Massively http://massively.joystiq.com Massively http://www.blogsmithmedia.com/http://massively.joystiq.com/media/feedlogo.gif Massively http://massively.joystiq.com en-us Copyright 2012 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[The Firing Line: PlanetSide 2's Matt Higby on the MMOFPS revolution]]>http://massively.joystiq.com/2012/05/26/the-firing-line-planetside-2s-matt-higby-on-the-mmofps-revolut/http://massively.joystiq.com/2012/05/26/the-firing-line-planetside-2s-matt-higby-on-the-mmofps-revolut/http://massively.joystiq.com/2012/05/26/the-firing-line-planetside-2s-matt-higby-on-the-mmofps-revolut/#commentsFiled under: , , , , , , , , , , , ,

The Firing Line interviews PlanetSide 2's Matt Higby
Sony Online Entertainment has begun carpet-bombing media outlets with publicity relating to its upcoming PlanetSide 2 MMOFPS. The game has been in development for quite a while now, but up until very recently the devs have kept a low profile. Now the title's Twitter feed is exploding on a daily basis, awe-inspiring alpha gameplay videos are finding their way into the public eye, and interviews abound.

I managed to get creative director Matt Higby's attention for a few moments, and he's got some interesting things to say about PS2's upside. Would you believe that MMOFPS is about to become a new industry buzzword? Read on after the break.

Continue reading The Firing Line: PlanetSide 2's Matt Higby on the MMOFPS revolution

MassivelyThe Firing Line: PlanetSide 2's Matt Higby on the MMOFPS revolution originally appeared on Massively on Sat, 26 May 2012 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>classic-mmofeaturedfiring-linefpsinterviewmatt-higbymatt-higby-interviewmmo-shootermmofpsopinionplanetsideplanetside-2planetside-2-interviewpsps1ps2pvpsci-fishootersoesonysony-online-entertainmenttflthe-firing-linethird-person-shootertpsSat, 26 May 2012 12:00:00 EST<![CDATA[The MMO Report: Pre-E3 edition]]>http://massively.joystiq.com/2012/05/25/the-mmo-reports-pre-e3-special/http://massively.joystiq.com/2012/05/25/the-mmo-reports-pre-e3-special/http://massively.joystiq.com/2012/05/25/the-mmo-reports-pre-e3-special/#commentsFiled under: , , , , , , ,

The MMO Report
Heads up, ladies and gents; it's time for a special pre-E3 edition of The MMO Report. That's right, the biggest event in the industry is rolling out the proverbial red carpet next week, and MMOs have plenty on the slate for the big event. G4's fabulous Casey Schreiner has a look at some of the big pre-E3 MMO news, as well as a taste of what players can expect from the convention.

For your appetizer, we have a look at the three factions of ZeniMax's upcoming title, The Elder Scrolls Online. You can wash that down with a tall glass of Trion Worlds' MMO-television crossover game, Defiance. That should be sufficient to prepare you for the main course of PlanetSide 2's delicious MAX suit reveal, as well as a few more post-meal treats. So what are you waiting for? Pull up a seat and check out the full video below.

Continue reading The MMO Report: Pre-E3 edition

MassivelyThe MMO Report: Pre-E3 edition originally appeared on Massively on Fri, 25 May 2012 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>casey-schreinerdefiancehumormmo-reportnewsopinionplanetside-2ps2rounduptesothe-elder-scrollsthe-elder-scrolls-onlinethe-mmo-reporttrailertrailersvideovideosFri, 25 May 2012 18:30:00 EST<![CDATA[PlanetSide 2 unveils the Mechanized Assault Exo-Suit]]>http://massively.joystiq.com/2012/05/25/planetside-2-unveils-the-mechanized-assault-exo-suit/http://massively.joystiq.com/2012/05/25/planetside-2-unveils-the-mechanized-assault-exo-suit/http://massively.joystiq.com/2012/05/25/planetside-2-unveils-the-mechanized-assault-exo-suit/#commentsFiled under: , , , , , ,

Screenshot -- PlanetSide 2
Heads up, PlanetSide 2 fans; today, Sony Online Entertainment has released some new battlefield intel for you on the game's "most heavy-duty class": the Mechanized Assault Exo-Suit, or MAX. PlanetSide 2's MAX suit "serves as a mobile weapons platform, capable of unleashing a serious beating," and will prove incredibly valuable to players in the field.

Thanks to the game's modular weapons system, MAX suits can be customized to deal with specific threats, or they can be outfitted with a more generic loadout to provide all-around support on the warzones. Each faction's version of the MAX suit will come with abilities specific to that faction. Add to that a nice, hefty layer of armor plating, and you've got a force to be reckoned with in any battlefield situation. For a first look at the formidable exosuits, check out the gallery below.

[Source: Sony Online Entertainment press release]

Gallery: PlanetSide 2

MassivelyPlanetSide 2 unveils the Mechanized Assault Exo-Suit originally appeared on Massively on Fri, 25 May 2012 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>fpsgalleriesgallerymaxmax-suitmechanized-assault-exo-suitmmo-shootermmofpsplanetsideplanetside-2ps2sci-fiscreenshotscreenshotsshootersoesonysony-online-entertainmentFri, 25 May 2012 14:00:00 EST<![CDATA[The Firing Line: Epic SOE memories on PlanetSide's ninth anniversary]]>http://massively.joystiq.com/2012/05/25/the-firing-line-epic-soe-memories-on-planetsides-ninth-anniver/http://massively.joystiq.com/2012/05/25/the-firing-line-epic-soe-memories-on-planetsides-ninth-anniver/http://massively.joystiq.com/2012/05/25/the-firing-line-epic-soe-memories-on-planetsides-ninth-anniver/#commentsFiled under: , , , , , , , , , , , , , ,

The Firing Line - Epic SOE memories on PlanetSide's ninth anniversary
So PlanetSide is nine years old this week (nine!), and Sony Online Entertainment is journeying down memory lane to look back at its ground-breaking MMOFPS. The firm is of course hard at work on the sequel, but some of the devs have taken a time-out to share their favorite memories with us.

Though the word "epic" is overused in MMO discourse, it's a recurring theme here. Due to the size, scope, and sheer ambition on display in the original PlanetSide, it's actually appropriate too. While you're reminiscing with the devs, take a stroll through our side-by-side gallery that compares vehicles and equipment from the original PlanetSide with their counterparts in PlanetSide 2.

Gallery: PlanetSide vs. PlanetSide 2 comparisons

Continue reading The Firing Line: Epic SOE memories on PlanetSide's ninth anniversary

MassivelyThe Firing Line: Epic SOE memories on PlanetSide's ninth anniversary originally appeared on Massively on Fri, 25 May 2012 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>andrew-rischclassic-mmodave-georgesonfeaturedfiring-linefpsmargaret-krohnmmo-shootermmofpsopinionplanetsideplanetside-2planetside-aftershockplanetside-dev-memoriesplanetside-epic-momentsplanetside-memoriespsps1ps2pvpsci-fishootersoesonysony-online-entertainmenttflthe-firing-linethird-person-shooterthom-terrazastpstramell-isaacFri, 25 May 2012 11:00:00 EST<![CDATA[Take to the skies with PlanetSide 2's aerial combat trailer]]>http://massively.joystiq.com/2012/05/24/take-to-the-skies-with-planetside-2s-aerial-combat-trailer/http://massively.joystiq.com/2012/05/24/take-to-the-skies-with-planetside-2s-aerial-combat-trailer/http://massively.joystiq.com/2012/05/24/take-to-the-skies-with-planetside-2s-aerial-combat-trailer/#commentsFiled under: , , , , , ,

Screenshot -- PlanetSide 2
Infantry may make up the bulk of PlanetSide 2's armies, but there's much more to a solid fighting force than footsoldiers. A new video of the game from Sony Online Entertainment shines the spotlight on the various forms of aerial support available to the PlanetSide 2 factions.

We're not just talking about a few bombers and personnel carriers, either; the video shows off some rather impressive dogfights between a great number of players as well as a few strafing runs against some unfortunate ground units. While it's only a short teaser, it definitely gives players a sense of the kind of explosion-filled excitement players can expect from the game's aerial combat when they finally get in the cockpit. Just click on past the cut to see the whole video with your own eyes.

