Massively http://massively.joystiq.com Massively http://www.blogsmithmedia.com/http://massively.joystiq.com/media/feedlogo.gif Massively http://massively.joystiq.com en-us Copyright 2012 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[Marvel Heroes unveils its first official trailer [Updated]]]>http://massively.joystiq.com/2012/05/22/marvel-heroes-unveils-its-first-official-trailer/http://massively.joystiq.com/2012/05/22/marvel-heroes-unveils-its-first-official-trailer/http://massively.joystiq.com/2012/05/22/marvel-heroes-unveils-its-first-official-trailer/#commentsFiled under: , , , , , ,

Screencap -- Marvel Heroes announcement trailer
After months and months of teasing us, Gazillion Entertainment has finally officially released new details about its upcoming new title, the free-to-play Marvel Heroes. The press release claims that the game will take "the MMO category to a completely new level of excitement and engagement" by combining "the energy of action role-playing games with the breadth and immersion of the MMO genre."

Players can now get their first look at Marvel Heroes with the title's first teaser trailer, which features gameplay footage interwoven with some rather menacing shots of a certain Victor Von Doom, who seems to have gotten his titanium-plated hands on what appears to be the Cosmic Cube, an artifact that gives its bearer the power to bend reality to his will. We're not sure what Doc Doom plans to do with the Cube, but we know that it can't possibly be anything good. Presumably it will be up to the players to put a stop to Doom's nefarious plans and return the Cube to its rightful place, but until we find out more, head on past the cut and enjoy the trailer in all of its super-goodness.

[Source: Gazillion Entertainment press release]

[Update: IGN has a preview of the game that discusses in detail its Diablo roots.]

Continue reading Marvel Heroes unveils its first official trailer [Updated]

MassivelyMarvel Heroes unveils its first official trailer [Updated] originally appeared on Massively on Tue, 22 May 2012 14:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>announcementcosmic-cubedoctor-doomf2pfree-to-playgazilliongazillion-entertainmentmarvelmarvel-heroesmarvel-universemarvel-universe-onlinemuonew-titlenew-titlessecret-identitysuperherosuperheroestrailertrailersvideovideosTue, 22 May 2012 14:30:00 EST<![CDATA[Aeria Games unveils new multiplayer shooter, Born to Fire]]>http://massively.joystiq.com/2012/05/21/aeria-games-unveils-new-mmofps-born-to-fire/http://massively.joystiq.com/2012/05/21/aeria-games-unveils-new-mmofps-born-to-fire/http://massively.joystiq.com/2012/05/21/aeria-games-unveils-new-mmofps-born-to-fire/#commentsFiled under: , , , , ,

Born to Fire image
Aeria Games, with numerous free-to-play titles already under its belt, just unveiled a new multiplayer first-person shooter called Born to Fire. This character-driven game is set following the Cold War, when rules of engagement are thrown out the window and the world is a free-fire zone.

Director of Publishing Tom Nichols describes the game: "In Born to Fire, players step in the boots of five distinct classes of elite operatives engaged in a global firefight for domination. With the instant gratification of one-click matchmaking and the in-depth analysis provided by elaborate replay tools, Born to Fire represents a new class of character-driven, highly customizable MMOFPS that's easy to get into but nearly impossible to fully master."

The five classes available for play are Rifleman, Duelist, Ranger, Heavy-Hitter, or Warden; each comes with unique backstory, tactics, and a fully customizable arsenal.

Sign-ups for closed beta are going on now! Players can keep informed of the latest news, updates, and contests by "liking" Born To Fire's Facebook page. Also, be sure to check out the screenshots and artwork in the attached gallery.

Gallery: Born to Fire

Born to Fire


[Source: Areia Games press release]

MassivelyAeria Games unveils new multiplayer shooter, Born to Fire originally appeared on Massively on Mon, 21 May 2012 07:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>aeriaaeria-gamesBorn-to-Firefirst-person-shooterfpsgalleriesgallerynew-titlesscreenshotswarMon, 21 May 2012 07:00:00 EST<![CDATA[TERA hits the #1 spot for Amazon downloads]]>http://massively.joystiq.com/2012/05/04/tera-hits-the-1-spot-for-amazon-downloads/http://massively.joystiq.com/2012/05/04/tera-hits-the-1-spot-for-amazon-downloads/http://massively.joystiq.com/2012/05/04/tera-hits-the-1-spot-for-amazon-downloads/#commentsFiled under: , , , , ,

Unquestionably the best game named TERA released in May this year.
Whenever a game launches, there's always a question of whether it will sink or swim. MMOs don't necessarily live or die on the basis of their launches, but it takes a lot more effort to recover from a bad launch. TERA seems to have gotten off on the right foot, as it hit the #1 download spot for Amazon during its launch week, and all projections point to it hitting the top spot next week as well.

If you're tempted to jump on the bandwagon, now is definitely the time. Through the 31st of the month, players who purchase the game will receive discounted subscription rates as well as a special Golden Dragon weapon skin. The Digital Collector's Edition from Amazon also features a special mount and two necklaces to help improve your journey through the game world. If you like little added bits of value, now might be the time to give the game a shot.

[Source: Amazon press release]

MassivelyTERA hits the #1 spot for Amazon downloads originally appeared on Massively on Fri, 04 May 2012 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>amazonblueholebluehole-studiosdigital-distributiondigital-editiondirect-downloadsdownloadsen-masseen-masse-entertainmentfantasylaunchnew-launchesnew-titlesteraFri, 04 May 2012 17:00:00 EST<![CDATA[Matt Higby discusses PlanetSide 2's progression and customization]]>http://massively.joystiq.com/2012/05/02/matt-higby-discusses-planetside-2s-progression-and-customizatio/http://massively.joystiq.com/2012/05/02/matt-higby-discusses-planetside-2s-progression-and-customizatio/http://massively.joystiq.com/2012/05/02/matt-higby-discusses-planetside-2s-progression-and-customizatio/#commentsFiled under: , , , , , ,

I'm not actually in the war, I just like riding this ATV.
PlanetSide 2 has but one real game it must live up to, but if you consider the unique elements that its predecessor brought to the table, that's still a tall order. A recent interview with the game's creative director, Matt Higby, highlights the ways that the game is being designed to fulfill the requirements of an engaging MMO and an engaging FPS. That means giving characters plenty of progression without locking out new players who just want to shoot things.

The game's overall progression path is meant to be one of options, not straight power. That's the case for classes as well as advancement; Heavy Assault characters will play distinctly from other classes, but they'll have a variety of unique abilities that players can choose among. The interview also sheds more light on what players can expect from the game's overarching persistent elements, which set the game and its factions apart from standard FPS fare. The game still has a long way to go in development, but what's been shown thus far is definitely an encouraging start.

MassivelyMatt Higby discusses PlanetSide 2's progression and customization originally appeared on Massively on Wed, 02 May 2012 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>developmentfpsinterviewsmatt-higbymmo-shootermmofpsnew-titlesplanetsideplanetside-2previewsps2sci-fishootersoesonysony-online-entertainmentupcoming-titlesWed, 02 May 2012 17:00:00 EST<![CDATA[Aeria Games announces its new MMORTS, Dragon Crusade]]>http://massively.joystiq.com/2012/04/26/aeria-games-announces-their-new-mmorts-dragon-crusade/http://massively.joystiq.com/2012/04/26/aeria-games-announces-their-new-mmorts-dragon-crusade/http://massively.joystiq.com/2012/04/26/aeria-games-announces-their-new-mmorts-dragon-crusade/#commentsFiled under: , , , , , , ,

Not sure exactly where dragons enter in to all this.
While years have gone by without many entries into the MMORTS genre, the list of contenders is slowly but steadily expanding. Add Dragon Crusade to the list; it's an upcoming free-to-play browser title just announced by Aeria Games. The game will feature six different races, each with its own strengths and weaknesses as well as a unique racial capital. The core of the game, however, isn't meant to simply be your choice of race; it's building an actual kingdom over multiple cities.

Kingdoms are meant to add an important strategic resource to the game. Players are responsible for the defense of their cities, forcing a balance between gaining new ground and protecting what's already there. Players will also be granted a variety of different heroes, mounts, and pets, all of which have special development paths to give player forces a unique flair. There's no word yet on when the game will go into general release, but potential players can register for the upcoming closed beta on the official site.

