musicians the chance to weave their original melodies into the fabric of the conspiracy-laden game. Many heeded that call and over 300 submissions were received, some containing multiple compositions.

Instead of the originally intended five, 11 selections were chosen for inclusion in TSW. The winning music -- with titles like When Scouts Go Bad, I'll be the Death of You, Save Me, and The Zombie Stare -- will be introduced in Issue #7. Players will hear these pieces played on different radios throughout the game, such as those at The Ravens Knock and Susie's Diner in Kingsmouth, PC Bang in Seoul, and London's The Crusades nightclub. Congratulations to all the winners!

[Thanks to Samantha for the tip!]

MassivelyDid you hear? The Secret World music contest winners announced originally appeared on Massively on Wed, 06 Mar 2013 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>buy-to-playcontest-winnersfactionfantasyfuncomhorrormusi-competitionmusic-contentmusic-contestmythologyplayer-musicsci-fantasysecret-worldskill-basedsubscriptionlessthe-secret-worldtswWed, 06 Mar 2013 12:00:00 EST<![CDATA[Chaos Theory: The Secret World needs bug spray in Egypt, stat!]]>http://massively.joystiq.com/2013/03/04/chaos-theory-the-secret-world-needs-bug-spray-in-egypt-stat/http://massively.joystiq.com/2013/03/04/chaos-theory-the-secret-world-needs-bug-spray-in-egypt-stat/http://massively.joystiq.com/2013/03/04/chaos-theory-the-secret-world-needs-bug-spray-in-egypt-stat/#commentsFiled under: , , , , , , ,

Chaos Theory The Secret World needs bug spray in Egypt, stat!
Talk about timing.

Recently, you all voted that I continue my adventures on my Templar. The timing was impeccable because right in the middle of that vote, The Secret World's next issue was announced. And where will this update be focused? Why, in Egypt -- right where my Templar just so happens to be! Fortuitous for me, to be sure. So I have been (mostly) happily blasting my way through the desert with a shotgun at my hip and a rifle slung across my back, enjoying new-to-me content and anticipating the upcoming new-to-everyone goodies.

But not all timing has been good. As mentioned, I've been mostly enjoying my tales in the desert. Why the caveat? There's a bit of an infestation in Egypt, and I am not talking about the beetles that want to devour Said. The place is crawling with bugs! Besides swarming with giant locusts and their tentacled proboscises, Egypt also appears to have a higher prevalence of glitches. I have never encountered so many bugs in all of TSW as I have in a couple of days in that zone. And all at a time when the dev team is dealing with relocation and hasn't been able to jump right in and douse the area with a giant can of Raid.

The timing is particularly bad because it's unfortunately right when all eyes are turning to Egypt on the eve of Issue #6. How this release plays out will have lasting affects on the game and how folks view it.

Continue reading Chaos Theory: The Secret World needs bug spray in Egypt, stat!

MassivelyChaos Theory: The Secret World needs bug spray in Egypt, stat! originally appeared on Massively on Mon, 04 Mar 2013 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbugsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragonfactionfaction-pvpfantasyfeaturedfuncomhorrorilluminatiIssue-6Issue-6-The-Last-Train-to-Cairomythologyopinionsci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstiming-is-everythingtswtsw-chaos-theorytsw-dragonMon, 04 Mar 2013 17:00:00 EST<![CDATA[The Secret World dev blog expounds on Issue #6 PvP changes]]>http://massively.joystiq.com/2013/03/04/the-secret-world-dev-blog-expounds-on-issue-6-pvp-changes/http://massively.joystiq.com/2013/03/04/the-secret-world-dev-blog-expounds-on-issue-6-pvp-changes/http://massively.joystiq.com/2013/03/04/the-secret-world-dev-blog-expounds-on-issue-6-pvp-changes/#commentsFiled under: , , , , , , , ,

The Secret World dev blog expounds on Issue #6 PvP changes
When Issue #6 Last Train to Cairo was announced for The Secret World, a new PvP ranking system was briefly touched upon. In today's dev blog, system designer Tim Donks goes into more detail about this new feature as well as the matchmaking system.

In response to player requests for PvP rewards, Issue #6 is introducing Battle Ranks. By gaining PvP experience (which is shared among all group members who are present and alive at the time of the enemy kill), players can climb the ranks of PvP prowess, earning special tokens along the way to spend on various PvP rewards, including uniforms that are automatically equipped when entering PvP. An important note about PvP experience: Less XP is earned for each subsequent kill of the same player within the battlegrounds, Fusang, and the fight clubs until nothing is gained. This diminishing rewards system resets for each new trip into a PvP zone.

Once the update hits, players will also be able to queue for multiple battlegrounds at the same time. Also expected in Issue #6 -- or shortly thereafter -- players' wins and losses in PvP matches will be tracked to improve the matchmaking mechanic.