Continue reading Take to the skies with PlanetSide 2's aerial combat trailer

MassivelyTake to the skies with PlanetSide 2's aerial combat trailer originally appeared on Massively on Thu, 24 May 2012 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>aerial-combatair-combatfpsmmo-shootermmofpsplanetsideplanetside-2ps2sci-fishootersoesonysony-online-entertainmenttrailertrailersvideovideosThu, 24 May 2012 17:30:00 EST<![CDATA[PlanetSide 2 video features night ops, 23 minutes of alpha gameplay]]>http://massively.joystiq.com/2012/05/17/planetside-2-video-features-night-ops-23-minutes-of-alpha-gamep/http://massively.joystiq.com/2012/05/17/planetside-2-video-features-night-ops-23-minutes-of-alpha-gamep/http://massively.joystiq.com/2012/05/17/planetside-2-video-features-night-ops-23-minutes-of-alpha-gamep/#commentsFiled under: , , , , , , , , , ,

PlanetSide 2 - cockpit view
Curious about the current state of PlanetSide 2? TotalBiscuit recently traveled to Sony Online Entertainment's San Diego headquarters for some hands-on time with the upcoming MMOFPS. What he saw was pretty impressive (we know this because we saw it too, thanks to his video, which we've embedded after the break).

While the game is still in early alpha, we think there's plenty to be excited about, judging by the 23-minute clip. We get a good look at night-fighting, ground and air combat, and an interesting tank vs. foot-soldier matchup that doesn't turn out like you might expect.

Continue reading PlanetSide 2 video features night ops, 23 minutes of alpha gameplay

MassivelyPlanetSide 2 video features night ops, 23 minutes of alpha gameplay originally appeared on Massively on Thu, 17 May 2012 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>fpsmmo-shootermmofpsnight-fightingplanetsideplanetside-2planetside-2-night-fightingplanetside-2-night-opsps2sci-fishootersoesonysony-online-entertainmentvideoThu, 17 May 2012 14:00:00 EST<![CDATA[Matt Higby discusses PlanetSide 2's progression and customization]]>http://massively.joystiq.com/2012/05/02/matt-higby-discusses-planetside-2s-progression-and-customizatio/http://massively.joystiq.com/2012/05/02/matt-higby-discusses-planetside-2s-progression-and-customizatio/http://massively.joystiq.com/2012/05/02/matt-higby-discusses-planetside-2s-progression-and-customizatio/#commentsFiled under: , , , , , ,

I'm not actually in the war, I just like riding this ATV.
PlanetSide 2 has but one real game it must live up to, but if you consider the unique elements that its predecessor brought to the table, that's still a tall order. A recent interview with the game's creative director, Matt Higby, highlights the ways that the game is being designed to fulfill the requirements of an engaging MMO and an engaging FPS. That means giving characters plenty of progression without locking out new players who just want to shoot things.

The game's overall progression path is meant to be one of options, not straight power. That's the case for classes as well as advancement; Heavy Assault characters will play distinctly from other classes, but they'll have a variety of unique abilities that players can choose among. The interview also sheds more light on what players can expect from the game's overarching persistent elements, which set the game and its factions apart from standard FPS fare. The game still has a long way to go in development, but what's been shown thus far is definitely an encouraging start.

MassivelyMatt Higby discusses PlanetSide 2's progression and customization originally appeared on Massively on Wed, 02 May 2012 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>developmentfpsinterviewsmatt-higbymmo-shootermmofpsnew-titlesplanetsideplanetside-2previewsps2sci-fishootersoesonysony-online-entertainmentupcoming-titlesWed, 02 May 2012 17:00:00 EST<![CDATA[Strike like Lightning with PlanetSide 2's latest vehicle reveal]]>http://massively.joystiq.com/2012/04/27/strike-like-lightning-with-planetside-2s-latest-vehicle-reveal/http://massively.joystiq.com/2012/04/27/strike-like-lightning-with-planetside-2s-latest-vehicle-reveal/http://massively.joystiq.com/2012/04/27/strike-like-lightning-with-planetside-2s-latest-vehicle-reveal/#commentsFiled under: , , ,

Screenshot -- PlanetSide 2
In PlanetSide 2, wars are not won by infantry alone. Sometimes you've gotta bring in the big guns, and sometimes you've gotta attach those big guns to even bigger tanks that can turn unwitting enemy foot soldiers into a fine crimson smear on the ground. For those times, Sony Online Entertainment has announced the latest Nanite Systems vehicle, the Lightning.

The lightning is a lightweight 75mm tank that uses its mobility and obscene rate of fire to rain havoc upon the battlefield while avoiding enemy counterattacks. The one-man tank can fire up to six rounds in under three seconds, "allowing the driver to quickly adjust [his] aim after [his] first shot." The modular turret can be swapped out for a variety of other turret types for those times when you just want to mix it up a bit, and the Lightning's Skyguard turret is "the most effective ground-to-air weapon on the battlefield, as it's fitted with 40mm cannons with an elevation range of 80 degrees." To top it all off, the Lightning is one of the fastest ground vehicles, which makes it just as useful for tactical retreats as it is for vehicular manslaughter. The vehicle will be available to all three factions, so no matter which side you're fighting for, you can rest assured that you'll have some speedy firepower at your disposal.

[Source: Sony Online Entertainment press release]

MassivelyStrike like Lightning with PlanetSide 2's latest vehicle reveal originally appeared on Massively on Fri, 27 Apr 2012 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>fpslightningmmo-shootermmofpspew-pew-gunsplanetsideplanetside-2ps2sci-fishootersoesonysony-online-entertainmenttanktanksvehiclevehiclesFri, 27 Apr 2012 16:00:00 EST<![CDATA[PlanetSide 2 fan trailer delivers fan service]]>http://massively.joystiq.com/2012/04/16/planetside-2-fan-trailer-delivers-fan-service/http://massively.joystiq.com/2012/04/16/planetside-2-fan-trailer-delivers-fan-service/http://massively.joystiq.com/2012/04/16/planetside-2-fan-trailer-delivers-fan-service/#commentsFiled under: , , , , , , , , , ,

PlanetSide 2 - fan trailer
Sony Online Entertainment hasn't shown much in the way of PlanetSide 2 video footage aside from the GDC demo and a recent alpha clip, so anxious fans are turning to their own devices in order to get their three-faction open-world sci-fi fix.

A user named Nax has cut together a two-minute clip and posted it on both YouTube and the PlanetSide Universe forums. The short makes good use of the alpha video as well as some pre-existing teaser trailer footage in order to showcase PS2's frenetic action and large environments. We also get a stirring soundtrack compliments of Thomas Bergersen (one half of the prolific trailer-music duo known as Two Steps from Hell).

Check out the goods after the break.

Continue reading PlanetSide 2 fan trailer delivers fan service

MassivelyPlanetSide 2 fan trailer delivers fan service originally appeared on Massively on Mon, 16 Apr 2012 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>auraxisfan-trailerfan-videofpsmmo-shootermmofpsplanetsideplanetside-2planetside-2-fan-trailerplanetside-2-trailerps2sci-fishootersoesonysony-online-entertainmentvideoMon, 16 Apr 2012 12:00:00 EST<![CDATA[PAX East 2012: A talk with PlanetSide 2's Matt Higby]]>http://massively.joystiq.com/2012/04/06/pax-east-2012-a-talk-with-planetside-2s-matt-higby/http://massively.joystiq.com/2012/04/06/pax-east-2012-a-talk-with-planetside-2s-matt-higby/http://massively.joystiq.com/2012/04/06/pax-east-2012-a-talk-with-planetside-2s-matt-higby/#commentsFiled under: , , , , , , , ,

PlanetSide 2
"For me, it's such a compelling genre for anybody who's played it," SOE Creative Director Matt Higby said about PlanetSide 2's niche. "But that's the thing. There's not a lot of people who have played a MMOFPS, but the people who have are addicted."

Hibgy sat down with us at PAX East to promote SOE's upcoming sci-fi shooter, saying that it scratches two itches with one bird (or some other mixed metaphor). "I'm a competitive player; I love shooters," he said, "but I'm also a very social player and love the progression aspect of MMOs."

It's not as if the MMOFPS field is going to remain wide-open for very long. Competitors are rushing to mine this largely untouched market. Still, SOE has an advantage above the rest: It launched one of the first of its kind and has years of experience managing such a game. While we anxiously wait for word on PlanetSide 2's beta, we listened to Higby tell us why this title will continue the company's reign over the genre.