[Source: Aeria Games press release]

Gallery: Dragon Crusade

MassivelyAeria Games announces its new MMORTS, Dragon Crusade originally appeared on Massively on Thu, 26 Apr 2012 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>aeria-gamesbrowserbrowser-gameclosed-betadragon-crusadef2pfree-to-playgalleriesgallerymmortsnew-titlesrtsupcoming-betaThu, 26 Apr 2012 11:00:00 EST<![CDATA[Torchlight 2 available for pre-purchase on Steam]]>http://massively.joystiq.com/2012/04/25/torchlight-2-available-for-pre-purchase-on-steam/http://massively.joystiq.com/2012/04/25/torchlight-2-available-for-pre-purchase-on-steam/http://massively.joystiq.com/2012/04/25/torchlight-2-available-for-pre-purchase-on-steam/#commentsFiled under: , ,

Treasure chests. Sweet, sweet treasure chests.
With all the buzz around a certain well-known third installment of a franchise, you could be forgiven for momentarily forgetting about Torchlight 2. However, the game is now available for pre-purchase on Steam, which should serve as something of a reminder. The game doesn't yet have a firm release date other than this summer, but you can still drop your $20 and have the game ready to play on launch day.

The original Torchlight was hailed by many as the spiritual sequel to Diablo II (and some assumed it would also be the closest we'd ever get to an actual sequel). Torchlight 2 boasts more character customization, more pet customization, improved fishing and pet management, a new set of classes, and of course all of the same hack-and-slash gameplay that the first game featured. If you're a fan of the genre, that third installment likely has your eye for the moment, but you might want to see how the other half lives as well.

MassivelyTorchlight 2 available for pre-purchase on Steam originally appeared on Massively on Wed, 25 Apr 2012 22:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>launchesnew-titlespre-orderpre-purchaserunic-gamessteamtltl2torchlighttorchlight-2upcoming-titlesWed, 25 Apr 2012 22:00:00 EST<![CDATA[ChangYou plans to bring Shadowbane back in China]]>http://massively.joystiq.com/2012/04/23/changyou-plans-to-bring-shadowbane-back-in-china/http://massively.joystiq.com/2012/04/23/changyou-plans-to-bring-shadowbane-back-in-china/http://massively.joystiq.com/2012/04/23/changyou-plans-to-bring-shadowbane-back-in-china/#commentsFiled under: , , , ,

Old MMOs never die, they just get farmed out. Well, except AC2. And TMO. And E&B. And SWG...
MMOs die. It's a very sad reality, but a reality just the same. And more often than not, there's no chance for a revival. But every so often the stars align just right and fans get lucky, which is almost the case with Shadowbane. Nearly three years after the game's shutdown, it looks like it'll be getting a new lease on life... as the basis for a new title developed by ChangYou.

There are no firm details on what the new game will look like, although it appears to have been in development for roughly a year at this time. Preliminarily titled World of Shadowbane, the game is still too far in the future for any sort of launch information, much less discussion of whether or not the game will see an American release. Still, it's closer to a chance at revival than the game has had in the past three years, and that's something.

MassivelyChangYou plans to bring Shadowbane back in China originally appeared on Massively on Mon, 23 Apr 2012 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>changyoudead-mmosdead-titlesmmo-industrynew-titlesnewsshadowbanetitle-revivaltitles-in-developmentubisoftworld-of-shadowbaneMon, 23 Apr 2012 18:30:00 EST<![CDATA[Aeria announces new Waren Story MMO, releases trailer]]>http://massively.joystiq.com/2012/04/17/aeria-announces-new-waren-story-mmo-releases-trailer/http://massively.joystiq.com/2012/04/17/aeria-announces-new-waren-story-mmo-releases-trailer/http://massively.joystiq.com/2012/04/17/aeria-announces-new-waren-story-mmo-releases-trailer/#commentsFiled under: , , , , , , , , ,

Waren Story - character concept art
"The continent of Waren is divided, and a dark force is stirring in its polluted western lands." So says the latest press release from Aeria Games, which trumpets the firm's new Waren Story MMO. Naturally the dark force and the polluted lands call for plenty of heroes, and players can saddle up as one of four classes (Warrior, Gunner, Archer, or Brawler) to take on the forces of evil in Aeria's latest free-to-play offering.

The company says that players will "traverse an endless series of monster-infested plains" while exploring an "exotic medieval world," but Aeria hasn't released many details in regard to Waren Story's mechanics.

There is a brief trailer available, though, so click past the break to check it out.

[Source: Aeria Games press release]

Continue reading Aeria announces new Waren Story MMO, releases trailer

MassivelyAeria announces new Waren Story MMO, releases trailer originally appeared on Massively on Tue, 17 Apr 2012 10:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>aeriaaeria-gamesf2pfantasyfree-to-playnew-titlesvideowarenwaren-storyTue, 17 Apr 2012 10:30:00 EST<![CDATA[Dark Legends goes live for Android and Chrome]]>http://massively.joystiq.com/2012/04/11/dark-legends-goes-live-for-mobile-devices-and-chrome/http://massively.joystiq.com/2012/04/11/dark-legends-goes-live-for-mobile-devices-and-chrome/http://massively.joystiq.com/2012/04/11/dark-legends-goes-live-for-mobile-devices-and-chrome/#commentsFiled under: , , , , , ,

He bit her right in her main catsup artery.
So you like vampires? It's kind of a thing these days. Maybe you like vampires so much that you really want to play around with some vampiric content on your mobile device. That's for the best, as Spacetime Studios has released Dark Legends today. Building off the success of the studio's previous mobile/browser titles (Pocket Legends and Star Legends), the newest game allows players to take on the role of a bloodsucking monster of the night.

The game is currently available in the the Google Play Store and the Chrome app store; it won't be available in the iOS app store for a few more weeks. Like previous offerings, it's free-to-play, and you can log in from separate devices to play both on the road and at home. Unlike previous games, this one is definitely not aiming for the family market, being a fair bit more overtly violent and bloody. Still, if you feel the urge to rampage through dark alleys while you are walking through said alleys in real life, Dark Legends has you covered.

[Update: We've clarified that the game is not yet available for Apple users. Sorry for the confusion!]

MassivelyDark Legends goes live for Android and Chrome originally appeared on Massively on Wed, 11 Apr 2012 21:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>browserbrowser-mmodark-legendsf2pfree-to-playmobilenew-gamesnew-titlespocket-legendsspacetimespacetime-studiosstar-legendsvampiresWed, 11 Apr 2012 21:00:00 EST<![CDATA[Is Notch's 0x10c an MMO?]]>http://massively.joystiq.com/2012/04/05/is-notchs-0x10c-an-mmo/http://massively.joystiq.com/2012/04/05/is-notchs-0x10c-an-mmo/http://massively.joystiq.com/2012/04/05/is-notchs-0x10c-an-mmo/#commentsFiled under: , , , , ,

Notch
Markus "Notch" Persson has let slip the fact that he's working on a followup to Minecraft. The title -- jokingly referred to as Mars Effect a couple of weeks ago -- is now known as 0x10c, and it's got enough geek cred to make our hearts go pitter-patter.

First of all it's hard science-fiction, and second of all, it has an ambitious feature list that boasts an advanced economy, space battles, seamless planetary landings, and "lots of engineering." It's also got a nifty ship system wherein players will need to manage a generator and wattage to power various onboard systems.

Finally, there's a fully functioning computer within the computer game. Notch says that the "emulated 16-bit CPU can be used to control your entire ship, or just to play games [...] while waiting for a large mining operation to finish." The only question left in our minds (other than when can we play it) is whether or not it's an MMO. The website hints at single- and multiplayer functionality "via the multiverse," and it also mentions a monthly fee.

