Massively http://massively.joystiq.com Massively http://www.blogsmithmedia.com/http://massively.joystiq.com/media/feedlogo.gif Massively http://massively.joystiq.com en-us Copyright 2012 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[Ultima Online rolling out a new installment of the Awakening]]>http://massively.joystiq.com/2012/05/21/ultima-online-rolling-out-a-new-installment-of-the-awakening/http://massively.joystiq.com/2012/05/21/ultima-online-rolling-out-a-new-installment-of-the-awakening/http://massively.joystiq.com/2012/05/21/ultima-online-rolling-out-a-new-installment-of-the-awakening/#commentsFiled under: , , , , ,

In some cases, sleep is better than awakening. Like waking up to a fight against a giant squid monster.
Ultima Online is preparing a continuation of the game's latest global arc with tomorrow's patch. Act VI of The Awakening asks players to assist in crafting a number of alchemical preparations, with a number of rewards available for players who actively try to crack the puzzle of the correct ingredients. More information will be available from the official site as well as an in-game NPC. If you need more time to prepare, don't worry -- the quest is going active in July and lasting until mid-August.

If you're not willing to wait, the new patch also sees a revamp of the Covetous Dungeon. The first floor remains largely unchanged, but levels two and three both feature a new system for the game in which players accumulate points for defeating monsters that can later be turned in for new rewards. Last but not least, vanilla plants have been added to the game's gardening system, giving players another new thing to explore when not fighting monsters or preparing for the next part of The Awakening.

MassivelyUltima Online rolling out a new installment of the Awakening originally appeared on Massively on Mon, 21 May 2012 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>classic-mmodungeon-revampsdungeonseaelectronic-artsfantasygame-mechanicsglobal-arclord-britishmythicmythic-entertainmentnew-contentnew-patchnewspatchpatch-notespatchesrevampsthe-awakeningultimaultima onlineuouo-awakeningupdatesMon, 21 May 2012 18:30:00 EST<![CDATA[DC Universe Online shows off the new Shield weapon]]>http://massively.joystiq.com/2012/05/17/dc-universe-online-shows-off-the-new-shield-weapon/http://massively.joystiq.com/2012/05/17/dc-universe-online-shows-off-the-new-shield-weapon/http://massively.joystiq.com/2012/05/17/dc-universe-online-shows-off-the-new-shield-weapon/#commentsFiled under: , , , , , ,

Based off of a Kirby character who was based off of another Kirby character owned by a competing company.
Shields generally aren't thought of as a weapon; they're usually seen as the exact opposite of a weapon. But in the superheroic milieu, all that changes. A shield is something to be used offensively, and in DC Universe Online's next major update, players will begin wielding the shield for their own superheroic (or villainous) capers. A recent interview with creative director Jens Andersen discusses the intended role of the shield in combat.

Andersen explains that while the new weapon comes along in a very PvP-centered update, it's not meant to be used specifically for PvP; the team just wants to have something new for players to enjoy no matter what. In play, shields are similar to a staff weapon, but unlike most other weapons, the shield can continue to build a combo after a heavy strike by moving back to light strikes. That should make the shield a very aggressive option -- perhaps odd for something that's not generally thought of as a weapon.

MassivelyDC Universe Online shows off the new Shield weapon originally appeared on Massively on Thu, 17 May 2012 23:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>combatconsoleconsolesdc-universedc-universe-onlinedcuodlcf2pfree-to-playinterviewnew-abilitiesnew-contentnew-weaponspatchesplaystation-3playstation3ps3shieldshieldssoesony-online-entertainmentsuperherosuperheroesthe-last-laughupdatesweaponweaponsThu, 17 May 2012 23:00:00 EST<![CDATA[Spirit Tales launching Crisis of Jade Forest next week]]>http://massively.joystiq.com/2012/05/17/spirit-tales-launching-crisis-of-jade-forest-next-week/http://massively.joystiq.com/2012/05/17/spirit-tales-launching-crisis-of-jade-forest-next-week/http://massively.joystiq.com/2012/05/17/spirit-tales-launching-crisis-of-jade-forest-next-week/#commentsFiled under: , , , , ,

Diabeetus.
It's really hard to imagine anything in the saccharine world of Spirit Tales being properly termed a crisis, but the game's newest update is aiming in that direction. The Crisis of Jade Forest goes live on May 23rd, giving players a chance to tackle an extra-difficult version of the normal Jade Forest area with extra boss-enriched goodness. Successful players have plenty of motivation, however, as the reward for completion involves a chest that could contain items normally reserved for the game's item mall.

Groups of up to five players can enter the battle once per day, which fills the area with deadly monsters and 10 special bosses. Successfully defeating all of these bosses will grant the chance to earn both rewards that would normally cost real money as well as other little trinkets. it's also meant to be a great way to level up, so if you're already in the open beta, you may want to consider a look at the dungeon.

MassivelySpirit Tales launching Crisis of Jade Forest next week originally appeared on Massively on Thu, 17 May 2012 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>animedungeondungeon-contentf2pfree-to-playkoramgamekoramgame-ltdmicrotransactionsnew-contentpatchespreviewsspecial-contentspirit-talesupdatesThu, 17 May 2012 17:30:00 EST<![CDATA[Star Trek Online posts Ask Cryptic answers for each day of May]]>http://massively.joystiq.com/2012/05/04/star-trek-online-posts-ask-cryptic-answers-for-each-day-of-may/http://massively.joystiq.com/2012/05/04/star-trek-online-posts-ask-cryptic-answers-for-each-day-of-may/http://massively.joystiq.com/2012/05/04/star-trek-online-posts-ask-cryptic-answers-for-each-day-of-may/#commentsFiled under: , , , , ,

Attacking DS9 is always something like content.
Converting a game from a subscription model is hard work. That's the theme throughout the latest installment of Star Trek Online's regular Ask Cryptic feature: The reason that the game has gone for so long without major batches of new content is that the team has been wholly focused on switching models. But there's more coming to the game in the near future, starting with the major Season 6 patch hitting the test server soon.

The coming patch will feature new ground and space missions similar to STFs without being quite the same sort of content. The update will also feature a new Fleet Advancement system, which will give player groups a chance to improve themselves and acquire new bonuses. Star Trek Online players will be well-served by taking a look at the full list of answers, which go into further detail about upcoming systems and planned additions for the next patch and beyond.