Continue reading PAX East 2012: A talk with PlanetSide 2's Matt Higby

MassivelyPAX East 2012: A talk with PlanetSide 2's Matt Higby originally appeared on Massively on Fri, 06 Apr 2012 22:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabiowareclassic-mmoconconventione3eaelectronic-artsexpofpsgdclucasartsmatt-higbymmo-shootermmofpspaxpax-2012pax-eastpax-east-2012penny-arcade-expoplanetsideplanetside-2psps1ps2sci-fishootersoesonysony-online-entertainmentstar-warsstar-wars-the-old-republicsubsubscription-feeswtorteam-fortress-2the-old-republictorFri, 06 Apr 2012 22:00:00 EST<![CDATA[SOE time-lapse video shows PlanetSide 2's Scope 4X]]>http://massively.joystiq.com/2012/04/04/soe-time-lapse-video-shows-planetside-2s-scope-4x/http://massively.joystiq.com/2012/04/04/soe-time-lapse-video-shows-planetside-2s-scope-4x/http://massively.joystiq.com/2012/04/04/soe-time-lapse-video-shows-planetside-2s-scope-4x/#commentsFiled under: , , , , , , , , , ,

PlanetSide 2 - NC Scope 4X
Planning on playing for the New Conglomerate faction in PlanetSide 2? If so, you'll want to check out the new video we've got for you after the break.

Sony Online Entertainment has put together a three-minute piece detailing the NC's Scope 4X (and no, we're not kidding -- it really is a video about a rifle scope). While the 4X may seem like an odd choice for a dev diary clip, it's actually indicative of the amount of work SOE is pouring into its open-world MMOFPS.

SOE senior artist Patrick Ho steps us through the complete design process, and we get a long look at thumbnail sketches, 3-D modeling, painting, and the fine details that typify PlanetSide 2's gear.

Continue reading SOE time-lapse video shows PlanetSide 2's Scope 4X

MassivelySOE time-lapse video shows PlanetSide 2's Scope 4X originally appeared on Massively on Wed, 04 Apr 2012 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>designdesign-videofpsmmo-shootermmofpsnew-conglomeratepatrick-hoplanetsideplanetside-2ps2ps2-scope-4xsandboxsci-fiscope-4xshootersoesonysony-online-entertainmenttime-lapse-videovideoWed, 04 Apr 2012 14:00:00 EST<![CDATA[EverQuest Online Adventures slays its final dragon]]>http://massively.joystiq.com/2012/03/29/everquest-online-adventures-slays-its-final-dragon/http://massively.joystiq.com/2012/03/29/everquest-online-adventures-slays-its-final-dragon/http://massively.joystiq.com/2012/03/29/everquest-online-adventures-slays-its-final-dragon/#commentsFiled under: , , ,

EQOA
EverQuest Online Adventures, the console spinoff of SOE's EverQuest franchise, is counting down the hours until the server is switched off at midnight tonight. In addition to EQOA, SOE is shuttering three other underperforming titles today: Cosmic Rift, Infantry, and Star Chamber: The Harbinger Saga.

Instead of spending its final days in sorrow, the EQOA community joined the dev team for a series of epic battles against marauding dragons this past week. Players have filled the forums with posts about their favorite in-game memories over the past nine years of gameplay. To compensate players for the loss of their game world, SOE gave EQOA subscribers three months of gold-level status in EverQuest and EverQuest II.

EQOA came out in 2003 on the PlayStation 2 and was one of the first generation of console MMOs. For those Massively readers feeling nostalgic or curious about it, definitely check out our series on the game: part 1, part 2, and part 3.

MassivelyEverQuest Online Adventures slays its final dragon originally appeared on Massively on Thu, 29 Mar 2012 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>cancelclosureconsoleconsole-mmoCosmic-Rifteqeq-iieqoaeverquesteverquest-iieverquest-onlineeverquest-online-adventuresInfantryplaystation-2ps2soesony-online-entertainmentStar-Chamber-The-Harbinger-SagasunsetsunsettingThu, 29 Mar 2012 16:00:00 EST<![CDATA[SOE releases PlanetSide 2 alpha gameplay video]]>http://massively.joystiq.com/2012/03/29/soe-releases-planetside-2-alpha-gameplay-video/http://massively.joystiq.com/2012/03/29/soe-releases-planetside-2-alpha-gameplay-video/http://massively.joystiq.com/2012/03/29/soe-releases-planetside-2-alpha-gameplay-video/#commentsFiled under: , , , , , , , , , ,

PlanetSide 2 - Vanguard vs. foot soldier
Want to see some new PlanetSide 2 gameplay action? We do too, and fortunately Gametrailers has a bit of it in the form of a new video. We use the word "new" loosely here because the footage was filmed earlier this month at GDC, and there's not a whole lot of info contained therein that fans of the game didn't already know.

Still, three minutes of gameplay is nothing to sneeze at, and we get a decent look at ground combat, air combat, and various forms of vehicular combat (as well as all the requisite UIs). The clip is narrated by PlanetSide 2 creative director Matt Higby, who provides a layman's introduction to the massive world of Auraxis as well as all the customizable gameplay that Sony Online Entertainment is building into its MMOFPS sequel.

Don't take our word for it, though. Check out the full video after the break.

Continue reading SOE releases PlanetSide 2 alpha gameplay video

MassivelySOE releases PlanetSide 2 alpha gameplay video originally appeared on Massively on Thu, 29 Mar 2012 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>auraxisfpsgameplay-videomatt-higbymmo-shootermmofpsplanetsideplanetside-2planetside-2-gameplay-videoplanetside-2-videops2sandboxsci-fishootersoesonysony-online-entertainmentvideoThu, 29 Mar 2012 12:00:00 EST<![CDATA[Hunker down and blow up: Meet PlanetSide 2's Engineer]]>http://massively.joystiq.com/2012/03/28/hunker-down-and-blow-up-meet-planetside-2s-engineer/http://massively.joystiq.com/2012/03/28/hunker-down-and-blow-up-meet-planetside-2s-engineer/http://massively.joystiq.com/2012/03/28/hunker-down-and-blow-up-meet-planetside-2s-engineer/#commentsFiled under: , , , , , ,

PlanetSide 2
If PlanetSide 2's recent Infiltrator class reveal didn't grab you by the throat and say, "Play me with very last, dying gasp in your rapidly-turning-blue body," then SOE would like to try again with the Engineer. PS2's Engineer got a promotion from his old duties as a wrench monkey, opting instead for blowing enemies up with high-yield explosives and creating tough-as-nails fortifications to protect his teammates.

Engineers are granted an Advanced Construction Engine that turns them into a walking, smart-talking factory. With this tool, Engineers can deploy anti-personnel and anti-vehicle turrets, anti-tank mines, and protective shield generators. In addition, the class will fill a vital role when it comes to repairing vehicle and suit damage

In direct combat, the Engineer will rely on a trustworthy assortment of assault weapons, such as shotguns and SMGs. SOE predicts that the Engineer will be most valuable in holding a position and starting a siege against an enemy stronghold.

MassivelyHunker down and blow up: Meet PlanetSide 2's Engineer originally appeared on Massively on Wed, 28 Mar 2012 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabetasclassclass-revealclassesengineerfortificationsfpsinfiltratorminesmmo-shootermmofpsplanetsideplanetside-2ps2sci-fishootersoesonysony-online-entertainmentturretsWed, 28 Mar 2012 18:00:00 EST<![CDATA[The Firing Line: A couple of PlanetSide 2 concerns]]>http://massively.joystiq.com/2012/03/23/the-firing-line-a-couple-of-planetside-2-concerns/http://massively.joystiq.com/2012/03/23/the-firing-line-a-couple-of-planetside-2-concerns/http://massively.joystiq.com/2012/03/23/the-firing-line-a-couple-of-planetside-2-concerns/#commentsFiled under: , , , , , , , , , ,

The Firing Line - A couple of PlanetSide 2 concerns
Now that the glow of PlanetSide 2's GDC demo reveal is a couple of weeks back in the rear-view mirror, I've had time to digest it all and adjust my expectations of the game accordingly. Nothing I saw from Matt Higby and company dampened my enthusiasm for Sony Online Entertainment's MMOFPS opus, but a few things I didn't see are niggling at the back of my mind.

Don't get me wrong -- PS2 is still at the top of my most-anticipated MMO list, but there are a few points of contention that could relegate it to the status of fun diversion instead of zomg-must-play-every-day title.

Continue reading The Firing Line: A couple of PlanetSide 2 concerns

MassivelyThe Firing Line: A couple of PlanetSide 2 concerns originally appeared on Massively on Fri, 23 Mar 2012 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>classic-mmodesignfeaturedfiring-linefpsgame-mechanicsimmersionmatt-higbymmo-shootermmofpsopinionplanetsideplanetside-2psps1ps2pvpsandboxsci-fishootersoesonysony-online-entertainmenttflthe-firing-linethird-person-shootertpsFri, 23 Mar 2012 13:00:00 EST<![CDATA[PlanetSide 2's Higby talks resource costs, business models, and more on Reddit]]>http://massively.joystiq.com/2012/03/23/planetside-2s-higby-talks-resource-costs-business-models-and/http://massively.joystiq.com/2012/03/23/planetside-2s-higby-talks-resource-costs-business-models-and/http://massively.joystiq.com/2012/03/23/planetside-2s-higby-talks-resource-costs-business-models-and/#commentsFiled under: , , , , , , , , ,

PlanetSide 2 - desert canyon concept art
Aside from the big GDC demo earlier this month, mass information dumps regarding PlanetSide 2 have been few and far between. Thankfully, creative director Matt Higby took to Reddit yesterday for an AMA (ask me anything) session that brought a few interesting nuggets to light.