MassivelyIs Notch's 0x10c an MMO? originally appeared on Massively on Thu, 05 Apr 2012 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>0x10chard-sci-fiis-notchs-game-an-mmoMarkus-Perssonmars-effectminecraftmmo-industrynew-titlesnotchsci-fiThu, 05 Apr 2012 12:00:00 EST<![CDATA[The gates hiss open for a peek at City of Steam]]>http://massively.joystiq.com/2012/03/04/the-gates-hiss-open-for-a-peek-at-city-of-steam/http://massively.joystiq.com/2012/03/04/the-gates-hiss-open-for-a-peek-at-city-of-steam/http://massively.joystiq.com/2012/03/04/the-gates-hiss-open-for-a-peek-at-city-of-steam/#commentsFiled under: , , , , , ,

This screenshot looks more like it comes from the City of Green Women With Cool Armor and Guns. Which is a pretty neat city too.
The steampunk genre is loved by a lot of gamers, but it has yet to see a surfeit of titles. The good news for fans is that City of Steam is on the horizon, and it's promising a free-to-play browser-based experience for anyone who wants to take part in exploring ancient mechanical ruins. Of course, the question then becomes whether or not the game is worth the investment of time... something that can be solved by taking part in the game's currently running sneak peek event.

The sneak peek is available only to players who already snagged a code for access, meaning that players just coming into the game will be out of luck. It's certainly an encouraging sign that the game is moving toward its full release, which should make fans of clockwork automatons and arcane science quite happy. And if you're one of the players taking part in the sneak peek... well, all the better, right?

MassivelyThe gates hiss open for a peek at City of Steam originally appeared on Massively on Sun, 04 Mar 2012 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabetasbrowserbrowser-gamescity-of-steamcosf2pfree-to-playin-game-eventsmachinist-gamesnew-titlessneak-peeksteampunktestingupcoming-titlesSun, 04 Mar 2012 17:00:00 EST<![CDATA[Jump into Black Prophecy's past with gamigo's Nexus Conflict]]>http://massively.joystiq.com/2012/02/27/jump-into-black-prophecys-past-with-gamigos-nexus-conflict/http://massively.joystiq.com/2012/02/27/jump-into-black-prophecys-past-with-gamigos-nexus-conflict/http://massively.joystiq.com/2012/02/27/jump-into-black-prophecys-past-with-gamigos-nexus-conflict/#commentsFiled under: , , , , ,

Screenshot -- Nexus Conflict
The world of Black Prophecy hasn't always been like it is today. In the past, the Second Species Wars raged between the cybernetically augmented Tyi and the genetically modified Genides who fought for control of an area known as the Nexus, where universes collide. In a press release today, gamigo AG announced that its new title, Nexus Conflict, will allow players to take a trip back in time to participate in these wars not behind the controls of a fighter ship but on the command bridge of a colossal battle cruiser.

Nexus Conflict is being billed as a "tactical real-time strategy game," and players will be able to run it right in their browsers thanks to the Unity engine. The title will offer both PvE and PvP missions, meaning that there will be something for the co-operative and competitive crowds alike. And of course, players will be able to customize their ships with a variety of upgrades in order to turn them into the biggest, baddest, planet-blowing-up-est starships in the Nexus.

If this sounds like your idea of a good time, then just head on over to the Nexus Conflict official site (linked below) to sign up for the game's beta test, which is scheduled to begin in March.

[Source: gamigo AG press release]

MassivelyJump into Black Prophecy's past with gamigo's Nexus Conflict originally appeared on Massively on Mon, 27 Feb 2012 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabetasbrowserbrowser-basedf2pfree-to-playgamigo-agmmortsnewnew-titlenew-titlesnexus-conflictreal-time-strategyrtssci-fiscience-fictionstrategyMon, 27 Feb 2012 13:00:00 EST<![CDATA[WildStar's Troy Hewitt talks about the game's design philosophy]]>http://massively.joystiq.com/2012/02/13/wildstars-troy-hewitt-talks-about-the-games-design-philosophy/http://massively.joystiq.com/2012/02/13/wildstars-troy-hewitt-talks-about-the-games-design-philosophy/http://massively.joystiq.com/2012/02/13/wildstars-troy-hewitt-talks-about-the-games-design-philosophy/#commentsFiled under: , , , , , ,

It never goes smooth! Why can't it ever go smooth?
It's likely to be a while longer before anyone gets to lay hands on WildStar's beta, much less the finished game, but there's still a lot to look forward to. A recent interview with producer Troy Hewitt might help salve a bit of that anticipation as Hewitt discusses the game's design philosophy and content systems. As he explains, Carbine Studios embraced the idea that players should be allowed to play how they want, when they want, and with whomever they want.

This extends to the game's content at multiple levels; Hewitt explains that solo and group content shouldn't be at odds, that even people who prefer to level and play solo are still enjoying the fact that they experience a persistent world with other players. There's also a lot of talk about players crafting their own stories as they explore the game world, something augmented by the game's split between different player types. Take a look at the full interview if you're following the game avidly, as there are plenty of interesting tidbits -- even if you might have preferred a release date.

MassivelyWildStar's Troy Hewitt talks about the game's design philosophy originally appeared on Massively on Mon, 13 Feb 2012 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>carbinecarbine-studioscontentdesigndesign-philosophygroupgroupinginterviewncsoftnew-titlesnewspreviewssolosoloingtroy-hewittupcoming-titleswildstarMon, 13 Feb 2012 18:00:00 EST<![CDATA[Warner Bros. invests in Korean publisher to 'co-develop certain online games' [Updated]]]>http://massively.joystiq.com/2012/01/20/korean-developer-secures-rights-to-make-batman-lord-of-the-ring/http://massively.joystiq.com/2012/01/20/korean-developer-secures-rights-to-make-batman-lord-of-the-ring/http://massively.joystiq.com/2012/01/20/korean-developer-secures-rights-to-make-batman-lord-of-the-ring/#commentsFiled under: , , ,

Batman and Barrow-wight
Unless you live in South Korea or are a massive fan of the F.E.A.R. series, chances are you haven't heard much about Korean studio Inplay Interactive. That's going to change right now, so prepare yourself.

Inplay is a developer that's worked on F.E.A.R.: Origin Online and SNK All Stars Online but is now poised to rapidly expand its portfolio. Today, the studio announced that it has inked a deal with Warner Bros. to develop two of its most significant IPs into MMOs: Batman and Lord of the Rings. In turn, Warner Bros. will be both an investor and a shareholder of the company.

[Update: We've learned that our original source was mistranslated. Warner Bros. has indeed invested in Inplay Interactive with intent to "strengthen the Korean development capability of online games to the world." The partnership "Intend[s] To Co-Develop Certain Other Online Games by utilizing Warner Bros. Properties," but the specific properties have not as yet been disclosed as originally reported. We apologize for the confusion.]

MassivelyWarner Bros. invests in Korean publisher to 'co-develop certain online games' [Updated] originally appeared on Massively on Fri, 20 Jan 2012 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>fearfear-origin-onlineinplayinplay-interactiveipkorealord-of-the-ringslord-of-the-rings-onlinelotronew-titlessnk-all-stars-onlinesouth-koreaturbineturbine-entertainmentwarner-broswbFri, 20 Jan 2012 15:00:00 EST<![CDATA[Massively Exclusive: NEOWIZ GAMES gets bloody with Seven Souls Online debut trailer [Updated]]]>http://massively.joystiq.com/2012/01/17/massively-exclusive-neowiz-games-gets-bloody-with-seven-souls-o/http://massively.joystiq.com/2012/01/17/massively-exclusive-neowiz-games-gets-bloody-with-seven-souls-o/http://massively.joystiq.com/2012/01/17/massively-exclusive-neowiz-games-gets-bloody-with-seven-souls-o/#commentsFiled under: , , , , ,

Screenshot -- Seven Souls Online
"Let the bloodshed begin," announces the debut trailer of NEOWIZ GAMES' upcoming free-to-play martial arts title, Seven Souls Online, and wow, it is not kidding around. The announcement trailer is essentially a montage of a number of player-characters running around and beating the crap out of everything until it explodes into a fine, crimson mist. And you know what? We're totally OK with that. Sure, we don't actually know much of anything about the gameplay or the story or... well, anything else, but when I can hit something so hard that I knock it straight out of existence, none of that really matters anymore. For the full trailer, click on past the cut, and be sure to stay tuned tomorrow for more information from Seven Souls Online.

[Source: NEOWIZ GAMES]

[Update: We've added the official press release behind the break too! It includes a mention of the game's closed beta test, which you can now apply for.]