MassivelyStar Trek Online posts Ask Cryptic answers for each day of May originally appeared on Massively on Fri, 04 May 2012 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ask-crypticcrypticcryptic-studiosdevelopmentf2pfleet-advancementfree-to-playgame-mechanicsmajor-patchmajor-patchesnew-contentpatchpatchesperfect-worldperfect-world-entertainmentpwesci-fistar-trekstar-trek-mmostar-trek-onlinestosto-season-6Fri, 04 May 2012 16:30:00 EST<![CDATA[New preview available for Final Fantasy XIV's Garuda fight]]>http://massively.joystiq.com/2012/04/24/new-preview-available-for-final-fantasy-xivs-garuda-fight/http://massively.joystiq.com/2012/04/24/new-preview-available-for-final-fantasy-xivs-garuda-fight/http://massively.joystiq.com/2012/04/24/new-preview-available-for-final-fantasy-xivs-garuda-fight/#commentsFiled under: , , , , , ,

Many-winged angel.
The primals are among the greatest forces within Eorzea, something that Final Fantasy XIV players are no doubt acutely aware of after the clash with Ifrit. The second primal battle is coming, pitting players against Garuda, deity of the Ixali. That means another pitched battle against a superior foe in the Howling Eye, a battle which the official site has just recently previewed with a video of the fight in hard mode and a video preview of the new weapon rewards.

According to the lore, the Ixali revere Garuda as the Empress of Birds, a soaring deity who maintains an appetite for the flesh of land-dwelling creatures. She is the incarnate strength of the bird-men as well as a source of great terror. But just as with Ifrit, players who defeat her can expect to have a variety of fantastic weapons, as illustrated in the video just past the break. Just be careful -- if you aren't on the ball when you fight her, you could find yourself completely blown away.

[Thanks to Alex for the tip!]

Continue reading New preview available for Final Fantasy XIV's Garuda fight

MassivelyNew preview available for Final Fantasy XIV's Garuda fight originally appeared on Massively on Tue, 24 Apr 2012 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>boss-battlesconsoleconsolesendgamefantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivgarudalorenew-contentpreviewprimalprimalssquaresquare-enixvideovideo-previewvideosTue, 24 Apr 2012 20:00:00 EST<![CDATA[Guided tour of the new SWTOR flashpoint]]>http://massively.joystiq.com/2012/04/06/guided-tour-of-the-new-swtor-flashpoint/http://massively.joystiq.com/2012/04/06/guided-tour-of-the-new-swtor-flashpoint/http://massively.joystiq.com/2012/04/06/guided-tour-of-the-new-swtor-flashpoint/#commentsFiled under: , , , , , ,

SWTOR flashpoint: The Lost Island
Yesterday, BioWare invited some members of the press to take part in a guided tour of the latest update for Star Wars: The Old Republic. In recent Hyperspace Beacons, we've covered everything from the user interface changes to the crew skills system. However, the specifics of some of the new story content have been a bit sparse. Thanks to help from BioWare, that's now changed.

Beyond the break, we have put together a 15-minute video describing the ins and outs of the latest flashpoint: The Lost Island. Together with a member of the BioWare development team, we explored this new level-50 zone, destroying everything in our path and maybe learning something along the way.

Continue reading Guided tour of the new SWTOR flashpoint

MassivelyGuided tour of the new SWTOR flashpoint originally appeared on Massively on Fri, 06 Apr 2012 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>biowaredr-lorrickdungeoneaelectronic-artsflashpointguided-tourinstancelucasartsnew-contentopinionord-mantellpreviewrakghoulRise-of-the-Rakghoulssci-fistar-warsstar-wars-the-old-republicswtorthe-lost-islandthe-old-republictorupdate-1.2videoFri, 06 Apr 2012 19:00:00 EST<![CDATA[No subtlety to Champions Online's SMASH Alerts, just straight-up brawling]]>http://massively.joystiq.com/2012/02/23/no-subtlety-to-champions-onlines-smash-alerts-just-straight-up/http://massively.joystiq.com/2012/02/23/no-subtlety-to-champions-onlines-smash-alerts-just-straight-up/http://massively.joystiq.com/2012/02/23/no-subtlety-to-champions-onlines-smash-alerts-just-straight-up/#commentsFiled under: , , , , , ,

Venom is attacking the city! This looks like a job for... um... darn, what was that guy's name? The dude with the swords? Cutman? Cut-up? Something with cut.
The most basic superhero stories are pretty simple -- a villain is attacking the city and the hero has to go stop him or her. That's the spirit behind the new SMASH Alerts coming to the Champions Online test realm, quick instances that pit players against signature villains in a straight-up brawl. The villain may or may not have any minions, but the real test is to see if the heroes can knock out the villain within the time limit.

Players will notice that the new Alert system also has gained a new minimap icon and improved queue functionality, allowing you to sign up for a quick and dirty brawl with your nemesis of choice from anywhere. There are also new team-up GRAB Alerts available for testing against paired villains, which should give every hero a chance to pop in and beat the living daylights out of a villain up to no good. And, really, isn't that all you can ask from a superhero game?

MassivelyNo subtlety to Champions Online's SMASH Alerts, just straight-up brawling originally appeared on Massively on Thu, 23 Feb 2012 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alert-systemsalertschampions-onlinecocrypticcryptic-studiosf2pfree-to-playnew-contentperfect-world-entertainmentpwequeuequeueing-systemsupcoming-contentThu, 23 Feb 2012 19:00:00 EST<![CDATA[Wings Over Atreia: Ode to 3.0]]>http://massively.joystiq.com/2012/02/20/wings-over-atreia-ode-to-3-0/http://massively.joystiq.com/2012/02/20/wings-over-atreia-ode-to-3-0/http://massively.joystiq.com/2012/02/20/wings-over-atreia-ode-to-3-0/#commentsFiled under: , , , , , , , ,

Wings Over Atreia header
*cue pitch pipe*

Twinkle, twinkle, little patch,
How I wonder where you're at?
In the East they play with ease,
In the West you're just a tease!
Twinkle, twinkle, three point oh,
Hurry please I want you so!

I've tried to be patient. I really have. I even avoided any wayward glances at Aion's Korean patch notes (translated, of course) for 3.0. That way, I could contain my excitement a little better. I mean, we already know I am dying for housing, and I also know mounts are involved. But there is always so much more, and I was trying to make the wait more bearable. I stood firm in my resolve.