MassivelyThe Secret World dev blog expounds on Issue #6 PvP changes originally appeared on Massively on Mon, 04 Mar 2013 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>battlegroundsbuy-to-playdev-blogdev-diaryfactionfantasyfuncomFusanghorrorissue-6Issue-6-The-Last-Train-to-CairomythologyPvPPvP-ranking-systemPvP-rankssci-fantasysecret-worldskill-basedsubscriptionlessthe-secret-worldTim-DonkstswupdateMon, 04 Mar 2013 12:00:00 EST<![CDATA[The Stream Team: Cult fever edition, March 4 - 10, 2013]]>http://massively.joystiq.com/2013/03/04/the-stream-team-cult-fever-edition-march-4-10-2013/http://massively.joystiq.com/2013/03/04/the-stream-team-cult-fever-edition-march-4-10-2013/http://massively.joystiq.com/2013/03/04/the-stream-team-cult-fever-edition-march-4-10-2013/#commentsFiled under: , , , ,

The Stream Team MLT edition, March 4 10, 2013

It can strike out of nowhere: that random line or twenty from one of the movie greats just rockets out of your mouth. But I'm not talking about some box office smash. Oh no, I'm talking about the truly defining films of our culture -- the cult classics! With their quirkiness, their courage to stretch beyond the boundaries of the industry, and of course those sensationally memorable lines, these films embedded themselves in our psyches and helped shape our social environment.

Wouldn't it be great to have been at the dawning of these bits of history? Well why not be at the start of a budding cult classic? While there are no guarantees, there's certainly a possibility that one of Massively TV's shows will rise up and join the hallowed annals of cult status. You never know, so why deny yourself the opportunity and live with regret?

Check out this week's Stream Team schedule after the cut and be a part of history in the making, all while enjoying the crazy commentary of your favorites hosts as they show off new betas and old standbys alike. Then vote for your favorite movie to MMO conversion in our poll at the end.

Continue reading The Stream Team: Cult fever edition, March 4 - 10, 2013

MassivelyThe Stream Team: Cult fever edition, March 4 - 10, 2013 originally appeared on Massively on Mon, 04 Mar 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmoanetarenanetbiowarebrowserbrowser-basedbuy-to-playccpccp-gamesclone-warsclone-wars-adventuresconquestconsoleconsolescrypticcryptic-studioscwadc-universedc-universe-onlinedcuodiablodnddotae-sporteaelectronic-artseq-2eq-iieq2eqiiesporteveeve-onlineeverquest-2everquest-iif2pfactionfamilyfantasyfeaturedfrfree-realmsfree-to-playfuncomgame-of-thrones-ascentgrinding-geargrinding-gear-gamesguild-wars-2gw2heart-of-the-swarmheroes-of-newerthhi-rezhi-rez-studioshonhorrorinternet-spaceshipskartugakid-friendlykidskids-mmokingsislekingsisle-entertainmentLeap-Daylivestreamlivestreaminglivestreamslobbylucasartsmassively-metamassively-tvmetaminigameministry-of-warmobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftneverwinterpath-of-exileperfect-worldperfect-world-entertainmentpiratepirate101piratesplaystation-3playstation3poepollps3pvppweRenaissance-Heroesriftrift-literift-planes-of-telararoguelikervrs2s2-gamessandboxsci-fantasysci-fisecret-worldshakes-and-fidgetskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstarcraft-2starcraft-iistarcraft-ii-heart-of-the-swarmstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtortelonthe-old-republicthe-secret-worldthe-stream-teamthree-faction-pvpthree-way-pvptortriontrion-worldstswtwitchtwitch-tvvanguardvanguard-saga-of-heroesvgMon, 04 Mar 2013 09:00:00 EST<![CDATA[The Daily Grind: Is 'maintenance mode' really a negative?]]>http://massively.joystiq.com/2013/02/28/the-daily-grind-is-maintenance-mode-really-a-negative/http://massively.joystiq.com/2013/02/28/the-daily-grind-is-maintenance-mode-really-a-negative/http://massively.joystiq.com/2013/02/28/the-daily-grind-is-maintenance-mode-really-a-negative/#commentsFiled under: , ,

The Secret World - Gunners
This week's news of Funcom naming Joel Bylos the creative director on all three of its MMORPGs was met with some predictable "maintenance mode!" and "yay, Funcom's failing" rhetoric in our comment section. While neither of these suppositions are based in reality, the former got me to thinking, and what I thought was that "maintenance mode" isn't an automatic negative to me like it appears to be to some folk.

For one thing, I play a ton of MMOs, and for another, I'm not exactly a content locust since it usually takes me several months to max out an avatar (and several more after that to gear him up). I can see why the hurry-up-and-beat-the-endgame crowd would be cross with a title that doesn't add new content every other week, but for me that's not only OK, it's preferable since it means that I might actually see all of the content, finish all of the story arcs, and get some use out of my gear.