Continue reading Massively Exclusive: NEOWIZ GAMES gets bloody with Seven Souls Online debut trailer [Updated]

MassivelyMassively Exclusive: NEOWIZ GAMES gets bloody with Seven Souls Online debut trailer [Updated] originally appeared on Massively on Tue, 17 Jan 2012 21:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>7-souls7-souls-onlineannouncementannouncement-trailerbetadebutdebut-trailerf2pfree-to-playneowiz-gamesnew-titlenew-titlesseven-soulsseven-souls-onlinetrailertrailersvideovideosTue, 17 Jan 2012 21:00:00 EST<![CDATA[Jagged Alliance Online adds in PvP for testers]]>http://massively.joystiq.com/2012/01/16/jagged-alliance-online-adds-in-pvp-for-testers/http://massively.joystiq.com/2012/01/16/jagged-alliance-online-adds-in-pvp-for-testers/http://massively.joystiq.com/2012/01/16/jagged-alliance-online-adds-in-pvp-for-testers/#commentsFiled under: , , , , , ,

He shot my bike? He shot my bike! Why are you negotiating with the man who just shot my bike?!
If you've been playing in the closed beta of Jagged Alliance Online thus far, the "Online" portion of that name has probably seemed to be something of a misnomer. Beta testers have been exploring the game mechanics from the point of set missions against AI opponents, but that's all about to change. Cliffhanger Productions and gamigo have just unveiled the game's new multiplayers modes, with three different modes and six different maps for players to take up arms against one another.

The three modes consist of Deathmatch (self-explanatory), Bounty Hunter (a race to fight to a target and be the first to kill said target), and Search and Destroy (destroy three targets while protecting your own). Players will be matched via a matchmaker system based upon levels and position in the overall rankings, preventing unfair matches (in theory) and giving good players more substantive rewards for success. If you've got a need for some online turn-based strategy, it might be well worth keeping an eye on these features at they develop.

[Source: gamigo press release]

MassivelyJagged Alliance Online adds in PvP for testers originally appeared on Massively on Mon, 16 Jan 2012 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betacliffhanger-productionsclosed-betaf2pfree-to-playgamigojagged-alliance-onlinejaonew-titlespvppvp-modesstrategytestingturn-based-strategyupcoming-titlesupdatesMon, 16 Jan 2012 13:00:00 EST<![CDATA[Rumor: WAR40K canceled, THQ readying itself for sale [Updated; rumor debunked]]]>http://massively.joystiq.com/2012/01/15/rumor-war40k-canceled-thq-readying-itself-for-sale/http://massively.joystiq.com/2012/01/15/rumor-war40k-canceled-thq-readying-itself-for-sale/http://massively.joystiq.com/2012/01/15/rumor-war40k-canceled-thq-readying-itself-for-sale/#commentsFiled under: , , , , ,

Warhammer 40: Dark Millennium Online - giant robot thing
It's been a rough couple of years for Warhammer MMORPG fans, and if the rumors are true, it's about to get a bit bleaker.

Kotaku reports on a tweet by games industry insider Kevin Dent that indicates that THQ has "canceled its entire 2014 slate of releases to position the company for sale." This would include Warhammer 40K: Dark Millennium Online, which Dent referred to as "the Games Workshop MMO" on his Twitter page.

We'll keep you posted as we learn more.

[Update: THQ's Australian PR department has issued a statement asserting that the company has not in fact canceled its 2014 lineup and "has not made any decisions" regarding WAR40K.]

MassivelyRumor: WAR40K canceled, THQ readying itself for sale [Updated; rumor debunked] originally appeared on Massively on Sun, 15 Jan 2012 19:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>breakingcanceledcancellationdark-millennium-onlinemmo-industrynew-titlesrumorsci-fithqwar40k-dark-millenium-onlinewarhammerwarhammer-mmoSun, 15 Jan 2012 19:30:00 EST<![CDATA[Snail Games (officially) announces wuxia MMO, Age of Wushu]]>http://massively.joystiq.com/2012/01/06/snail-games-officially-announces-wuxia-mmo-age-of-wushu/http://massively.joystiq.com/2012/01/06/snail-games-officially-announces-wuxia-mmo-age-of-wushu/http://massively.joystiq.com/2012/01/06/snail-games-officially-announces-wuxia-mmo-age-of-wushu/#commentsFiled under: , , , , ,

Screenshot -- Age of Wushu
Have you ever been sitting around with your buddies and watching Crouching Tiger, Hidden Dragon while thinking to yourself, "Meh, I could do that"? If so, you're probably making a killing in martial arts tournaments and not reading Massively. But don't worry, there's still hope for the rest of us: Snail Games' upcoming free-to-play, wuxia-centric title, Age of Wushu is now officially announced.

For the uninitiated, wuxia is a genre of literature, movies, and games which generally includes high-flying, acrobatic ass-kicking. The game will allow players to train under eight different martial art schools, each with its own strengths and weaknesses. The press release boasts that the game features no levels or classes, warning players that "that beggar on the street may be a traveling Grand Master."

Combat, unsurprisingly, is based on wuxia-style martial arts, and will feature what the team calls a "counter combat system," which makes it sound like combat could be based around a system of attacks, counters, reversals, and so forth, just like in true martial arts. Of course, no martial-arts combat system would be complete without Crouching-Tiger-Hidden-Dragon-style aerial fights, which Snail Games has certainly included. To top it off, random NPC events, 17 different professions, and 30 offline activities should help ensure that players have something to do no matter the circumstances. To get your martial arts fix, remember to watch the game's official launch trailer we revealed yesterday, and keep an eye on Massively for more from Age of Wushu in the future.

[Source: Snail Games press release]

Continue reading Snail Games (officially) announces wuxia MMO, Age of Wushu

MassivelySnail Games (officially) announces wuxia MMO, Age of Wushu originally appeared on Massively on Fri, 06 Jan 2012 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>age-of-wushuannouncementf2pfree-to-playmartial-artsmartial-arts-schoolsnew-titlenew-titlesoffline-activitiesoffline-progressionrandom-npc-encounterssandparkschoolssnail-gameswuxiaFri, 06 Jan 2012 09:00:00 EST<![CDATA[Ask Massively: Further answers to the same questions edition]]>http://massively.joystiq.com/2011/12/29/ask-massively-further-answers-to-the-same-questions-edition/http://massively.joystiq.com/2011/12/29/ask-massively-further-answers-to-the-same-questions-edition/http://massively.joystiq.com/2011/12/29/ask-massively-further-answers-to-the-same-questions-edition/#commentsFiled under: , , , ,

All right, just the Sith Lords on the left sing this verse!
Apparently, people like talking about Star Wars: The Old Republic. Or perhaps more accurately, people enjoy arguing about it. According to comments, the game is a huge hit and failure that is in no way an accomplishment but is still unparalleled, and you can tell it will succeed and fail using a variety of metrics. Me, I've just been playing the heck out of it. Also drinking cranberry juice, but you didn't really need to know that part.

As you may have guessed, this week's installment is all about the persistent question of Star Wars: The Old Republic's getting a devoted Joystiq-flavored site. I suspect most of our regular readers are playing the game and not really thinking about asking questions. If you've got a question for next week, you can leave it in the comments below or send it along to ask@massively.com. Questions may be edited slightly for brevity or clarity.

Continue reading Ask Massively: Further answers to the same questions edition

MassivelyAsk Massively: Further answers to the same questions edition originally appeared on Massively on Thu, 29 Dec 2011 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ask-massivelycolumncolumnsfeaturedhumormassively-metammo-industrynew-titlesopinionsitesstar-wars-the-old-republicswtorThu, 29 Dec 2011 18:00:00 EST<![CDATA[Perfect World announces Fantasy Condor Heroes MMO]]>http://massively.joystiq.com/2011/12/18/perfect-world-announces-fantasy-condor-heroes-mmo/http://massively.joystiq.com/2011/12/18/perfect-world-announces-fantasy-condor-heroes-mmo/http://massively.joystiq.com/2011/12/18/perfect-world-announces-fantasy-condor-heroes-mmo/#commentsFiled under: , , , ,

Are you ready for another free-to-play martial arts MMO from China? Ready or not, Perfect World Entertainment is producing a title called Fantasy Condor Heroes, according to a news blurb at Gamasutra.