Then I broke down. I peeked. And oh how the many-tendriled beast of anticipation took hold of me once again! Of course there is always the requisite "fixed this bug" and "changed that appearance" filler, but when mining deeper, you also find some definite valuable nuggets. Aion's next patch has some "how cool," some "oh wow, that's really unexpected," and some "about time!" thrown in as well. From new zones to new instances to new features, there is plenty coming our way. Don't want to tax your scroll wheel and sift through the entire patch notes yourself? Wings Over Atreia delves in to uncover some of the most tantalizing treasures for you.

Continue reading Wings Over Atreia: Ode to 3.0

MassivelyWings Over Atreia: Ode to 3.0 originally appeared on Massively on Mon, 20 Feb 2012 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3.0-patchaion-3.0aion-ascensionAturam-Sky-Fortressbeshbeshmundir-templeDorgal-Manordungeondungeon-crawldungeon-crawlingdungeonsexpansionfeaturedincreased-level-capLandis-Forestlevel-caplevel-cap-increasenew-contentnew-landsnew-zonespatch-3.0patchesRentus-Baserole-playrole-playingroleplayroleplayerroleplayersSand-Lords-LairSarpanskill-changesSRSteel-RakeTahmesTiamarantaWings-Over-AtreiaMon, 20 Feb 2012 17:00:00 EST<![CDATA[ArenaNet closes the book on Guild Wars' Winds of Change]]>http://massively.joystiq.com/2012/02/14/arenanet-closes-the-book-on-guild-wars-winds-of-change/http://massively.joystiq.com/2012/02/14/arenanet-closes-the-book-on-guild-wars-winds-of-change/http://massively.joystiq.com/2012/02/14/arenanet-closes-the-book-on-guild-wars-winds-of-change/#commentsFiled under: , , , , ,

Guild Wars - I assume this image has something to do with Winds of Change
If you missed the Winds of Change arc that's bridging the gap between Guild Wars and Guild Wars 2, now's a great time to head to the official ArenaNet blog to catch up. The devs have provided a handy summary post and a bit of an explanation for their narrative goals as both Guild Wars and its highly anticipated sequel move forward.

ArenaNet also acknowledges the community feedback regarding the difficulty of the Winds of Change content, and the firm says that initially "the difficulty was getting in the way of people enjoying the story, making it far more of a slog than we'd intended and actively undermining their enjoyment of it."

Happily, recent updates have led to "major balance tweaks" and second looks at both normal and hard-mode content, so if you were frustrated before, it's worth your time to give it another go.

MassivelyArenaNet closes the book on Guild Wars' Winds of Change originally appeared on Massively on Tue, 14 Feb 2012 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>arena-netarenanetchallengedev-blogfantasyguild-warsguild-wars-2gwgw2mmo-storynarrativencsoftnew-contentwinds-of-changeTue, 14 Feb 2012 20:00:00 EST<![CDATA[Allods Online: Game of Gods coming February 15th]]>http://massively.joystiq.com/2012/02/01/allods-online-game-of-gods-coming-february-15th/http://massively.joystiq.com/2012/02/01/allods-online-game-of-gods-coming-february-15th/http://massively.joystiq.com/2012/02/01/allods-online-game-of-gods-coming-february-15th/#commentsFiled under: , , , , , , ,

Allods Online - Some dude fighting some ghost thing
We knew that Allods' latest expansion was coming soon. We didn't know exactly when, though. Thanks to gPotato, we're now comfortable penciling in February 15th on our free-to-play fantasy calendar.

Game of Gods is "the biggest expansion ever to hit Allods Online," and it will bring a new Bard class, objective-driven PvP arenas, and new raids to the table. New weapons and armor, new allods and astral layers, and some sort of loot-drop lottery card system are also on the way. That's not all, though, and the game's official website has a full listing of the patch's features and functionality.

[Source: gPotato press release]

MassivelyAllods Online: Game of Gods coming February 15th originally appeared on Massively on Wed, 01 Feb 2012 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>allodsallods-onlineastrum-nivalbardclassesexpansionf2pfantasyfree-to-playgame-of-godsgpotatonew-contentpatchesWed, 01 Feb 2012 13:00:00 EST<![CDATA[RIFT's 1.7 patch filled with content, coming soon]]>http://massively.joystiq.com/2012/01/16/rifts-1-7-patch-filled-with-content-coming-soon/http://massively.joystiq.com/2012/01/16/rifts-1-7-patch-filled-with-content-coming-soon/http://massively.joystiq.com/2012/01/16/rifts-1-7-patch-filled-with-content-coming-soon/#commentsFiled under: , , , , , ,

RIFT - some dragon or other
What's next for RIFT? Well, the 1.7 patch, for starters. The update is called Carnival of the Ascended, and if it sounds a bit festive, it is. Telaran weddings are in the offing, as Trion is introducing a marriage mechanic to its fantasy MMO. There's also the new River of Souls Chronicle, which the official forums bill as an "undead adventure for two."

A new master mode dungeon is coming too, as is an expert dungeon overhaul with more options and better loot for endgame avatars. Finally, there's a free weekend coming your way on January 19th, and you can return to Telara (or check it out for the first time) for no charge through January 22nd.

MassivelyRIFT's 1.7 patch filled with content, coming soon originally appeared on Massively on Mon, 16 Jan 2012 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>1.7-patchascendedcarnival-of-the-ascendedchronicledungeonsendgamefantasyin-game-marriagelootmarriagemarriage-mechanicmaster-modemaster-mode-dungeonnew-contentriftrift-1.7rift-planes-of-telarariver-of-souls-chronicletelaratriontrion-worldsweddingMon, 16 Jan 2012 16:00:00 EST<![CDATA[BioWare hints at new SWTOR content, tops one million players]]>http://massively.joystiq.com/2011/12/23/bioware-hints-at-new-swtor-content/http://massively.joystiq.com/2011/12/23/bioware-hints-at-new-swtor-content/http://massively.joystiq.com/2011/12/23/bioware-hints-at-new-swtor-content/#commentsFiled under: , , , ,

Star Wars: The Old Republic - new boss
Star Wars: The Old Republic is less than a week old, and many players are already wondering if and when BioWare is going to add new content. Yes, there are some 50s on the servers already, and James Ohlen has penned a post on the game's official website that should excite those who have already rushed through the game's content.

For starters, January will bring a new flashpoint to the game as well as an expanded operation instance. The former "takes place on a brand new world and involves some pretty epic battles." The latter "takes the existing Karagga's palace scenario and more than triples it in size."