Time between content updates also means time that I get to explore, socialize, roleplay, and do all the stuff that MMOs facilitate beyond the basic treadmill. What about you, Massively readers? Is "maintenance mode" a turnoff or does it give you time to catch your breath?

Every morning, the Massively bloggers probe the minds of their readers with deep, thought-provoking questions about that most serious of topics: massively online gaming. We crave your opinions, so grab your caffeinated beverage of choice and chime in on today's Daily Grind!?

MassivelyThe Daily Grind: Is 'maintenance mode' really a negative? originally appeared on Massively on Thu, 28 Feb 2013 08:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>age-of-conanage-of-conan-unchainedanarchy-onlineaoaocaoc-unchainedbuy-to-playclassic-mmoconancontent-locustsdaily-grindf2pfactionfantasyfree-to-playfuncomhorrorhyboriamythologyopinionsci-fantasysci-fisecret-worldskill-basedsubscriptionlesstdgthe-daily-grindthe-secret-worldtswunchainedThu, 28 Feb 2013 08:00:00 EST<![CDATA[Funcom's Bylos named creative director on AoC, AO, and TSW]]>http://massively.joystiq.com/2013/02/26/bylos-named-funcom-creative-director-overseeing-tsw-aoc-and-a/http://massively.joystiq.com/2013/02/26/bylos-named-funcom-creative-director-overseeing-tsw-aoc-and-a/http://massively.joystiq.com/2013/02/26/bylos-named-funcom-creative-director-overseeing-tsw-aoc-and-a/#commentsFiled under: , , , , , , , ,

Bylos named Funcom creative director, overseeing TSW, AoC, and AO
Funcom has announced that The Secret World creative director Joel Bylos is now the creator director for all three of the firm's MMORPGs. This includes TSW, Age of Conan, and Anarchy Online. Bylos has penned letters from the game director for TSW and AoC, while AO's Dave "Ilaliya" Williams passes the torch via a forum post.

Bylos' TSW letter talks additional content plans up to and including Issue #12 (the live game currently sits on Issue #5, with #6 scheduled for early March). Bylos has a special place in his heart for AoC stemming from his time as the lead designer on the Rise of the Godslayer expansion, and his initial game director letter reflects on both coming home and the opportunities for expanding Hyboria. He also talks a bit about the pros and cons of having a single production team working on three live titles.

Finally, outgoing AoC producer Craig "Silirrion" Morrison recaps his four years at the helm and hints at a "new opportunity within the MMO world."

[Thanks to David for the tip.]

MassivelyFuncom's Bylos named creative director on AoC, AO, and TSW originally appeared on Massively on Tue, 26 Feb 2013 11:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>age-of-conanage-of-conan-unchainedanarchy-onlineaoaocaoc-unchainedbuy-to-playbylos-new-creative-directorclassic-mmoconancraig-morrisonf2pfactionfantasyfree-to-playfuncomhorrorhyboriajoel-bylosmythologysci-fantasysci-fisecret-worldsilirrionskill-basedsubscriptionlessthe-secret-worldtswunchainedTue, 26 Feb 2013 11:30:00 EST<![CDATA[Chaos Theory Extra: Bylos interview unearths more about TSW's Issue #6]]>http://massively.joystiq.com/2013/02/25/chaos-theory-extra-bylos-interview-unearths-more-about-tsws-is/http://massively.joystiq.com/2013/02/25/chaos-theory-extra-bylos-interview-unearths-more-about-tsws-is/http://massively.joystiq.com/2013/02/25/chaos-theory-extra-bylos-interview-unearths-more-about-tsws-is/#commentsFiled under: , , , , , , ,

Chaos Theory Extra Bylos interview unearths moreabout TSW's Issue #6
By now, it's no secret that I am excited for The Secret World's next update with its new story arc and new reward systems. Oh, and whips -- we can't forget the whips. I did, after all, mention it a bit earlier today. So it shouldn't be any surprise that I want to find out as much as I can about The Last Train to Cairo. With that in mind, I caught up with Creative Director Joel Bylos to unearth a few more tidbits about Issue #6 and beyond to pass along to you.

Keep reading for a discussion on the state of the team's relocation, word on when players can expect their first trip to Venice, and a few hints about future auxiliary weapons as well as the inspiration behind this update.

Continue reading Chaos Theory Extra: Bylos interview unearths more about TSW's Issue #6

MassivelyChaos Theory Extra: Bylos interview unearths more about TSW's Issue #6 originally appeared on Massively on Mon, 25 Feb 2013 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragonfactionfaction-pvpfantasyfeaturedfuncomhorrorilluminatiinterviewinterviewsissue-6Issue-6-The-Last-Train-to-CairoJoel-Bylosmythologyopinionsci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsThe-Last-Train-to-Cairothe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonMon, 25 Feb 2013 17:00:00 EST