If you're one of the game's hardcore faithful, the talk was more confirmation than revelation, but for casual or newly interested fans, there's a lot of stuff to digest. Among the more interesting bits was the fact that PS2 will use PunkBuster and the fact that all of the game's classes and vehicles will be available from the get-go.

Higby also touched on resource costs for vehicles as well as the fact that the devs want "to create the game first and then build the business model that best services the game, rather than trying to conform the game to some particular business or membership model."

If Reddit's sprawling threads and needle-in-a-haystack nested replies aren't your cup of tea, PlanetSide Universe has collected most of the relevant info on its own discussion boards.

MassivelyPlanetSide 2's Higby talks resource costs, business models, and more on Reddit originally appeared on Massively on Fri, 23 Mar 2012 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>business-modelsclassesfpsmatt-higbymmo-shootermmofpsplanetsideplanetside-2planetside-2-amaplanetside-2-redditps2sandboxsci-fishootersoesonysony-online-entertainmentvehiclesFri, 23 Mar 2012 11:00:00 EST<![CDATA[Now you don't see him: Meet PlanetSide 2's Infiltrator]]>http://massively.joystiq.com/2012/03/22/now-you-dont-see-him-meet-planetside-2s-infiltrator/http://massively.joystiq.com/2012/03/22/now-you-dont-see-him-meet-planetside-2s-infiltrator/http://massively.joystiq.com/2012/03/22/now-you-dont-see-him-meet-planetside-2s-infiltrator/#commentsFiled under: , , , , ,

PlanetSide 2
He's the boogeyman whom battle-hardened soldiers fear and the guy whom Batman consults with on a daily basis. He's the Infiltrator, PlanetSide 2's sneaky assassin, and he won't stop coming for you until you are dead. Unless he gets lost. Planets are big.

SOE revealed the Infiltrator today as the game's stealth-user and long-distance sniper. Using advanced technology and camouflage systems, the Infiltrator can get to places that no other class can -- and do a lot of damage once there. Interestingly enough, while the Infiltrator lacks heavy armor, SOE does claim that the class' tactical advantages will prove to be just as protective as a titanium suit.

Infiltrators can use both sniper and scout rifles as well as pistols for close-quarter combat. The sniper rifle boasts the best range, while the scout rifle is better for mobile assault missions. It will, of course, be up to the player to decide whichever is the best to use in which situation.

MassivelyNow you don't see him: Meet PlanetSide 2's Infiltrator originally appeared on Massively on Thu, 22 Mar 2012 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>assassinclassclass-revealfpsinfiltratormmo-shootermmofpsplanetsideplanetside-2ps2sci-fiscoutshootersnipersoesonysony-online-entertainmentThu, 22 Mar 2012 16:00:00 EST<![CDATA[Leaderboard: DUST 514 vs. PlanetSide 2]]>http://massively.joystiq.com/2012/03/12/leaderboard-dust-514-vs-planetside-2/http://massively.joystiq.com/2012/03/12/leaderboard-dust-514-vs-planetside-2/http://massively.joystiq.com/2012/03/12/leaderboard-dust-514-vs-planetside-2/#commentsFiled under: , , , , , , ,

Leaderboard
One gets the sense that gamers can't wait for the future to get here so we can all join roving packs of pulse rifle-toting goons fighting each other for a living, like the world's most awesome paintball match. To tide us over, several studios are working hard at fulfilling our fantasies in virtual space with MMOFPS PvP titles such as DUST 514 and PlanetSide 2.

We recently got a closer look at both of these games at GDC, and it's safe to say that not only do they each come from experienced pedigree -- CCP and SOE -- but they're both highly anticipated by trigger-finger monitor mercenaries.

But we all know the sacred rule of MMOs, which is that there can only ever be one. There can only be one victor and one success -- and all the rest are doomed to languish in whatever the virtual equivalent of a compost heap is. So tell us true right now: Which will be more successful, DUST 514 or PlanetSide 2? Register your vote so that you'll be able to come back, months from now, and use this as proof that you knew better than all of the other fools out there!

Continue reading Leaderboard: DUST 514 vs. PlanetSide 2

MassivelyLeaderboard: DUST 514 vs. PlanetSide 2 originally appeared on Massively on Mon, 12 Mar 2012 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>battle-royalccpccp-gamesconsoledustdust-514eveeve-onlinefpsgdcgdc-2012leaderboardmmo-shootermmofpsone-on-oneone-vs-oneopinionplanetsideplanetside-2playstationplaystation-3pollpollsps2ps3sci-fishootersoesonysony-online-entertainmentversusvotevotesvotingvsMon, 12 Mar 2012 16:00:00 EST<![CDATA[GDC 2012: The Firing Line's PlanetSide 2 and DUST 514 redux]]>http://massively.joystiq.com/2012/03/09/the-firing-line-more-on-planetside-2-and-dust-514-from-gdc/http://massively.joystiq.com/2012/03/09/the-firing-line-more-on-planetside-2-and-dust-514-from-gdc/http://massively.joystiq.com/2012/03/09/the-firing-line-more-on-planetside-2-and-dust-514-from-gdc/#commentsFiled under: , , , , , , , , , , ,

The Firing Line - GDC 2012 header
This week I was fortunate enough to chat up the developers on the two biggest MMOFPS titles of the year. Exactly what year that is remains to be seen, and after hearing Sony Online Entertainment use the word "alpha" quite a lot, I suspect that PlanetSide 2 may slip into 2013. And that's not a bad thing at all, by the way.

CCP's DUST 514, on the other hand, is surely coming in 2012. The devs will be doling out some long-awaited hands-on time with EVE's precocious little brother at Fanfest in a couple of weeks, and while DUST and PS2 share similar core gameplay, their target audiences (and the general feeling I get from each game) are completely different.

Continue reading GDC 2012: The Firing Line's PlanetSide 2 and DUST 514 redux

MassivelyGDC 2012: The Firing Line's PlanetSide 2 and DUST 514 redux originally appeared on Massively on Fri, 09 Mar 2012 10:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesconconferenceconventiondavid-reiddustdust-514dust-eve-integrationdust-playstationeveeve-onlinef2pfeaturedfpsfree-to-playgame-developers-conferencegame-developers-conference-2012game-mechanicsgdcgdc-2012hilmar-peturssoninterviewmatt-higbymmofpsmobilenew-edenopinionplanetside-2playstation-3ps2ps3pvpsandboxtflthe-firing-linethird-person-shootertpstramell-isaacvitaFri, 09 Mar 2012 10:30:00 EST<![CDATA[Massively Speaking Episode 189: GDC Tuesday]]>http://massively.joystiq.com/2012/03/07/massively-speaking-episode-189-gdc-tuesday/http://massively.joystiq.com/2012/03/07/massively-speaking-episode-189-gdc-tuesday/http://massively.joystiq.com/2012/03/07/massively-speaking-episode-189-gdc-tuesday/#commentsFiled under: , , , , , , , , , , ,

PlanetSide 2
Massively Speaking Episode 189 is a special GDC edition hosted by two of our attendees, Shawn Schuster and Jef Reahard. The two assemble for a short, early-morning debriefing on yesterday's PlanetSide 2 demo, which as Shawn describes it, "pretty much blew [him] away." They compare the game to its predecessor and chat about the combat styles, immersion, interface, hype, and the massive feel of the game, even in alpha.

Stay tuned for tomorrow, when the pair will be joined by fellow Massively staffers MJ Guthrie and Karen Bryan. Our ground crew will be reporting back on DUST 514, Trion Worlds, MechWarrior Online, and more over the next few days. (And don't worry; the Justin and Bree show will return next week.)

Have a comment for the podcasters? Shoot an email to podcast@massively.com. We may just read your email on the air!

Get the podcast:
[iTunes] Subscribe to Massively Speaking directly in iTunes.
[RSS] Add Massively Speaking to your RSS aggregator.
[MP3] Download the MP3 directly.
Listen here on the page:



Read below the cut for the full show notes.