Ohlen says that's just the beginning, too, and BioWare plans on releasing similar new content with regularity. Finally, players concerned over the company's ability to add new story (and voiceover content) will want to check out writer Alexander Freed's post on the official forums. In a nutshell, he says not to worry, as BioWare does have voice actors under contract and can proceed with development without adding much time to the content creation process.

Finally, our sister site reports that TOR has topped one million registered players and over 28 million hours played!

[Thanks to Scratches for the tip!]

MassivelyBioWare hints at new SWTOR content, tops one million players originally appeared on Massively on Fri, 23 Dec 2011 19:15:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alexander-freedbiowarecontentea-biowareElectronic-Artsflashpointjames-ohlennew-contentoperationsci-fistar-wars-the-old-republicswtorthe-old-republictorFri, 23 Dec 2011 19:15:00 EST<![CDATA[RuneScape adds a new dungeon for mold time's sake]]>http://massively.joystiq.com/2011/11/28/runescape-adds-a-new-dungeon-for-mold-times-sake/http://massively.joystiq.com/2011/11/28/runescape-adds-a-new-dungeon-for-mold-times-sake/http://massively.joystiq.com/2011/11/28/runescape-adds-a-new-dungeon-for-mold-times-sake/#commentsFiled under: , , , , , ,

Slime molds.
It's not really a proper fantasy game until you've fought your way through animated fungi, right? That's the premise of the newest dungeon in RuneScape, the just-added Polypore Dungeon. Deep within the dungeon lives a solitary skinweaver who was born to be a healer, but she's turned her powers to creating animated fungi for her own amusement. With her only other companion an ancient merchant that no longer has all of his faculties, her domain isn't a prime vacation spot... unless, of course, you're a skilled adventurer looking for new items and new craftable armor.

The new dungeon can be reached north of the Duel Arena bank, with most of its contents requiring a high level in various skills. The inhabitants are non-aggressive, however, allowing any and all members to take a look at the place freely. Other updates include an improvement to the Slayer interface and the UI option to switch bloom lighting on or off, which should help improve your overall experience whether or not you decide to go mushroom hunting.

MassivelyRuneScape adds a new dungeon for mold time's sake originally appeared on Massively on Mon, 28 Nov 2011 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>craftingdungeonsf2pfree-to-playjagexnew-contentnewspatchespolypore-dungeonrunescapeupdatesMon, 28 Nov 2011 18:00:00 EST<![CDATA[New Champions Online Whiteout comic series content debuts]]>http://massively.joystiq.com/2011/11/18/new-champions-online-whiteout-comic-series-content-debuts/http://massively.joystiq.com/2011/11/18/new-champions-online-whiteout-comic-series-content-debuts/http://massively.joystiq.com/2011/11/18/new-champions-online-whiteout-comic-series-content-debuts/#commentsFiled under: , , , , , ,

Champions Online - Whiteout screenshot
Comic book geeks rejoice! Well, digital comic book geeks, that is. Champions Online has just announced the first issue of its second Comic Series content update. The new stuff is called Whiteout, and like the previous series (Aftershock), it spans multiple weekly issues that take the form of free content packs.

The Champions website says that Comic Series are designed to take you on an "exciting adventure in which you'll encounter new creatures and environments, all the while playing through an intriguing story." The new Whiteout series is accessible to players at level 11 or higher, and on top of the new narrative you'll get special issue rewards and item drops as you progress.

MassivelyNew Champions Online Whiteout comic series content debuts originally appeared on Massively on Fri, 18 Nov 2011 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>championschampions-onlinecomic-seriescontent-packscrypticcryptic-studiosf2pfree-to-playnew-contentperfect-world-entertainmentpwesuperherowhiteoutFri, 18 Nov 2011 16:30:00 EST<![CDATA[Star Trek Online dev blog talks new content, Dominion featured episode]]>http://massively.joystiq.com/2011/11/17/star-trek-online-dev-blog-talks-new-content-dominion-featured-e/http://massively.joystiq.com/2011/11/17/star-trek-online-dev-blog-talks-new-content-dominion-featured-e/http://massively.joystiq.com/2011/11/17/star-trek-online-dev-blog-talks-new-content-dominion-featured-e/#commentsFiled under: , , , , , , ,

Star Trek Online - captain's viewport
Cryptic executive producer Stephen D'Angelo has posted another Star Trek Online Path to F2P dev diary. For the 23rd installment (yes, 23!), D'Angelo outlines a near future roadmap for the game as the business model transition continues.

D'Angelo says that STO will boast a Featured Episode Replay event for the remainder of November on the live server. The first week of December should see a new game build migrating to the live shard from the Tribble test server. This update will feature "new content, new systems, and many gameplay improvements," and D'Angelo characterizes it as a "significant" release.

How significant? It includes new Borg content (the Invasion of Defera), the new duty officer system, and several new events and dailies. There's more to read at the official STO website (including an upcoming Featured Episode series focused on the Dominion!), so check it out by following the link below.

MassivelyStar Trek Online dev blog talks new content, Dominion featured episode originally appeared on Massively on Thu, 17 Nov 2011 11:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bogborgcrypticdev-blogdev-diarydominionf2pfeatured-episodefeatured-episode-replayfree-to-playnew-contentperfect-world-entertainmentpwesci-fistar-trekstar-trek-onlinestephen-dangeloThu, 17 Nov 2011 11:30:00 EST<![CDATA[Martial Empires Path to Purgatory update brings big content drop]]>http://massively.joystiq.com/2011/11/16/martial-empires-path-to-purgatory-update-brings-big-content-drop/http://massively.joystiq.com/2011/11/16/martial-empires-path-to-purgatory-update-brings-big-content-drop/http://massively.joystiq.com/2011/11/16/martial-empires-path-to-purgatory-update-brings-big-content-drop/#commentsFiled under: , , , , , , ,

Martial Empires - combat screenshot
It's patch day in Martial Empires, and gamigo has a hellish road in store for fans of the free-to-play action MMO. The Path to Purgatory update features a new survival mode challenge that pits players against hordes of monsters as they carve their way through 32 levels of a gigantic tower.

There's also a big nasty waiting at the end of the challenge, and that's only part of the package. The update also features various mounts and battle pets, guild research functionality, and a new quest series that stretches from level one through 55. gamigo is also planning a number of in-game events, according to its latest press release, and you can learn more about Martial Empires on the game's official website.