If you're a student of Chinese popular culture, that name may ring a bell since it's taken from a wuxia novel called Return of the Condor Heroes. The book was written by author Louis Cha (under the pen name Jin Yong) and originally serialized in the late 1950s. Thus far Perfect World has not made any feature- or gameplay-related details available, nor do we know when Fantasy Condor Heroes will be released.

MassivelyPerfect World announces Fantasy Condor Heroes MMO originally appeared on Massively on Sun, 18 Dec 2011 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>f2pfantasyfantasy-condor-heroesfree-to-playmartial-artsmartial-arts-mmonew-titlesperfect-world-entertainmentpwewuxiaSun, 18 Dec 2011 15:00:00 EST<![CDATA[The Daily Grind: Do you try to grab names on launch?]]>http://massively.joystiq.com/2011/12/18/the-daily-grind-do-you-try-to-grab-names-on-launch/http://massively.joystiq.com/2011/12/18/the-daily-grind-do-you-try-to-grab-names-on-launch/http://massively.joystiq.com/2011/12/18/the-daily-grind-do-you-try-to-grab-names-on-launch/#commentsFiled under: , , , ,

Now and forever, it is I that will be known as Steve!
Early access for Star Wars: The Old Republic started earlier this week, and that meant that Tuesday evening saw me taking part in a time-honored tradition, namely speeding through the character creator several times in hopes of getting the names that I wanted. I got pretty lucky; out of the eight names I was hoping for, six were available and two were available with just a slight tweak, which was pretty good all around.

Of course, these are all characters that I plan on playing in the very near future, but it was still a big batch of character names right out of the starting gate. Do you do the same? When a new game comes out, do you rush to nab the names of characters you already know you want to play? Do you wait and see if you can get certain names or try to grab the same ones? Or are character names just not that important to you in the long run?

Every morning, the Massively bloggers probe the minds of their readers with deep, thought-provoking questions about that most serious of topics: massively online gaming. We crave your opinions, so grab your caffeinated beverage of choice and chime in on today's Daily Grind!

MassivelyThe Daily Grind: Do you try to grab names on launch? originally appeared on Massively on Sun, 18 Dec 2011 08:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>character-namesculturegame-launchesgrabbing-nameslaunchlaunchesnamesnew-titlesopiniontdgthe-daily-grindSun, 18 Dec 2011 08:00:00 EST<![CDATA[Monkey Quest goes portable]]>http://massively.joystiq.com/2011/12/16/monkey-quest-goes-portable/http://massively.joystiq.com/2011/12/16/monkey-quest-goes-portable/http://massively.joystiq.com/2011/12/16/monkey-quest-goes-portable/#commentsFiled under: , , , ,

Is it a blast of combos, or did he blast a combo? Truly an existential mystery.
If you or your children are fond of Nickelodeon's Monkey Quest, you may have run into the unavoidable problem that the game requires you to be home. Like many other games, however, Monkey Quest is hopping on the mobile bandwagon with Monkey Quest: Thunderbow. Available now for the iPhone and iPad, the game stars a specific monkey from the world of Ook, the eponymous Thunderbow, as he seeks to dethrone the evil cat king Zotan.

Gameplay is managed in a similar style as the popular Angry Birds games, with the caveat being that Angry Birds doesn't allow you to earn special items and equipment for use in the main Monkey Quest game. Regular updates are planned for the game to help keep players engaged and interested as Thunderbow continues his quest. So if you've got one of the portable devices and your child can't get enough monkey business, it's worth a look.

[Source: Nickelodeon press release]

MassivelyMonkey Quest goes portable originally appeared on Massively on Fri, 16 Dec 2011 21:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>appleappsipadiphoneipodmobile-appsmobile-gamesmobile-gamingmonkeymonkey-questmonkey-quest-thunderbowmonkeysnew-titlesnewsnickelodeonookFri, 16 Dec 2011 21:00:00 EST<![CDATA[Portalarium announces Ultimate Collector: Garage Sale as first title]]>http://massively.joystiq.com/2011/12/07/portalarium-announces-ultimate-collector-garage-sale-as-first-t/http://massively.joystiq.com/2011/12/07/portalarium-announces-ultimate-collector-garage-sale-as-first-t/http://massively.joystiq.com/2011/12/07/portalarium-announces-ultimate-collector-garage-sale-as-first-t/#commentsFiled under: , , ,

Ultimate Collector: Garage Sale
Richard Garriott's recent startup, Portalarium, had many people wondering what would be the first thing to come out of this mad scientist's new studio. Well, wonder no more. Now we know that Portalarium's first title will be a Facebook game known as Ultimate Collector: Garage Sale, which focuses on -- you guessed it -- collecting things that you buy at garage sales. We couldn't make this up if we tried.

Players can create an avatar and customize their houses, and then go shopping at estate sales, garage sales, pawn shops, and so forth in order to complete collections of items. These item collections can then be displayed in your house as a trophy of sorts, or you can sell them to make a quick buck. We'll just have to wait and see how this bizarre project shapes up in the coming months.

MassivelyPortalarium announces Ultimate Collector: Garage Sale as first title originally appeared on Massively on Wed, 07 Dec 2011 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>announcementgarage-salenew-titlenew-titlesportalariumrichard-garriottultimate-collectorultimate-collector-garage-saleWed, 07 Dec 2011 18:00:00 EST<![CDATA[TERA producer confident that game offers something new]]>http://massively.joystiq.com/2011/12/05/tera-producer-confident-that-game-offers-something-new/http://massively.joystiq.com/2011/12/05/tera-producer-confident-that-game-offers-something-new/http://massively.joystiq.com/2011/12/05/tera-producer-confident-that-game-offers-something-new/#commentsFiled under: , , , , , ,

TERA - High elf priestess
"If we had simply cloned a successful MMO, I think we'd have a battle on our hands, but we didn't," says TERA Europe producer Stephan Krippendorf. He's talking, of course, about the inevitable World of Warcraft comparisons that dog every new fantasy MMO (comparisons that seem particularly irrelevant given TERA's impressive visuals and divergent combat).

"When you dive into the game for the first time, swing a sword, cast a spell, dodge and weave in combat, you'll be hooked," Krippendorf explains in an interview at Videogamer.com. The sit-down covers a bit about the game's action combat mechanics as well as the story elements and the endgame political system, but most of the juicy tidbits center around the title's potential success in a crowded MMO market.

"I think TERA has what it takes to be a huge success though, regardless of WoW numbers," Krippendorf concludes.

MassivelyTERA producer confident that game offers something new originally appeared on Massively on Mon, 05 Dec 2011 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-combatarboreafantasyinterviewmmo-industrynew-titlespolitical-systemstephan-krippendorfteratera-europeWorld-of-WarcraftwowMon, 05 Dec 2011 10:00:00 EST<![CDATA[TERA website updates with glyph descriptions]]>http://massively.joystiq.com/2011/12/03/tera-website-updates-with-glyph-descriptions/http://massively.joystiq.com/2011/12/03/tera-website-updates-with-glyph-descriptions/http://massively.joystiq.com/2011/12/03/tera-website-updates-with-glyph-descriptions/#commentsFiled under: , , , , , ,

TERA - Lancer in battle
Well, it's not a release date announcement, but it's not another big-ass monster reveal either, so we'll call that a win. What the heck are we talking about? The official TERA website has updated with a news blurb about the fantasy title's glyph system. The glyph mechanics become available at level 25, and they basically buff your various class skills. Influence and brilliance glyphs lower the MP cost of skill usage; energy and persistence glyphs give you shorter cooldowns; and glyphs of lingering increase skill durations.

There are hundreds of glyphs to choose from, and each skill has four different glyphs available. Head to the official site for more info, including specifics on Lancer and Sorcerer glyphs. TERA is currently scheduled for a spring 2012 release in the West.

MassivelyTERA website updates with glyph descriptions originally appeared on Massively on Sat, 03 Dec 2011 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>classesdev-blogen-masseen-masse-entertainmentfantasygame-mechanicsglyph-systemglyphslancermmo-industrynew-titlesskillssorcererteraSat, 03 Dec 2011 18:00:00 EST<![CDATA[Goblinworks announces Pathfinder Online]]>http://massively.joystiq.com/2011/11/22/goblinworks-announces-pathfinder-online/http://massively.joystiq.com/2011/11/22/goblinworks-announces-pathfinder-online/http://massively.joystiq.com/2011/11/22/goblinworks-announces-pathfinder-online/#commentsFiled under: , ,

Pathfinder logo
For pen-and-paper RPG players, Pathfinder remains a perennial favorite game setting. Those players may find themselves excited to know, then, that Goblinworks has announced Pathfinder Online. This MMORPG adaptation of the extremely popular system will be a "hybrid sandbox/theme park-style MMO roleplaying game." The title will feature a "robust trading system [that] puts players in control of the world's economy," which should be wonderful for players who like to work the market. Characters can also establish settlements and expand them into full kingdoms while raising an army to help defend their turf.