Continue reading Massively Speaking Episode 189: GDC Tuesday

MassivelyMassively Speaking Episode 189: GDC Tuesday originally appeared on Massively on Wed, 07 Mar 2012 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>conconferenceconventionfeaturedfpsgame-developers-conferencegame-developers-conference-2012gdcgdc-2012humorjef-reahardmassively-speakingmmo-shootermmofpsopinionplanetsideplanetside-2podcastpodcastingpodcastsps2sci-fishawn-schustershootersoesonysony-online-entertainmentWed, 07 Mar 2012 15:00:00 ESTMassively Speaking Episode 189Massively.com Staff00:12:10podcasts<![CDATA[GDC 2012: SOE's PlanetSide 2 gunning for the big time]]>http://massively.joystiq.com/2012/03/07/gdc-2012-soes-planetside-2-gunning-for-the-big-time/http://massively.joystiq.com/2012/03/07/gdc-2012-soes-planetside-2-gunning-for-the-big-time/http://massively.joystiq.com/2012/03/07/gdc-2012-soes-planetside-2-gunning-for-the-big-time/#commentsFiled under: , , , , , , , , , ,

PlanetSide 2 - TR minigun
Our PlanetSide 2 bootcamp didn't start on the war-torn planet of Auraxis. It started on a plushly appointed hotel terrace in the middle of downtown San Francisco. Sony Online Entertainment brought its A-game to GDC 2012, and though its MMOFPS sequel is still undergoing internal alpha testing, the demo was striking enough to make us feel like battle-weary soldiers returning from the front.

Executive producer Josh Hackney kicked things off with a short spiel that touched on what made the original PlanetSide unique (truly massive combat, ambitious open-world design, and a passionate/enduring community, in a nutshell). Hackney then turned the microphone over to creative director Matt Higby and a team of SOE devs who proceeded to wow the gaggle of game journos with an hour of pure awesome.

Continue reading GDC 2012: SOE's PlanetSide 2 gunning for the big time

MassivelyGDC 2012: SOE's PlanetSide 2 gunning for the big time originally appeared on Massively on Wed, 07 Mar 2012 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>conconferenceconventionexclusivef2pfeaturedfpsfree-to-playgame-developers-conferencegame-developers-conference-2012game-mechanicsgdcgdc-2012interviewjosh-hackneymatt-higbymmo-shootermmofpsplanetsideplanetside-2ps2sci-fishootersidegradessoesonysony-online-entertainmenttrammelWed, 07 Mar 2012 09:00:00 EST<![CDATA[GDC 2012: Advanced recon of PlanetSide 2 uncovers hot zone photographs]]>http://massively.joystiq.com/2012/03/06/advanced-recon-of-planetside-2-uncovers-hot-zone-photographs/http://massively.joystiq.com/2012/03/06/advanced-recon-of-planetside-2-uncovers-hot-zone-photographs/http://massively.joystiq.com/2012/03/06/advanced-recon-of-planetside-2-uncovers-hot-zone-photographs/#commentsFiled under: , , , , , , , , ,

PlanetSide 2
Massively's boots are on the ground at this week's Games Developer Conference, and we've stormed Sony Online Entertainment's stronghold to find out any and all information about its upcoming MMOFPS PlanetSide 2. We've been tweeting the excitement from the show floor, and while hearing it is one thing, seeing it for yourself is another.

That's why we're bringing to you a mega-upload of 22 hot new images and concept art from this MMOFPS. Showing off a huge variety of environments, ships, soldiers, outfits, and action sequences, these screenshots are pure eye-candy for those anticipating this title. And after the cut, you'll find two GDC videos of the game, courtesy of PlanetSide Universe and tipster Kyle.

This is only the beginning, however. Stay tuned to Massively for our first impressions of PlanetSide 2 and an interview with SOE's Tramell Isaac coming later this week!

Gallery: PlanetSide 2


Massively sent four resolute reporters to San Francisco to bring you back the biggest MMO news from this year's GDC, the largest pro-only gaming industry con in the world! From games like The Secret World to PlanetSide 2, we're on the case, so stay tuned for all the highlights from the show!

Continue reading GDC 2012: Advanced recon of PlanetSide 2 uncovers hot zone photographs

MassivelyGDC 2012: Advanced recon of PlanetSide 2 uncovers hot zone photographs originally appeared on Massively on Tue, 06 Mar 2012 21:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>conconferenceconventionfpsgame-developers-conferencegame-developers-conference-2012gdcgdc-2012mmo-shootermmofpsplanetsideplanetside-2ps2sci-fishootersoesonysony-online-entertainmenttrailertrailerstramell-isaacvideovideosTue, 06 Mar 2012 21:30:00 EST<![CDATA[PlanetSide 2 devs run through a hypothetical battle scenario]]>http://massively.joystiq.com/2012/02/23/planetside-2-devs-run-through-a-hypothetical-battle-scenario/http://massively.joystiq.com/2012/02/23/planetside-2-devs-run-through-a-hypothetical-battle-scenario/http://massively.joystiq.com/2012/02/23/planetside-2-devs-run-through-a-hypothetical-battle-scenario/#commentsFiled under: , , , , , ,

PlanetSide 2
The gulf between sparse previews of an MMO and actually getting your hands on it is wide indeed, but the makers of PlanetSide 2 have an idea. If they can't allow you in the game yet or show you a hands-on, why not describe how a battle scenario might go from start to finish? Creative Director Matt Higby did just that for fans, conjuring up an imaginary skirmish between two forces over the fate of a base, and in doing so highlighted how such PvP fights might occur in the game.

In this scenario, he envisions a base being attacked; that attack is then repulsed by its defenders. The former defenders proceed to launch aircraft to continue the rout until the attackers have retreated into their own base. Attack aircraft and air transports, he says, will be the first responders on the scene, as they're the quickest to get anywhere. From that point, he imagines the attackers rallying support to go on the offensive once more, with vehicles leading the way and ground troops following, swarming the base and capturing it for good.

Higby says that the tug-of-war between bases will be anything but dull and simple: "Now, distracting that tug of war is all the other regions that are all around here... There's lots of little strategic decisions and options that you can do in there that radically change the balance of the big battle that's happening."

MassivelyPlanetSide 2 devs run through a hypothetical battle scenario originally appeared on Massively on Thu, 23 Feb 2012 22:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>battlebattle-scenariof2pfree-to-playhypotheticalmatt-higbyplanetsideplanetside-2ps2pvpsoeSony-Online-Entertainmenttug-o-wartug-of-warThu, 23 Feb 2012 22:00:00 EST<![CDATA[SOE opens up about multi-year European partnership]]>http://massively.joystiq.com/2012/02/21/soe-opens-up-about-multi-year-european-partnership/http://massively.joystiq.com/2012/02/21/soe-opens-up-about-multi-year-european-partnership/http://massively.joystiq.com/2012/02/21/soe-opens-up-about-multi-year-european-partnership/#commentsFiled under: , , , , , , , ,

ProSiebenSat.1
While we heard about Sony Online Entertainment's partnership with ProSiebenSat.1 Games Group to publish MMOs in Europe last month, the specific details of this deal were lurking under a cloud cover of mystery and speculation -- until now. SOE has posted a quite lengthy FAQ about this partnership and what it entails for the future of the studio in the Old World.

According to the deal, ProSiebenSat.1 has the license to officially publish eight of SOE's titles in 40 countries. These MMOs include DC Universe Online, EverQuest II, Free Realms, PlanetSide 2, and EverQuest Next (although not, oddly enough, EverQuest itself). SOE hopes that ProSiebenSat.1's location and expertise will result in in a greater audience for its games as well as more support and better localization for those under ProSiebenSat.1's umbrella. SOE even hopes that the partnership will result in "special content" for European players.

Previously, SOE had distribution agreements for Europe but nothing on the scale of what it now has with ProSiebenSat.1. It looks like EU players will need to transfer their accounts and characters over to ProSiebenSat.1's domain, although SOE promises that this will be an easy process. It's also important to note that these games and their servers will not interact with their North American counterparts, effectively separating the communities.

MassivelySOE opens up about multi-year European partnership originally appeared on Massively on Tue, 21 Feb 2012 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dc-universe-onlinedcuodealeq2eqiieueu-playerseuropeeuropeaneverquesteverquest-iieverquest-nextfree-realmslegalpartnershipplanetside-2prosiebensat.1ProSiebenSat.1-Games-Groupps2soeSony-Online-EntertainmentTue, 21 Feb 2012 16:00:00 EST<![CDATA[SOE's fifth annual G.I.R.L. competition beckons to future game designers]]>http://massively.joystiq.com/2012/02/16/soes-fifth-annual-g-i-r-l-competition-beckons-to-future-game-d/http://massively.joystiq.com/2012/02/16/soes-fifth-annual-g-i-r-l-competition-beckons-to-future-game-d/http://massively.joystiq.com/2012/02/16/soes-fifth-annual-g-i-r-l-competition-beckons-to-future-game-d/#commentsFiled under: , , , , ,

G.I.R.L.
Ladies and gentlemen, start your essay-writing engines! Sony Online Entertainment is sounding the call for this year's G.I.R.L. Game Design Competition and is now accepting applicants looking to win a $10,000 scholarship and a 10-week internship at SOE.