[Source: gamigo press release]

MassivelyMartial Empires Path to Purgatory update brings big content drop originally appeared on Massively on Wed, 16 Nov 2011 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dungeonseventsf2pfree-to-playgamigoin-game-eventsmartial-empiresnew-contentpatchpatchestower-dungeonWed, 16 Nov 2011 18:30:00 EST<![CDATA[EVE Online's Crucible expansion coming Nov 29th]]>http://massively.joystiq.com/2011/11/15/eve-onlines-crucible-expansion-coming-nov-29th/http://massively.joystiq.com/2011/11/15/eve-onlines-crucible-expansion-coming-nov-29th/http://massively.joystiq.com/2011/11/15/eve-onlines-crucible-expansion-coming-nov-29th/#commentsFiled under: , , , , , , ,

EVE Online - Crucible nebula background
CCP's feel-good post count has been building to a fever pitch in recent weeks, and today the company has announced the ultimate win-back promotion in the form of EVE Online's 15th major expansion. The content drop is called Crucible, and it's currently scheduled to debut on November 29th.

"Crucible evolves the graphics, interface, and game mechanics with over three dozen updated and improved features based on feedback and challenges put forth by its players. This is EVE re-forged," CCP says on the expansion's teaser page. The web portal also provides a handy collated list of the aforementioned developer updates, and in spite of what was unquestionably the rockiest summer in the sci-fi sandbox title's eight-year existence, the future is looking pretty bright.

MassivelyEVE Online's Crucible expansion coming Nov 29th originally appeared on Massively on Tue, 15 Nov 2011 14:15:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>breakingccpccp-gamescrucibleeveeve-crucibleeve-onlineexpansionexpansionsflying-in-spacenew-contentnew-edennew-shipsTue, 15 Nov 2011 14:15:00 EST<![CDATA[Runes of Magic reveals Souls of the Past trailer]]>http://massively.joystiq.com/2011/11/15/runes-of-magic-reveals-souls-of-the-past-trailer/http://massively.joystiq.com/2011/11/15/runes-of-magic-reveals-souls-of-the-past-trailer/http://massively.joystiq.com/2011/11/15/runes-of-magic-reveals-souls-of-the-past-trailer/#commentsFiled under: , , , , , , , ,

Runes of Magic - Tergothen Bay gate
Get ready, Runes of Magic fans. Frogster has unveiled a brand-spanking-new trailer for the fantasy title's upcoming Souls of the Past content patch. According to a developer post on the game's official boards, the update will go live on November 22nd and will feature a level cap increase as well as a new adventuring region.

Players will be able to advance from 67 to 70, and they'll also be able to explore Tergothen Bay, a royal coastal town near the foothills of the Redhill Mountains. The trailer is short, but it shows off a few of the big nasties awaiting players in the region's new dungeon. It also touches on the lore behind the new content, and specifically how the demon Sismond continues to manipulate the citizens of Taborea. Check it out after the break.

Continue reading Runes of Magic reveals Souls of the Past trailer

MassivelyRunes of Magic reveals Souls of the Past trailer originally appeared on Massively on Tue, 15 Nov 2011 13:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>f2pfantasyfree-to-playfrogsternew-contentpatchesredhill-mountainsrunes-of-magicsouls-of-the-pasttaboreatergothen-baytrailervideoTue, 15 Nov 2011 13:30:00 EST<![CDATA[Bounty Hounds Online closed beta featuring new content]]>http://massively.joystiq.com/2011/11/15/bounty-hounds-online-closed-beta-featuring-new-content/http://massively.joystiq.com/2011/11/15/bounty-hounds-online-closed-beta-featuring-new-content/http://massively.joystiq.com/2011/11/15/bounty-hounds-online-closed-beta-featuring-new-content/#commentsFiled under: , , , , , ,

Bounty Hounds Online - mercenary duel
Bounty Hounds Online is talking up its AAA characteristics in the latest press release from Wicked Interactive. According to the blurb, the sci-fi MMORPG "brings triple-A quality to the free-to-play genre" and allows players to choose from five different mercenary class types while directing their avatars through "multiple worlds and environments."

Beginning today, Wicked is rolling out a substantial update to the title's closed beta client. The new content includes five high-level Cambria group instances. There are also new missions and events on tap including objectives in the Wastelands that give both stat and skill point reset items. Finally, earned character titles now unlock unique stat-boost accessories, and XP requirements have been adjusted "so you'll spend less time grinding."

Sound interesting? Head to the official Bounty Hounds website to learn more.

[Source: Wicked Interactive press release]

MassivelyBounty Hounds Online closed beta featuring new content originally appeared on Massively on Tue, 15 Nov 2011 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabhobounty-houndsbounty-hounds-onlineclosed-betadungeonsf2pfree-to-playgrindgroup-dungeonsleveling-curvenew-contentnew-instancessci-fiwickedwicked-interactivexpTue, 15 Nov 2011 12:00:00 EST<![CDATA[Newest test server pass for Star Trek Online aimed at cleaning up [Updated with F2P date!]]]>http://massively.joystiq.com/2011/11/08/newest-test-server-pass-for-star-trek-online-aimed-at-cleaning-u/http://massively.joystiq.com/2011/11/08/newest-test-server-pass-for-star-trek-online-aimed-at-cleaning-u/http://massively.joystiq.com/2011/11/08/newest-test-server-pass-for-star-trek-online-aimed-at-cleaning-u/#commentsFiled under: , , , , , ,

The Borg's susceptibility to computer issues suggests that the Collective is still running on a Windows 98 tower.
Bugs and design issues are present even in the universe of Star Trek Online, ranging from irritating interface bugs on ship consoles to the apparently frequent bug that causes the holodeck to nearly kill everyone on the ship every few weeks. They also crop up in the game itself, of course, but as outlined in the latest Path to F2P blog, the development team is focusing in closely on trying to eliminate several bugs and design issues currently in the game.

Patrol missions, for instance, are being changed from a flat sequence of isolated system missions into a more freeform system that scales with level. Crafting changes are also being put in place, giving players "material blocks" to work with that are purchase via dilithium, thereby allowing fleets and groups of players to shunt crafting resources toward a single player. The entry also hints at an entirely new form of content coming to the test server over the next month, although players will have to wait to find out what that means.

[Edit: More details on the F2P switch have also surfaced, thanks to our friends at IGN.]