The announcement boasts randomly generated events, as well, stating that "as settlements develop, the surrounding wilderness develops more complex and challenging features." The goal appears to be not just to create a game, but in fact to bring to life a real, evolving world. Pathfinder fans should keep their eyes on Goblinworks' official site, where further development updates will be posted.

MassivelyGoblinworks announces Pathfinder Online originally appeared on Massively on Tue, 22 Nov 2011 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>announcementgoblinworkshybridnew-gamenew-gamesnew-titlenew-titlespathfinderpathfinder-onlinepen-and-paperpnpsandbox-theme-park-hybridTue, 22 Nov 2011 19:00:00 EST<![CDATA[Maverick details Unveiled: The Supernatural's progression system]]>http://massively.joystiq.com/2011/11/09/maverick-details-unveiled-the-supernaturals-progression-system/http://massively.joystiq.com/2011/11/09/maverick-details-unveiled-the-supernaturals-progression-system/http://massively.joystiq.com/2011/11/09/maverick-details-unveiled-the-supernaturals-progression-system/#commentsFiled under: , , , , , , ,

Unveiled The Supernatural - Hunter concept art
A few days ago we told you about Unveiled: The Supernatural, a new horror MMORPG from South Korea's Maverick Studios. Today we've got a bit more info for you, as the development team has released an official press blurb along with a gaggle of screenshots.

The press release touches on everything from the game's setting (the modern day real world, including New York City and the Hatra ruins in Iraq) to the races and progression mechanics.

Unveiled features hunters, vampires, witches, and werewolves as its playable races, and a classless progression system that involves spending mastery points as you level. Each character can have ten separate mastery trees (weapons, psychic, paranormal, magic, and many more). Inside each tree, you can learn up to ten powers, and you may also stumble across rare items called essences that allow your character to acquire a native power trait of another race.

Finally, Maverick says that the game will be PvP-focused, and the press blurb mentions race vs. race, guild vs. guild, and team vs. team variants. We'll bring you more on the game as it becomes available. In the meantime, have a look through the concept art and screenshot gallery below.

[Source: Maverick press release]

Gallery: Unveiled: The Supernatural

MassivelyMaverick details Unveiled: The Supernatural's progression system originally appeared on Massively on Wed, 09 Nov 2011 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>classless-progressiondemon-huntersfantasygalleryhorrormaverickmaverick-studiosnew-titlesscreenshotsunveiledunveiled-the-supernaturalvampireswerewolveswitchesWed, 09 Nov 2011 14:00:00 EST<![CDATA[SEE Games confirms Total Recall browser MMO]]>http://massively.joystiq.com/2011/11/08/see-games-confirms-total-recall-browser-mmo/http://massively.joystiq.com/2011/11/08/see-games-confirms-total-recall-browser-mmo/http://massively.joystiq.com/2011/11/08/see-games-confirms-total-recall-browser-mmo/#commentsFiled under: , , , ,

What the what
A few months ago, we reported that SEE Virtual Worlds had acquired a number of well-known intellectual properties, including the upcoming Total Recall remake. At the time, however, it was unknown how the company would put those properties to use.

Well, wonder no more. SEE has announced that it is working on a browser-based Total Recall MMO which will tie into the upcoming film remake. The game will be free-to-play and supported by microtransactions. No release date has been announced yet, but the movie itself is tentatively scheduled for August 3rd, 2012, so a similar release date for the game wouldn't be unreasonable.

MassivelySEE Games confirms Total Recall browser MMO originally appeared on Massively on Tue, 08 Nov 2011 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>announcementbrowserbrowser-basedf2pfilmfilmsfree-to-playget-your-ass-to-marsmoviemoviesnew-titlessee-gamessee-virtual-worldstotal-recalltotal-recall-remakeTue, 08 Nov 2011 13:00:00 EST<![CDATA[City of Steam browser title features unique steampunk world]]>http://massively.joystiq.com/2011/11/05/city-of-steam-browser-title-features-unique-steampunk-world/http://massively.joystiq.com/2011/11/05/city-of-steam-browser-title-features-unique-steampunk-world/http://massively.joystiq.com/2011/11/05/city-of-steam-browser-title-features-unique-steampunk-world/#commentsFiled under: , , , , , ,

City of Steam
Steampunk continues to be a source of fascination for both game geeks and game developers, and the latest example of the phenomenon in MMO circles is a new title called City of Steam.

An interview at Light Speed Gaming spills the beans on the browser-based title, which is being developed by a Chinese firm called Mechanist Games. If you've ever wanted to play a mechanical dwarf, or explore a world that is literally a giant machine, City of Steam may be your game. The setting is borrowed from a series of RPG books and incorporates all the elements of fantastical steampunk (plus a few novel twists) that fans of the genre have come to expect.

"The world itself is a giant machine, and is, in fact flat. The elemental planes aren't found by mystical methods -- you can literally walk across the teeth of the world to reach them. The sun and stars are actually tethered to the world, orbiting as gyroscopic pieces of the superstructure of existence," according to the designers. Head to Light Speed Gaming for more on the setting and the game mechanics, and don't forget to view the video embed after the break.

[Thanks to Soren for the tip!]

Continue reading City of Steam browser title features unique steampunk world

MassivelyCity of Steam browser title features unique steampunk world originally appeared on Massively on Sat, 05 Nov 2011 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>browserbrowser-basedcity-of-steamfantasygame-mechanicsloremechanistmechanist-gamesmmo-industrynew-titlessettingsteampunkvideoworld-designSat, 05 Nov 2011 14:00:00 EST<![CDATA[Beta registration opened for upcoming sci-fi MMOFPS Repulse]]>http://massively.joystiq.com/2011/11/03/beta-registration-opened-for-upcoming-sci-fi-mmofps-repulse/http://massively.joystiq.com/2011/11/03/beta-registration-opened-for-upcoming-sci-fi-mmofps-repulse/http://massively.joystiq.com/2011/11/03/beta-registration-opened-for-upcoming-sci-fi-mmofps-repulse/#commentsFiled under: , , , , , ,

Five seconds after the trailer ends, a tender kiss.
It's proving to be quite the year for MMOFPS fans, with several upcoming titles aimed in precisely that direction. Repulse is another entry in the genre from Aeria Games, set in a future setting wherein human beings have polluted the planet beyond repair. The remaining parts of humanity have found a new home in the stars, but unfortunately, the planet is already inhabited, and its existing residents aren't terribly keen on letting humans move in.

Closed beta registration has just begun on the official site, with a trailer and some early promotional artwork to help build excitement. The game promises to host several different play modes, as well as giving players the option to switch classes mid-combat while experimenting with a variety of different gear setups. If you're a fan of the genre, you might want to take a look at the trailer just past the cut and perhaps sign up for the beta now, rather than later.

Gallery: Repulse

Continue reading Beta registration opened for upcoming sci-fi MMOFPS Repulse

MassivelyBeta registration opened for upcoming sci-fi MMOFPS Repulse originally appeared on Massively on Thu, 03 Nov 2011 22:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>aeria-gamesf2pfree-to-playgalleriesgallerymmofpsnew-titlespreviewsrepulsesci-fishootertrailertrailersvideovideosThu, 03 Nov 2011 22:00:00 EST<![CDATA[MechWarrior Online announced]]>http://massively.joystiq.com/2011/10/31/mechwarrior-online-announced/http://massively.joystiq.com/2011/10/31/mechwarrior-online-announced/http://massively.joystiq.com/2011/10/31/mechwarrior-online-announced/#commentsFiled under: , , ,

No BattleTech game is complete without a solid 100 tons of Atlas.
In the future, battles will be fought via BattleMechs -- enormous walking tanks covered in weapons, waging war for control of the region of known space called the Inner Sphere. Sound familiar? It's the premise behind the BattleTech series of games, including the popular MechWarrior franchise. And apparently, in late 2012, players will have the chance to get inside a 'Mech of their own in a new online installment to the series, MechWarrior Online, announced by Piranha Games.