The program, which is in its fifth year, is designed to promote and inspire female involvement in video game development by helping a talented student through undergraduate studies. Applicants have to currently be enrolled in a gaming-related program, have a 3.0 or higher GPA, be a resident of the US, and be 18 years old or older. If you meet all those standards and have a hankering to apply, you'll need to submit two pieces of original concept art "inspired by" PlanetSide 2 or EverQuest II, captions to go with the art, and a 500-word essay about women in the gaming industry. Applications are due by March 29th.

SOE Senior Vice President of Global Sales and Marketing Laura Naviaux hopes that this will be the biggest year ever for the scholarship: "Over the last few years, we have been nothing short of impressed with the hundreds of amazing submissions from talented students nationwide. Now in our fifth year, we can't wait to see the creativity that comes out of the G.I.R.L. program."

MassivelySOE's fifth annual G.I.R.L. competition beckons to future game designers originally appeared on Massively on Thu, 16 Feb 2012 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>eq2eqiieverquest-2everquest-iigame-design-competitiongamers-in-real-lifegirlLaura-Naviauxmmo-industryplanetside-2ps2scholarshipvideo-game-designersvideo-game-industryThu, 16 Feb 2012 17:00:00 EST<![CDATA[PlanetSide 2 website features new Terran Republic lore]]>http://massively.joystiq.com/2012/02/02/planetside-2-website-features-new-terran-republic-lore/http://massively.joystiq.com/2012/02/02/planetside-2-website-features-new-terran-republic-lore/http://massively.joystiq.com/2012/02/02/planetside-2-website-features-new-terran-republic-lore/#commentsFiled under: , , , , , , ,

PlanetSide 2 - TR Mosquito
It's been a while since we've featured a PlanetSide 2 lore update, mainly because more interesting gameplay info was on offer from Sony Online Entertainment. In the absence of new vehicle screens and Matt Higby Q&A's, though, we'll happily tell about the latest story-centric update to the official site (hey, some PS2 news is better than no PS2 news, amirite?).

Last night's blurb features one Tom Connery (presumably no relation to Sean, since it's the year 2640). Connery is prone to making holovid records of his life in the Terran Republic, and his latest is a somewhat harrowing account of a collapsing wormhole and the plight of the 40,000 colonists stuck on the wrong side of it. Click over to the official PS2 website for the full report.

MassivelyPlanetSide 2 website features new Terran Republic lore originally appeared on Massively on Thu, 02 Feb 2012 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>backstoryfpsloremmo-shootermmofpsplanetside-2ps2sci-fishootersoeSony-Online-Entertainmentstoryterran-republictom-connerytrThu, 02 Feb 2012 13:00:00 EST<![CDATA[SOE's Matt Higby talks PlanetSide 2 resources, territory control, and more]]>http://massively.joystiq.com/2012/01/29/soes-matt-higby-talks-planetside-2-resources-territory-control/http://massively.joystiq.com/2012/01/29/soes-matt-higby-talks-planetside-2-resources-territory-control/http://massively.joystiq.com/2012/01/29/soes-matt-higby-talks-planetside-2-resources-territory-control/#commentsFiled under: , , , , , , ,

PlanetSide 2 - soldiers at dusk
PlanetSide Universe and Auraxis Global Network got together with PlanetSide 2 creative director Matt Higby for a two-hour interview session last night. If you missed it, the full video chat is available after the cut below.

Higby and the AGN crew covered a lot of territory relating to Sony Online Entertainment's upcoming MMOFPS. Topics included the Engineer class, urban combat, and the territory and resource control systems. Higby also had plenty to say about the general philosophy behind PS2, and how the dev team is focused on refining the gameplay of its predecessor rather than reinventing the wheel.

"One of the things that we're trying to do with the game is reduce downtime, reduce a lot of the maintenance things that you had to do that were kind of inconvenient. We're not removing logistics or strategy [...] but trying to lessen those maintenance tasks that are less enjoyable as much as possible," Higby explained.

Continue reading SOE's Matt Higby talks PlanetSide 2 resources, territory control, and more

MassivelySOE's Matt Higby talks PlanetSide 2 resources, territory control, and more originally appeared on Massively on Sun, 29 Jan 2012 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>auraxisfpsgame-mechanicsgameplayinterviewlogisticsmatt-higbymmo-shootermmofpsplaneside-2ps2resourcessandboxsci-fishootersoeSony-Online-EntertainmentvideoSun, 29 Jan 2012 14:00:00 EST<![CDATA[PlanetSide 2 webcast features lengthy community Q&A]]>http://massively.joystiq.com/2012/01/27/planetside-2-webcast-features-lengthy-community-qanda/http://massively.joystiq.com/2012/01/27/planetside-2-webcast-features-lengthy-community-qanda/http://massively.joystiq.com/2012/01/27/planetside-2-webcast-features-lengthy-community-qanda/#commentsFiled under: , , , , , , ,

PlanetSide 2 - the Sunderer
If you're a PlanetSide 2 fan, you'll want to check out Sony Online Entertainment's latest webcast. The 30-minute affair features creative director Matt Higby, game designer Kevin Moyer, and senior art director Tramell Isaac. The trio field a whole bunch of community questions on the upcoming sci-fi MMOFPS, most of them centered around Nanite Systems vehicles like the Sunderer and the Galaxy.

If you don't have time to watch the whole shebang, PlanetSide Universe has a good breakdown of the new stuff (including some awesome bits on vehicle customizations like hood ornaments, camouflage, racing stripes, and other visual tweaks). Click past the cut for the full video.

Continue reading PlanetSide 2 webcast features lengthy community Q&A

MassivelyPlanetSide 2 webcast features lengthy community Q&A originally appeared on Massively on Fri, 27 Jan 2012 10:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>community-questionscustomizationf2pfpsfree-to-playkevin-moyermatt-higbymmo-shootermmofpsplanetside-2ps2sandboxsci-fishootersoesoe-webcastSony-Online-Entertainmenttramell-isaacvehiclesvideowebcastFri, 27 Jan 2012 10:30:00 EST<![CDATA[SOE shows off PlanetSide 2's Galaxy transport]]>http://massively.joystiq.com/2012/01/19/soe-shows-off-planetside-2s-galaxy-transport/http://massively.joystiq.com/2012/01/19/soe-shows-off-planetside-2s-galaxy-transport/http://massively.joystiq.com/2012/01/19/soe-shows-off-planetside-2s-galaxy-transport/#commentsFiled under: , , , , , ,

PlanetSide 2 - Galaxy transport
Another day, another PlanetSide 2 vehicle reveal. The latest update from Sony Online Entertainment features the venerable Galaxy, and if that doesn't quicken your pulse a little bit, you must've missed the original PlanetSide.

The Galaxy is a heavily armored troop transport designed to "hot drop" 12 soldiers into the heart of enemy territory. What's a hot drop? It's basically the game's sci-fi twist on the traditional parachute, and SOE says that it "automatically encapsulates any soldier or MAX unit that bails out with a protective barrier that slows their fall."

Galaxies are also sturdy enough to serve as mobile infantry bases after landing, and the ships feature respawn tubes, equipment terminals, and four weapon systems that may be operated on the ground.

MassivelySOE shows off PlanetSide 2's Galaxy transport originally appeared on Massively on Thu, 19 Jan 2012 09:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>fpsgalaxyhot-dropmmo-shootermmofpsplanetside-2ps2sci-fishipsshootersoeSony-Online-EntertainmentvehiclesThu, 19 Jan 2012 09:30:00 EST<![CDATA[PlanetSide 2's Sunderer carries troops, pushes tanks]]>http://massively.joystiq.com/2012/01/18/planetside-2s-sunderer-carries-troops-pushes-tanks/http://massively.joystiq.com/2012/01/18/planetside-2s-sunderer-carries-troops-pushes-tanks/http://massively.joystiq.com/2012/01/18/planetside-2s-sunderer-carries-troops-pushes-tanks/#commentsFiled under: , , , , , , ,

PlanetSide 2 - the Sunderer
Sony Online Entertainment is continuing its tradition of PlanetSide 2 vehicle reveals in a news blurb on the game's official website. The Sunderer looks like a cross between a tank and a Mack truck, and it's designed to pancake enemy defensive lines and deposit a load of troopers smack dab in the thick of the action.