MassivelyNewest test server pass for Star Trek Online aimed at cleaning up [Updated with F2P date!] originally appeared on Massively on Tue, 08 Nov 2011 22:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>balance-adjustmentsbug-fixescrypticcryptic-star-trekcryptic-studiosdesign-fixesf2pfixesfree-to-playnew-contentpath-to-f2ppreviewst-onlinestar-trek-mmostar-trek-onlinestotrek-onlineupcoming-contentTue, 08 Nov 2011 22:00:00 EST<![CDATA[EverQuest's Veil of Alaris expansion slated for November 15th]]>http://massively.joystiq.com/2011/10/26/everquests-veil-of-alaris-expansion-slated-for-november-15th/http://massively.joystiq.com/2011/10/26/everquests-veil-of-alaris-expansion-slated-for-november-15th/http://massively.joystiq.com/2011/10/26/everquests-veil-of-alaris-expansion-slated-for-november-15th/#commentsFiled under: , , , ,

EverQuest - Veil of Alaris logo
EverQuest's graphics aren't the only thing dated when it comes to Norrath! Oooh, yeah, that was cold, but the good news is that we still love dear old EQ, and we'll be checking out expansion number 1,342,756 (actually, number 18) in just a couple of weeks.

We know this because Sony Online Entertainment has announced the official release date for the Veil of Alaris content update, which is November 15th. Pre-orders have already begun, and you'll want to check out the official pre-order page to see if SOE's digital carrots are enough to entice you to part with your hard-earned dollars prior to release day.

MassivelyEverQuest's Veil of Alaris expansion slated for November 15th originally appeared on Massively on Wed, 26 Oct 2011 23:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>digital-collectors-editioneqeverquestexpansionfantasynew-contentnorrathpatchpre-ordersoeSony-Online-Entertainmentveil-of-alarisWed, 26 Oct 2011 23:00:00 EST<![CDATA[New Dawntide patch due October 17th, release date announcement to follow]]>http://massively.joystiq.com/2011/10/05/new-dawntide-patch-due-october-17th-release-date-announcement-t/http://massively.joystiq.com/2011/10/05/new-dawntide-patch-due-october-17th-release-date-announcement-t/http://massively.joystiq.com/2011/10/05/new-dawntide-patch-due-october-17th-release-date-announcement-t/#commentsFiled under: , , , , ,

Dawntide - Human waiting anxiously for a new release date
Hey kids, it's a Dawntide update! Yes, really. The fantasy sandbox from Working As Intended has been quiet since delaying its planned October 1st release date, but today the devs have issued a brief blurb on the game's official website that suggests a bit of hope for the future.

As it turns out, the delayed release was the result of a funding shortage, but now WAI has secured a new source and the team has "reassembled to resume development." A new patch is due October 17th, and a new release date announcement should roll in before the end of the month. WAI also takes a moment to tip its collective cap to Dawntide's hearty faithful. "Thanks for sticking with us through the rough times, and we still intend to release the best sandbox MMO out there," the site says.

[Thanks to Halldorr for the tip!]

MassivelyNew Dawntide patch due October 17th, release date announcement to follow originally appeared on Massively on Wed, 05 Oct 2011 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dawntidefantasynew-contentnew-patchpatchrelease-daterelease-date-announcementrelease-delaysandboxupdatewaiworking-as-intendedWed, 05 Oct 2011 16:00:00 EST<![CDATA[Fans unearth new Forsaken World patch details]]>http://massively.joystiq.com/2011/10/05/fans-unearth-new-forsaken-world-patch-details/http://massively.joystiq.com/2011/10/05/fans-unearth-new-forsaken-world-patch-details/http://massively.joystiq.com/2011/10/05/fans-unearth-new-forsaken-world-patch-details/#commentsFiled under: , , , , , ,

Forsaken World - skimpy armor girl
If you're a Forsaken World fan, you might be interested to know that Perfect World Entertainment has announced plans for the game's next content update. According to MMO Crunch, it's unclear whether the Storms of War patch is a full-blown expansion or a smaller-scale update. Either way, there's new stuff coming.

Some enterprising Forsaken World forum-dwellers have pieced together what they believe to be a feature list for the new content drop, but since Perfect World's Asian-market releases are normally months ahead of the American and European clients, none of the info has been confirmed.

Highlights of the feature list include memory fruit XP buffs, town teleport abilities, tweaks to dungeon difficulty and arena PvP systems, and a lot more.

MassivelyFans unearth new Forsaken World patch details originally appeared on Massively on Wed, 05 Oct 2011 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>content-updatef2pfantasyforsaken-worldfree-to-playnew-contentpatchpatchesperfect-world-entertainmentpwespeculationstorms-of-warupdateWed, 05 Oct 2011 14:00:00 EST<![CDATA[DCUO's latest update takes you to the Fortress of Solitude]]>http://massively.joystiq.com/2011/10/04/dcuos-latest-update-takes-you-to-the-fortress-of-solitude/http://massively.joystiq.com/2011/10/04/dcuos-latest-update-takes-you-to-the-fortress-of-solitude/http://massively.joystiq.com/2011/10/04/dcuos-latest-update-takes-you-to-the-fortress-of-solitude/#commentsFiled under: , , , , , , ,

DC Universe Online - Superman and the fortress
We still don't have a date for you with regard to DC Universe Online's impending payment model switcheroo. We do have the latest Sony Online Entertainment press release, though, and it's full of details about the superhero MMO's latest content patch.

Listen up, Superman fans, as today's patch brings about the second phase of a three-part raid in which players must stop Brainiac from harnessing Kryptonian technology and using it to destroy the entire planet. The update, appropriately titled The Fate of the Fortress, features Superman's iconic arctic hideout known as the Fortress of Solitude, and the patch allows would-be heroes to team up with Kal-El, Lex Luthor, and their fellow players to tackle a challenging eight-man group combat raid.

There's a bunch of new loot to be had as well, and today's update also features a new hard-mode option for the HIVE tier-two alert as well as a new Batcave PvP map. Finally, SOE has incorporated a new dueling mechanic into DCUO, so fire up your launchpads, button up your underoos, and get ready to save Gotham City and Metropolis from the clutches of the megalomaniacal Brainiac.