The announcement comes with a slew of questions and answers for expectant players, including information about customizing one's 'Mech, which of the classic designs will be seen in the game, and of course details about the world and timeline that the game takes place. There are no details regarding a beta at the moment, but the team seems quite insistent that the game will launch in 2012. It's certainly going to make next year interesting for all life-long MechWarrior fans.

MassivelyMechWarrior Online announced originally appeared on Massively on Mon, 31 Oct 2011 19:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>announcementsbreakingf2pfree-to-playmechwarriormechwarrior-onlinemwonew-titlespiranha-gamesupcoming-titlesMon, 31 Oct 2011 19:30:00 EST<![CDATA[The Sandbox interviews Repopulation developer]]>http://massively.joystiq.com/2011/10/21/the-sandbox-interviews-repopulation-developer/http://massively.joystiq.com/2011/10/21/the-sandbox-interviews-repopulation-developer/http://massively.joystiq.com/2011/10/21/the-sandbox-interviews-repopulation-developer/#commentsFiled under: , , , , , ,

The Repopulation - screenshot of a dude on a hill
The latest episode of The Sandbox podcast is worth a listen if you're curious about The Repopulation. Developer Josh Halls is the guest of honor and he sits down with host Coolit for a lengthy chat about Above & Beyond Technologies' upcoming sci-fi title. "It's not a full-blown sandbox game where you're dumped in a barrel and have to figure out what to do. There are both elements of sandbox gameplay as well as the more rollercoaster-type designs that you're used to that are more structured," Hall explains.

The themepark bells and whistles are front-loaded into the game in order to provide players with adequate tutorials. After that, Hall says, you're free to build your own nation, explore, and do whatever it is that tickles your creative fancy.

Hall also gives a bit of detail on the size of the dev team ("four or five guys" at the moment) as well as some commentary on the Hero engine and various aspects of The Repopulation's gameplay. Head to the The Sandbox for the full show.

MassivelyThe Sandbox interviews Repopulation developer originally appeared on Massively on Fri, 21 Oct 2011 11:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>above-and-beyond-technologiesdevelopmentgame-mechanicshero-engineinterviewjosh-hallnew-titlessandboxsci-fithe-repopulationFri, 21 Oct 2011 11:30:00 EST<![CDATA[Funcom talks The Secret World at NYCC]]>http://massively.joystiq.com/2011/10/17/funcom-talks-the-secret-world-at-nycc/http://massively.joystiq.com/2011/10/17/funcom-talks-the-secret-world-at-nycc/http://massively.joystiq.com/2011/10/17/funcom-talks-the-secret-world-at-nycc/#commentsFiled under: , , , , , ,

The Secret World - starring Fox Mulder
MMORPG.com's got the details on Funcom's appearance at last weekend's New York City Comic Con. Ragnar Tornquist and Dag Scheve were on hand to hype The Secret World, and the duo was the main attraction on a panel that fielded fan questions and showed off some new gameplay footage.

Several of the questions from the audience related to The Secret World's progression mechanics, and Tornquist stated that despite the fact that the game has no levels, there will be plenty of activities for grind aficionados. The term horizontal progression was mentioned, as were various skills and gear (the latter of which serves as a gate between different bits of the game's content). Check out the rest of the recap, along with a video embed, at MMORPG.com.

MassivelyFuncom talks The Secret World at NYCC originally appeared on Massively on Mon, 17 Oct 2011 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>comic-conconventionsdag-schevefantasyfuncomgrindhorrorhypemmo-industrynew-titlesnew-york-city-comic-connyccprogressionRagnar-Tornquistreal-world-eventsthe-secret-worldtswMon, 17 Oct 2011 12:00:00 EST<![CDATA[The Repopulation influenced by UO and SWG]]>http://massively.joystiq.com/2011/10/14/the-repopulation-influenced-by-uo-and-swg/http://massively.joystiq.com/2011/10/14/the-repopulation-influenced-by-uo-and-swg/http://massively.joystiq.com/2011/10/14/the-repopulation-influenced-by-uo-and-swg/#commentsFiled under: , , , , , ,

The Repopulation - Is that Tatooine?
Searching for more info on the new indie sandbox called The Repopulation? If so, check out an interview with Above & Beyond Technologies' creator J.C. Smith at Quick Jump.

The piece covers a lot of ground, and Smith talks about everything from inspiration for the sci-fi title to the current state of the cluttered MMO market. "I think this market still has room for growth, and that the main reason we see some of these titles as failures is due to elevated expectations and bloating budgets," Smith explains.

What's going to set The Repopulation apart, then? That's a much longer answer, and portions of it will no doubt set sandbox fans' hearts aflame. "We probably drew more influence from Ultima Online and Star Wars Galaxies than we have from any other MMOs," Smith says. "To me, UO was what I expected from an MMOG."

MassivelyThe Repopulation influenced by UO and SWG originally appeared on Massively on Fri, 14 Oct 2011 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>above-and-beyondabove-and-beyond-technologiesgreat-expectationsinterviewjc-smithnew-titlessandboxsci-fiscifistar-wars-galaxiesswgthe-repopulationultima-onlineuoFri, 14 Oct 2011 12:00:00 EST<![CDATA[Introducing Shadowrun Online]]>http://massively.joystiq.com/2011/10/13/introducing-shadowrun-online/http://massively.joystiq.com/2011/10/13/introducing-shadowrun-online/http://massively.joystiq.com/2011/10/13/introducing-shadowrun-online/#commentsFiled under: , ,

Shadowrun Online
Cliffhanger Productions, the makers of the upcoming Jagged Alliance Online, has announced another title in progress: Shadowrun Online. Based on the popular pen-and-paper game, Shadowrun will share a similar top-down strategy format with Jagged Alliance. Shadowrun takes place in a dystopian 2070 where magic and technology clash, and where hackers and street samurai are commonplace.

Shadowrun Online players will split their game time between prepping missions and carrying them out. While some of the maps will require all-out action efforts, others will require stealth, hacking, and even magic. Between fights, players will seek out contacts, prepare spells, and purchase gear to improve their odds when the time comes.

Shadowrun Online is in pre-production and the team hopes to get it into full development by November. It is planned to be a browser-based title, and Cliffhanger is drawing from Shadowrun alumni efforts to keep the game in line with the franchise. The company is still looking for partners to help with publishing and distributing.

MassivelyIntroducing Shadowrun Online originally appeared on Massively on Thu, 13 Oct 2011 09:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>browserbrowser-basedcliffhangercliffhanger-productionsdystopiahackersjagged-alliance-onlinenew-titlenew-titlespen-and-papershadowrunshadowrun-onlinestrategystreet-samuraitop-down-strategyThu, 13 Oct 2011 09:30:00 EST<![CDATA[Firefall dev says new MMO shooter will transcend the 'circle of suck']]>http://massively.joystiq.com/2011/10/06/firefall-dev-says-new-mmo-shooter-will-transcend-the-circle-of/http://massively.joystiq.com/2011/10/06/firefall-dev-says-new-mmo-shooter-will-transcend-the-circle-of/http://massively.joystiq.com/2011/10/06/firefall-dev-says-new-mmo-shooter-will-transcend-the-circle-of/#commentsFiled under: , , , , , , , ,

Firefall - Circle of suck Venn diagram
Red 5 Studios CEO Mark Kern has been around the game development block a time or two. With a resume that includes StarCraft, Diablo 2, Warcraft 3, and World of Warcraft, he's no stranger to successful multiplayer titles.

So why is he heading up the development of Firefall, a free-to-play MMO/shooter hybrid that aims to stand genre convention on its head? Well, precisely because it aims to stand genre convention on its head. "If I see another action MMO combat game with exclamation points over quest givers, I'm going to commit seppuku! We're pouring so much money [into] a very stale formula," he recently told PC Gamer.