SOE says the beastly ride can withstand a focused barrage of enemy fire due to its heavy armor, and the Sunderer also features enough mass and horsepower to push other vehicles (including tanks) out of its way. Its cargo hold can carry up to 12 soldiers as well as medical supplies and ammo. PlanetSide 2 is a large-scale persistent world shooter based in a sci-fi setting, and SOE is currently accepting closed beta applications.

MassivelyPlanetSide 2's Sunderer carries troops, pushes tanks originally appeared on Massively on Wed, 18 Jan 2012 09:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>auraxisf2pfpsfree-to-playmmo-shootermmofpsopen-worldpersistent-worldplanetside-2ps2sci-fishootersoeSony-Online-Entertainmentsunderertroop-carriervehiclesWed, 18 Jan 2012 09:30:00 EST<![CDATA[SOE shows off PlanetSide 2's Quad and Liberator]]>http://massively.joystiq.com/2012/01/13/soe-shows-off-planetside-2s-quad/http://massively.joystiq.com/2012/01/13/soe-shows-off-planetside-2s-quad/http://massively.joystiq.com/2012/01/13/soe-shows-off-planetside-2s-quad/#commentsFiled under: , , , , , , , , ,

PlanetSide 2 - Quads
What do giant transport vessels like the Galaxy and tiny ATVs like the Quad have in common? They're both built by Nanite Systems, of course. Who the heck is Nanite Systems? You'll have to brush up on your PlanetSide 2 lore to find out, and luckily the official website is here to help.

Today's reveal showcases the Quad, and Sony Online Entertainment tells us that "it has the highest top speed of any ground vehicle and is easy to acquire." As you would expect, the speed comes at a price, and let's just say that you don't want to be riding on a Quad when it takes a hit. Head to the PS2 website for a couple of screenshots and some backstory.

When you're done reading about the Quad, click on over to SOE's Liberator reveal to get the goods on another Nanite Systems product. The Liberator is a gunship, and while it boasts a ton of firepower and decent armor protection, it pays for its bristling bulk by being quite slow in the air.

MassivelySOE shows off PlanetSide 2's Quad and Liberator originally appeared on Massively on Fri, 13 Jan 2012 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>auraxisfpsloremmo-shootermmofpsnanitenanite-systemsplanetside-2ps2quadsci-fishootersoeSony-Online-EntertainmentvehiclesFri, 13 Jan 2012 18:30:00 EST<![CDATA[The Firing Line: Thousand-player dogfights and more PlanetSide 2 conjecture]]>http://massively.joystiq.com/2012/01/13/the-firing-line-thousand-player-dogfights-and-more-planetside-2/http://massively.joystiq.com/2012/01/13/the-firing-line-thousand-player-dogfights-and-more-planetside-2/http://massively.joystiq.com/2012/01/13/the-firing-line-thousand-player-dogfights-and-more-planetside-2/#commentsFiled under: , , , , , , , , , , ,

The Firing Line - PlanetSide 2 reaver
Welcome back to The Firing Line, boys and girls. Last week I talked at length about PlanetSide 2, and despite the fact that I'm apparently unqualified to do so according to some folks, I'm going to do it again this week.

How do ya like them apples?

Anyhow, that's not all I'm going to talk about, as a couple of other online shooters made news over the last seven days. Most of you know that I can't pass up the opportunity to mention Tribes: Ascend, and oh yeah, would you believe there's an aerial combat game that supports 1,000-player dogfights?

Continue reading The Firing Line: Thousand-player dogfights and more PlanetSide 2 conjecture

MassivelyThe Firing Line: Thousand-player dogfights and more PlanetSide 2 conjecture originally appeared on Massively on Fri, 13 Jan 2012 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>1000-player-dogfightair-combatair-warcosplaycrystal-grazianofeaturedfirefallfiring-linefpshi-rezhi-rez-studioslee-rehermanmasangmasang-softmmo-shootermmofpsopinionplanetside-2ps2red-5red-5-studiossci-fishootersoeSony-Online-Entertainmentthe-firing-linetop-gun-onlinetribestribes-ascendvideoFri, 13 Jan 2012 10:00:00 EST<![CDATA[New PlanetSide 2 gameplay footage spotted in the wild]]>http://massively.joystiq.com/2012/01/05/new-planetside-2-gameplay-footage-spotted-in-the-wild/http://massively.joystiq.com/2012/01/05/new-planetside-2-gameplay-footage-spotted-in-the-wild/http://massively.joystiq.com/2012/01/05/new-planetside-2-gameplay-footage-spotted-in-the-wild/#commentsFiled under: , , , , , , , , ,

PlanetSide 2 artwork
Sony Online Entertainment is building a little buzz around PlanetSide 2 lately. The upcoming MMOFPS revealed its beta signup process just before the Christmas holiday, and now fans at PlanetSide Universe have uncovered new gameplay footage courtesy of a couple of videos produced for Chinese publishing partner The9.

The first clip serves as an intro to The9's PS2 website, and it features some quick glimpses of airborne combat, tank combat, and first-person infantry combat. The second clip is a mixture of similar gameplay footage along with some talking-head dev interview shots which you can view after the cut.

Continue reading New PlanetSide 2 gameplay footage spotted in the wild

MassivelyNew PlanetSide 2 gameplay footage spotted in the wild originally appeared on Massively on Thu, 05 Jan 2012 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>fpsgameplay-footagemmo-shootermmofpsplanetside-2planetside2ps2sandboxsci-fishootersoeSony-Online-Entertainmentthe9videoThu, 05 Jan 2012 10:00:00 EST<![CDATA[PlanetSide 2 rallies the Vanu Sovereignty with new video]]>http://massively.joystiq.com/2011/11/23/planetside-2-rallies-the-vanu-sovereignty-with-new-video/http://massively.joystiq.com/2011/11/23/planetside-2-rallies-the-vanu-sovereignty-with-new-video/http://massively.joystiq.com/2011/11/23/planetside-2-rallies-the-vanu-sovereignty-with-new-video/#commentsFiled under: , , , , ,

Screenshot -- PlanetSide 2
PlanetSide 2's Vanu Sovereignty gets some more time in the spotlight today with a new video that shows off the technologically advanced vehicles and weaponry available to the faction. We hope that this video, in conjunction with the recent Vanu Sovereignty screenshots, can stave off your PlanetSide 2 hunger until the next morsel drops. Just click on past the cut for the full video.

[Source: Sony Online Entertainment press release]

Continue reading PlanetSide 2 rallies the Vanu Sovereignty with new video

MassivelyPlanetSide 2 rallies the Vanu Sovereignty with new video originally appeared on Massively on Wed, 23 Nov 2011 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>factionfactionsmmofpsplanetside-2ps2soesony-online-entertainmentvanuvanu-sovereigntyvideovideosWed, 23 Nov 2011 16:00:00 EST<![CDATA[PlanetSide 2's Vanu Sovereignty gets a new batch of screenshots]]>http://massively.joystiq.com/2011/11/22/planetside-2s-vanu-sovereignty-gets-a-new-batch-of-screenshots/http://massively.joystiq.com/2011/11/22/planetside-2s-vanu-sovereignty-gets-a-new-batch-of-screenshots/http://massively.joystiq.com/2011/11/22/planetside-2s-vanu-sovereignty-gets-a-new-batch-of-screenshots/#commentsFiled under: , , ,

Say
PlanetSide 2's Terran Republic and New Conglomerate have both had their time in the spotlight, but now we get to hear from the faction that everyone actually cares about: the technologically superior Vanu Sovereignty. PC Gamer has some new, incredibly purple screens showing the Vanu in action. Marvel at the hovertanks! Stand in awe of Vanu Sovereignty airships! Prepare to be pew-pewed in the face by an awesome laser pistol! After all, it takes a real man to wear purple. Or something like that, anyway. Just click on over to PC Gamer for all the new screens.

MassivelyPlanetSide 2's Vanu Sovereignty gets a new batch of screenshots originally appeared on Massively on Tue, 22 Nov 2011 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>mmofpspc-gamerpcgamerpew-pew-lasersplanetsideplanetside-2ps2screensscreenshotscreenshotssoesony-online-entertainmentvanuvanu-sovereigntyTue, 22 Nov 2011 16:30:00 EST<![CDATA[The Game Archaeologist's excellent EverQuest Online Adventures: The memories]]>http://massively.joystiq.com/2011/11/22/the-game-archaeologists-excellent-everquest-online-adventures/http://massively.joystiq.com/2011/11/22/the-game-archaeologists-excellent-everquest-online-adventures/http://massively.joystiq.com/2011/11/22/the-game-archaeologists-excellent-everquest-online-adventures/#commentsFiled under: , , , , ,

EQOA
It's been a good month looking back at EverQuest Online Adventures, wouldn't you agree? Educational, almost. While this title is just about as far from the mainstream MMO eye as can be these days, it's heartening to know it's still out there, still running, and still capable of evoking fond memories from current and former players.