[Source: SOE press release]

MassivelyDCUO's latest update takes you to the Fortress of Solitude originally appeared on Massively on Tue, 04 Oct 2011 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>brainiacdc-comicsdc-universedc-universe-onlinedcuofate-of-the-fortressfortress-of-solitudegame-update-5gotham-citygu-5hive-hard-modelex-luthormetropolisnew-contentnew-raidpress-releasesoeSony-Online-Entertainmentsuperherosupermanthe-fate-of-the-fortressTue, 04 Oct 2011 14:00:00 EST<![CDATA[Final Fantasy XIV releases notes for patch 1.19]]>http://massively.joystiq.com/2011/09/30/final-fantasy-xiv-releases-notes-for-patch-1-19/http://massively.joystiq.com/2011/09/30/final-fantasy-xiv-releases-notes-for-patch-1-19/http://massively.joystiq.com/2011/09/30/final-fantasy-xiv-releases-notes-for-patch-1-19/#commentsFiled under: , , , , , ,

Magma axes - for when chopping things up without burning them at the same time just feels too wussy.
It's going to take another few days before Final Fantasy XIV drops the enormous patch 1.19 onto the live servers, but the patch notes have already been released. And most players will likely agree upon glancing at the extensive list of updates that the patch is well worth the wait. Several portions of the update have already been previewed, ranging from the crafting changes to the battle mechanic updates, but there's also a long list of improvements, additions, and other elements to look forward to.

More details are available regarding the many additions to the Grand Company system, including Company leves, new quests, and the details for obtaining a Company chocobo along with obtaining membership. There's also a listing of new items available, a rundown of the new materia system, and a variety of updates and improvements to stats, mechanics, and abilities. The patch is planned for release on Tuesday, October 4th, a date that the game's players will likely be awaiting with bated breath.

MassivelyFinal Fantasy XIV releases notes for patch 1.19 originally appeared on Massively on Fri, 30 Sep 2011 19:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>endgameffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivgame-mechanicsgrand-companiesguildleveslevequestslevesmechanicsnew-contentnewspatch-notespatchessquaresquare-enixupdatesFri, 30 Sep 2011 19:30:00 EST<![CDATA[Age of Conan dev update outlines a year's worth of content]]>http://massively.joystiq.com/2011/09/30/age-of-conan-dev-update-outlines-a-years-worth-of-content/http://massively.joystiq.com/2011/09/30/age-of-conan-dev-update-outlines-a-years-worth-of-content/http://massively.joystiq.com/2011/09/30/age-of-conan-dev-update-outlines-a-years-worth-of-content/#commentsFiled under: , , , , , , , , ,

Age of Conan - concept art
Age of Conan's latest monthly development update is hot off the presses, and it's kind of a doozy. Funcom game director Craig "Silirrion" Morrison takes the gloves off and lists five major updates coming to AoC over the next year -- and he also offers a few disclaimers in terms of schedule changes and dates. As far as content goes, fans can look forward to new Turan boss encounters, the House of Crom dungeon, tier four raids, and a major Dreamworld/quality-of-life update prior to the end of the year.

Moving into 2012, Age of Conan will be adding a new multi-feat specification system (apparently the feature was a landslide winner in the recent summer survey). The devs will also be giving Priest archetypes some "care and attention" as well as implementing the single-server tech that will allow for cross-server minigames and "all manner of cool things." There will also be new variants on The Breach, The Forgotten City, and Dead Man's Hand dungeons, all balanced for high-level characters.

Finally, the second quarter of 2012 is the tentative launch date for AoC's latest adventure pack as well as the tradeskill revamp. There's more too, so head to the official website to check it out.

MassivelyAge of Conan dev update outlines a year's worth of content originally appeared on Massively on Fri, 30 Sep 2011 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>adventure-package-of-conanaoccraftingcrafting-revampcraig-morrisoncross-server-minigamesdev-diarydev-updatedreamworlddungeonsf2pfantasyfeatsfree-to-playfuncomhouse-of-cromkhitai-raidsmonthly-development-updatemulti-feat-specializationnew-contentsilirrionsingle-server-technologytier-four-raidsFri, 30 Sep 2011 11:00:00 EST<![CDATA[Caravan security missions marching to Final Fantasy XIV]]>http://massively.joystiq.com/2011/09/15/caravan-security-missions-marching-to-final-fantasy-xiv/http://massively.joystiq.com/2011/09/15/caravan-security-missions-marching-to-final-fantasy-xiv/http://massively.joystiq.com/2011/09/15/caravan-security-missions-marching-to-final-fantasy-xiv/#commentsFiled under: , , , , ,

We've got a great big convoy rolling through the night, we've got a great big convoy, ain't she a beautiful sight? Come on and join our convoy, ain't nothing gonna get in our way, we'll ride this rocking convoy for seals all through the day. CONVOY!
The list of features being added to Final Fantasy XIV in patch 1.19 just keeps growing. Not only will players be able to ride on the back of a chocobo, but a new set of missions for caravan defense will let players beat marauding fiends away from those selfsame yellow birds. And there are even Grand Company seals to be obtained in the exchange, which just sweetens the deal for players investing time and effort into the system.

Each of the Grand Companies will have a different caravan to protect and will enlist the aid of full members in ensuring the caravan's safety during its march from an aetheryte camp to one of the nearby hamlets. Monsters will attack the caravan in turn, sometimes driving off birds and sometimes outright damaging the cargo, and it will be up to players to feed, calm, and protect the chocobos laden with supplies. Once the caravan arrives at its destination, players will receive seals based on how much cargo actually made it to its objective -- a chance to earn more currency and get some nice experience out of the event.

MassivelyCaravan security missions marching to Final Fantasy XIV originally appeared on Massively on Thu, 15 Sep 2011 19:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>caravan-defensecaravan-securitychocobosdefenseffff14ffxivffxiv-patch-1.19final-fantasyfinal-fantasy-14final-fantasy-xivmission-typesmissionsnew-contentnew-missionsnewssquaresquare-enixThu, 15 Sep 2011 19:30:00 EST<![CDATA[Wargaming.net publishes World of Tanks development plan]]>http://massively.joystiq.com/2011/09/12/wargaming-net-publishes-world-of-tanks-development-plan/http://massively.joystiq.com/2011/09/12/wargaming-net-publishes-world-of-tanks-development-plan/http://massively.joystiq.com/2011/09/12/wargaming-net-publishes-world-of-tanks-development-plan/#commentsFiled under: , , , , , , , , ,

World of Tanks - screenshot
Wargaming.net has gifted World of Tanks fans with a development roadmap for the World War II-based action MMO, and a visit to the game's official website will give you a preview of what's coming down the pike over the next year.

The post lays out quite a bit of information, most of it marked with vague release windows like Q3 2012 and so on. There's the standard "dates are subject to change" disclaimer, but it's nonetheless interesting to see what looks to be a fairly complete development schedule. What are the highlights? Well, more tank models, of course, followed by new game types including historical battle, escort, garage battle, assault, and company battle modes.

There's also an expansion of the clan wars map in the works, as well as new customization options, vehicle physics, and more.