Previous attempts at blending MMO and shooter gameplay have resulted in what Kern colorfully terms the "circle of suck," but Firefall will break that mold due to its unique mind meld of both genres. "Let's get the shooting right, and selectively add in the MMO elements. Let's take the idea of open world sandbox play and feature hundreds of players instead of four- or eight-player co-op. Let's take towns, crafting, and resources and combine it all together. And that group would be a much more fun game when we started playing it than anything we'd tried before," Kern says.

MassivelyFirefall dev says new MMO shooter will transcend the 'circle of suck' originally appeared on Massively on Thu, 06 Oct 2011 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmocircle-of-suckco-opf2pfirefallfree-to-playhybridinterviewsmark-kernmmo-industrymmo-shooternew-titlessandboxsci-fishooterThu, 06 Oct 2011 09:00:00 EST<![CDATA[Perfect World Entertainment announces War of the Immortals]]>http://massively.joystiq.com/2011/09/28/perfect-world-entertainment-announces-war-of-the-immortals/http://massively.joystiq.com/2011/09/28/perfect-world-entertainment-announces-war-of-the-immortals/http://massively.joystiq.com/2011/09/28/perfect-world-entertainment-announces-war-of-the-immortals/#commentsFiled under: , , , , , ,

At some point, the whole zoom-in motif of flying toward an airborne city is going to get old. It may have already done so.
If you're a fan of Perfect World Entertainment's library of games, odds are good that you've been battling against immortals for some time now. But that's being ratcheted up several steps to full-fledged war. All right, War of the Immortals isn't exactly a direct extension of Battle of the Immortals, but the upcoming action MMO certainly has some connections to the older title. Nevertheless, it's still worth a look from fans of the genre, especially with its closed beta starting on October 25th.

War of the Immortals promises guild housing and territory control as players engage in battle against both enemies and one another. Players can choose between eight different classes, with each class linked to a unique set of "soul gear" that advance as the individual character progresses through the game. If it sounds up your alley, you might want to check out the announcement trailer embedded just after the cut.

[Source: PWE press release]

Continue reading Perfect World Entertainment announces War of the Immortals

MassivelyPerfect World Entertainment announces War of the Immortals originally appeared on Massively on Wed, 28 Sep 2011 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>actionaction-mmoannouncement-trailerbattle-of-the-immortalsboif2pfree-to-playlaunch-trailernew-titlesnewsperfect-world-enterainmentpreviewpwetrailerupcoming-titleswar-of-the-immortalswoiWed, 28 Sep 2011 09:00:00 EST<![CDATA[Some Assembly Required: Diving into details of Origins of Malu with an exclusive interview]]>http://massively.joystiq.com/2011/09/16/some-assembly-required-diving-into-details-of-origins-of-malu/http://massively.joystiq.com/2011/09/16/some-assembly-required-diving-into-details-of-origins-of-malu/http://massively.joystiq.com/2011/09/16/some-assembly-required-diving-into-details-of-origins-of-malu/#commentsFiled under: , , , , , , ,

Some Assembly Required header image
"This will be the world's best game ever ever ever!" -Michael Dunham. You tell 'em!

Honestly, we have heard it before: MMORPG feature lists that promise what our sandbox-loving hearts desire. Try as we might, we cannot escape those sneaky tendrils of hope that find the chinks in our +10 jaded armor of cynicism as we read about the return of a true virtual where actions have consequences, personal choices dictate gameplay, and individuality is a matter of principle.

Sadly, time and time again those hopes are dashed by titles that either cannot deliver on their promises or never even survive until launch. The same is true for the developers at Burning Dog Media; they too have ridden the roller coaster of sandbox dreams and harbored in their hearts a vision of their ultimate game if only they had the wherewithal to produce it. The difference between them and us is... they do!

Welcome to issue #6 of Some Assembly Required -- an exclusive interview with Michael Dunham and Dave Cruikshank -- Lead Developer and Art Director of Burning Dog Media, respectively -- who are in the midst of developing the new sci-fi/fantasy MMORPG Origins of Malu. Originally called just Origins (the change was to help avoid confusion with other projects that were cropping up with similar titles), this game previously teased sandbox aficionados with a glimpse at some hope-stirring features. Today, we have the privilege of expounding on "coming soon" and revealing more features that not only are planned but are for the most part implemented.

So why should we check out Origins of Malu? And what tantalizing tidbits of sandboxy goodness can we expect? Grab onto that hope and dive past the cut -- if you dare -- to see what Michael and Dave have to share.

Gallery: Origins of Malu

Continue reading Some Assembly Required: Diving into details of Origins of Malu with an exclusive interview

MassivelySome Assembly Required: Diving into details of Origins of Malu with an exclusive interview originally appeared on Massively on Fri, 16 Sep 2011 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>AIburning-dogburning-dog-mediacharacter-customiationcraftingdave-cruikshankduelingduelseconomyexclusivefactionsfantasyfeaturedharvestinghousinginterviewmassively-exclusive-interviewsmichael-dunhamnew-titlesoriginsOrigins of Maluorigins-mmoOrigins-of-MaluOriginsOfMalupermadeathpvpsandboxsandbox-mmosci-fiscifisome-assembly-requiredFri, 16 Sep 2011 10:00:00 EST<![CDATA[Blade & Soul Assassin abilities on display in new video]]>http://massively.joystiq.com/2011/08/26/blade-and-soul-assassin-abilities-on-display-in-new-video/http://massively.joystiq.com/2011/08/26/blade-and-soul-assassin-abilities-on-display-in-new-video/http://massively.joystiq.com/2011/08/26/blade-and-soul-assassin-abilities-on-display-in-new-video/#commentsFiled under: , , , , , , ,

Blade & Soul - assassin video
Say what you will about NCsoft's mysterious Blade & Soul import, but it certainly brings its share of eye candy to the table. MMO Culture has posted a new video featuring the martial arts MMORPG, and the clip centers on the nimble Assassin class and its deadly array of combos and fighting abilities.

The video runs under two minutes and is basically a series of one-on-one combat vignettes. If your Korean language skills are up to the task, you might be able to decipher the various intertitles and subtitles that accompany the presentation. If not, you can still get a feel for how the class is going to play thanks to the footage, which you can view in its entirety after the cut.

Continue reading Blade & Soul Assassin abilities on display in new video

MassivelyBlade & Soul Assassin abilities on display in new video originally appeared on Massively on Fri, 26 Aug 2011 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>abilitiesassassinblade-and-soulclass-videoclassesclosed-beta-2combatcombosfantasygame-mechanicsgameplaykorean-betakorean-importkorean-mmomartial-artsncsoftnew-titlesvideoFri, 26 Aug 2011 12:00:00 EST<![CDATA[Massively's exclusive TERA lore: A day in the life of Gernakul the Dracoloth]]>http://massively.joystiq.com/2011/08/26/massivelys-exclusive-tera-lore-a-day-in-the-life-of-gernakul-t/http://massively.joystiq.com/2011/08/26/massivelys-exclusive-tera-lore-a-day-in-the-life-of-gernakul-t/http://massively.joystiq.com/2011/08/26/massivelys-exclusive-tera-lore-a-day-in-the-life-of-gernakul-t/#commentsFiled under: , , , , , ,

TERA - dracoloth
Welcome, TERA fans, to another installment of Massively's exclusive A Day in the Life lore series. The recent news of TERA's spring 2012 launch delay may have dampened your spirits (or perhaps bolstered them if you're of the release-it-when-it's-ready mentality), but En Masse is here to tide us over with another interesting story snippet from the world of Arborea.

This time around we're treated to the tale of Volorius, a devan soldier who makes a pact with an unlikely ally named Gernakul. Gernakul is a dracoloth, and as you can tell from the screenshot above, he's not to be messed with. Aside from decimating a camp of heavily armored soldiers and snacking on a overconfident sorcerer, Gernakul is possessed of a treacherous and nasty disposition, as Volorious soon learns. Read about his fate after the cut.

Continue reading Massively's exclusive TERA lore: A day in the life of Gernakul the Dracoloth

MassivelyMassively's exclusive TERA lore: A day in the life of Gernakul the Dracoloth originally appeared on Massively on Fri, 26 Aug 2011 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>a-day-in-the-lifearboreablueholebluehole-studiodracolothen-masseen-masse-entertainmentexclusivefantasyfeaturedfran-stewartgernakulgernakul-the-dracolothlorenew-titlesteratera-onlinevoloriusFri, 26 Aug 2011 11:00:00 EST