While we did attempt to contact SOE for an interview to see if we could find out anything new -- or even old -- about EQOA, it failed to materialize. As a wonderful consolation prize, however, this week we'll hear from three players who have extensive experience in the game. So let's hit this column running and equip our +2 Ears of Paying Attention!

Continue reading The Game Archaeologist's excellent EverQuest Online Adventures: The memories

MassivelyThe Game Archaeologist's excellent EverQuest Online Adventures: The memories originally appeared on Massively on Tue, 22 Nov 2011 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>consoleconsole-mmoeqoaeverquest-online-adventuresfeaturedfrontiersgriefermoomudmudsmushnorwaypalplaystationplaystation-2ps2soeSony-Online-Entertainmenttraintrain-to-zoneTue, 22 Nov 2011 14:00:00 EST<![CDATA[PlanetSide 2 community night reveals vehicle customization, Vanguard tanks, and in-game footage]]>http://massively.joystiq.com/2011/11/21/planetside-2-community-night-reveals-vehicle-customization-vang/http://massively.joystiq.com/2011/11/21/planetside-2-community-night-reveals-vehicle-customization-vang/http://massively.joystiq.com/2011/11/21/planetside-2-community-night-reveals-vehicle-customization-vang/#commentsFiled under: , , , , ,

PlanetSide 2
What would you do if you had developers for a highly anticipated MMO on video chat with your fansite's community? The correct answer is "Pump them for all the information you can, then see if you can't get a first glimpse of said game in action."

PlanetSide Universe scored 1000 points this past weekend with that answer, as the site's community night video podcast covering PlanetSide 2 turned into an informational bonanza for the game's fans. The hosts talked to SOE's Matt Higby and Tramell Isaac about PS2's maps and vehicle customization while also getting a tour around the team's offices and a couple segments of in-game footage showing off PlanetSide 2's engine.

The fansite also netted a pair of new pictures showing off the impressive Vanguard tanks, which you can check out in the gallery below. The full community night podcast is after the jump, but you might want to put on a bib beforehand to catch all the drool!

Gallery: PlanetSide 2

Continue reading PlanetSide 2 community night reveals vehicle customization, Vanguard tanks, and in-game footage

MassivelyPlanetSide 2 community night reveals vehicle customization, Vanguard tanks, and in-game footage originally appeared on Massively on Mon, 21 Nov 2011 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>community-nightfirst-lookgalleryin-game-footagematt-higbyplanetsideplanetside-2planetside-universepodcastps2screenshottramell-isaacvanguardvanguard-tankvehicle-customizationvideovideo-podcastMon, 21 Nov 2011 11:00:00 EST<![CDATA[The Firing Line: All the shooter news that's fit to print]]>http://massively.joystiq.com/2011/11/18/the-firing-line-all-the-shooter-news-thats-fit-to-print/http://massively.joystiq.com/2011/11/18/the-firing-line-all-the-shooter-news-thats-fit-to-print/http://massively.joystiq.com/2011/11/18/the-firing-line-all-the-shooter-news-thats-fit-to-print/#commentsFiled under: , , , , , , , , , , , , ,

The Firing Line - header graphic with various shooter avatars
Welcome back to The Firing Line, folks. I'm still putting out a few flames from last week's how-dare-you-call-this-an-MMO smackdown, and rather than fuel that particular fire by telling you that I've been playing a lot of World of Tanks (oh, did I say that?), I figured I'd take a high-level look at what's been happening with a few of the larger MMO shooters (and quasi-MMO shooters) over the last couple of weeks.

Despite my best efforts, we're still stuck with lore updates and insignificant PR when it comes to PlanetSide 2, though we did snag a few new screenshots recently. Things have also been quiet when it comes to Global Agenda and a few of my other favorite titles. Not to worry, though. Hi-Rez is moving right along with its Tribes: Ascend beta, and you can read about that and more in my news roundup after the break.

Continue reading The Firing Line: All the shooter news that's fit to print

MassivelyThe Firing Line: All the shooter news that's fit to print originally appeared on Massively on Fri, 18 Nov 2011 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesdustdust-514featuredfirefallfiring-linegame-mechanicshi-rezhi-rez-studiosmmo-shootermmo-shootersmmofpsmmotpsopinionplanetside-2ps2pvpred-5-studiossci-fishootershooter-news-roundupshooter-roundupsoeSony-Online-Entertainmentthe-firing-linetribestribes-ascendFri, 18 Nov 2011 15:00:00 EST<![CDATA[The Game Archaeologist's excellent EverQuest Online Adventures: The blogger]]>http://massively.joystiq.com/2011/11/15/the-game-archaeologists-excellent-everquest-online-adventures/http://massively.joystiq.com/2011/11/15/the-game-archaeologists-excellent-everquest-online-adventures/http://massively.joystiq.com/2011/11/15/the-game-archaeologists-excellent-everquest-online-adventures/#commentsFiled under: , , , ,

EQOA
To tell you all the truth, the comments from last week's initial foray into EverQuest Online Adventures bowled me over -- I truly was not expecting so many players to be so passionate about the game! How cool is that? I hope that some of you send me in your EQOA stories to justin@massively.com so we can include them in next week's column.

Today I want to welcome Rick "Stoney" Stonebrook to our neck of the Massively woods. I remember finding Stoney's EQOA blog over a year ago and being so impressed that there was someone out there regularly updating a blog about this low-profile MMO. Stoney agreed to an interview about the game from a player's and blogger's perspective, so here goes!

The Game Archaeologist: Please introduce yourself and your blog! Why did you start blogging about EQOA?

Stoney: Well, I'm 24 and have lived in a lot of places in the past few years. I adopted the name Stoney when I started the blog, eqoa.wordpress.com, in October 2010. The purpose for the blog was simple: compile as much information about the game as I could find using various search engines such as Google, Yahoo, and YouTube. I hadn't played since 2005 and wasn't familiar with any new content. I had always wanted to return to the game. Thus the blog's goal evolved from a collection of memories to an effort to get people to return.

Continue reading The Game Archaeologist's excellent EverQuest Online Adventures: The blogger

MassivelyThe Game Archaeologist's excellent EverQuest Online Adventures: The blogger originally appeared on Massively on Tue, 15 Nov 2011 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alchemistbetamaxblogbloggerconsoleconsole-mmoeqoaeverquesteverquest-online-adventuresexpansionf2pfeaturedffxifinal-fantasy-xifree-to-playfrontierfrontiersinterviewminidiscsplaystation-2playstation-3ps2ps3rick-stonebrooksocom-navy-sealssoesonysony-online-entertainmentstoneytgathe-game-archaeologistunderfootworld-of-warcraftwowTue, 15 Nov 2011 17:00:00 EST<![CDATA[Massively Exclusive: PlanetSide 2's New Conglomerate Q&A]]>http://massively.joystiq.com/2011/11/11/massively-exclusive-planetside-2s-new-conglomerate-qanda/http://massively.joystiq.com/2011/11/11/massively-exclusive-planetside-2s-new-conglomerate-qanda/http://massively.joystiq.com/2011/11/11/massively-exclusive-planetside-2s-new-conglomerate-qanda/#commentsFiled under: , , , ,

PlanetSide 2
With the cold war in PlanetSide 2 quickly turning hot, potential players have to ask themselves: Which side will they join? Today SOE is making a bid on behalf of the New Conglomerate, painting them as the scrappy underdogs of the war with plenty of attitude to go around. We sat down with Creative Director Matt Higby to see if we could figure out what makes this faction tick.

Massively: As an introduction for new players, what's the philosophy behind the New Conglomerate?

Matt Higby: The New Conglomerate are an insurgent guerrilla force fighting against pretty stacked odds: an enormous military machine in the TR on one side and the vast technological superiority of the VS on the other. This forces the New Conglomerate to be adaptive, use creative tactics and take advantage of every possible opportunity they can to accomplish their goals. Their weapons run the gamut from conventional to experimental, and they're not willing to say no to anything that might give them an edge.

Continue reading Massively Exclusive: PlanetSide 2's New Conglomerate Q&A

MassivelyMassively Exclusive: PlanetSide 2's New Conglomerate Q&A originally appeared on Massively on Fri, 11 Nov 2011 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>exclusivefactionfactionsinterviewmatt-higbymatthew-higbyncNew-Conglomerateplanetsideplanetside-2psps1ps2q-and-asoeSony-Online-EntertainmentFri, 11 Nov 2011 16:30:00 EST