[Thanks to Greg for the tip!]

MassivelyWargaming.net publishes World of Tanks development plan originally appeared on Massively on Mon, 12 Sep 2011 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>assaultcompany-battle-divisionscustomizationdev-plandev-roadmapdevelopment-roadmapescortf2pfree-to-playgarage-battlehistorical-battlenew-contentnew-game-modesnew-tankstankswargaming.networld-of-tanksworld-war-2world-war-iiwotww2wwiMon, 12 Sep 2011 10:00:00 EST<![CDATA[The Anvil of Crom: Evaluating the dev update - crafting edition]]>http://massively.joystiq.com/2011/09/11/the-anvil-of-crom-evaluating-the-dev-update-crafting-edition/http://massively.joystiq.com/2011/09/11/the-anvil-of-crom-evaluating-the-dev-update-crafting-edition/http://massively.joystiq.com/2011/09/11/the-anvil-of-crom-evaluating-the-dev-update-crafting-edition/#commentsFiled under: , , , , , ,

Anvil of Crom - banner
Hallelujah, amen, and by frickin' Crom! What's got me all excitable this week? Well, the latest dev update, for starters, and I apologize in advance for reneging on last week's promise to devote today's column to a deeper examination of the new Savage Coast of Turan content. The last time we met, I gave you a quick rundown on the Ardashir Coast, but with all due respect to Funcom's content designers, the most interesting bit of Age of Conan news from the last little while is the crafting revamp that Silirrion hinted at in the August 31st update letter.

But Jef, how interesting could it be if it's taken you over a week to write about it? Well, you got me there, and I could throw in some excuses about needing to get something Turan-related out last week, as well as the fact that I was doing the DragonCon shuffle, but I won't.

Anyhow, holy shitaki mushrooms! Funcom mentioned AoC's tradeskills! Join me after the cut and bring the smelling salts.

Continue reading The Anvil of Crom: Evaluating the dev update - crafting edition

MassivelyThe Anvil of Crom: Evaluating the dev update - crafting edition originally appeared on Massively on Sun, 11 Sep 2011 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>age-of-craftinganvil-of-cromcraftingcrafting-revampcraig-morrisondev-diarydev-updatef2pfantasyfeaturedfree-to-playhouse-of-cromhyboriamonthly-dev-updatemonthly-development-updatemonthly-updatenew-contentnon-combat-gameplaysilirrionsingle-serversthe-anvil-of-cromtradeskill-revamptradeskillswelfare-epicsSun, 11 Sep 2011 12:00:00 EST<![CDATA[Age of Conan's Savage Coast adventure pack officially live]]>http://massively.joystiq.com/2011/09/09/age-of-conans-savage-coast-adventure-pack-officially-live/http://massively.joystiq.com/2011/09/09/age-of-conans-savage-coast-adventure-pack-officially-live/http://massively.joystiq.com/2011/09/09/age-of-conans-savage-coast-adventure-pack-officially-live/#commentsFiled under: , , , , , ,

Age of Conan - Ardashir City
If you didn't pony up 700 extra Funcom points for early access to Age of Conan's new Savage Coast of Turan adventure pack last week, you'll be glad to know that the content officially debuts today at its normal price. Said price is 1300 Funcom points (or approximately $15 depending on how you purchase your point packages).

So what do you get for your hard-earned barbarian bucks? A bunch of new content for both mid- and high-level players, that's what. There's the Ardashir Coast playfield and its numerous quest lines that are designed to take you from 50 to 55. Players may also partake of Dead Man's Hand, a solo dungeon that scales from level 50 to level 80. Don't forget the Isle of the Iron Statues, either. It's another solo instance -- level 80 this time -- and it's taken directly from the works of Conan author Robert E. Howard. Finally, endgame grouping fans should note the new Fort Ardashir dungeon (and it's hard to miss as you zone into Ardashir City for the first time).

The Savage Coast pack contains characters and locations from the recent Conan film reboot, and you can read more about the new content in Massively's weekly Anvil of Crom feature.

[Source: Funcom press release]

MassivelyAge of Conan's Savage Coast adventure pack officially live originally appeared on Massively on Fri, 09 Sep 2011 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>adventure-package-of-conanage-of-conan-unchainedaoc-unchainedbarbarian-bucksbarbarian-buxconanconan-filmconan-movief2pfantasyfree-to-playfuncomfuncom-pointsnew-contentpress-releasesavage-coast-of-turanFri, 09 Sep 2011 13:00:00 EST<![CDATA[The Anvil of Crom: Savage Coast first impressions]]>http://massively.joystiq.com/2011/09/04/the-anvil-of-crom-savage-coast-first-impressions/http://massively.joystiq.com/2011/09/04/the-anvil-of-crom-savage-coast-first-impressions/http://massively.joystiq.com/2011/09/04/the-anvil-of-crom-savage-coast-first-impressions/#commentsFiled under: , , , , , , , ,

Anvil of Crom header
Oy, the life of a game blogger. Earlier this week I teed off a bit on subscription-based games that tack on a cash shop. The short version of that particular rant is that I'm not a fan of the practice, at all, and as far as my personal gaming time goes, I've bid adieu to all of the double-dippers formerly denting my wallet -- with one exception, of course.

Whether that one exception makes me a hypocrite or is simply part of my job description is something I haven't quite figured out yet. In any event, it's somewhat ironic that I'm now about to tell you what a good time I had after spending 20 bucks in Age of Conan's item store. Yep, there I was, forking over for 2400 Funcom points -- I only needed 2000 for the Savage Coast of Turan adventure pack, of course -- and enjoying it for the most part. Luckily, it only costs 520 Massively points to read my first impressions after the cut.

Gallery: Age of Conan - Coast of Ardashir

Continue reading The Anvil of Crom: Savage Coast first impressions

MassivelyThe Anvil of Crom: Savage Coast first impressions originally appeared on Massively on Sun, 04 Sep 2011 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>adventure-package-of-conanage-of-conan-unchainedanvil-of-cromaocaoc-unchainedardashirardashir-cityconanf2pfantasyfeaturedfirst-impressionsfree-to-playgallerynew-contentsavage-coast-of-turanscreenshotsthe-anvil-of-cromturanSun, 04 Sep 2011 12:00:00 EST<![CDATA[DCUO's Fight for the Light content pack free for subscribers]]>http://massively.joystiq.com/2011/09/01/dcuos-fight-for-the-light-content-pack-free-for-subscribers/http://massively.joystiq.com/2011/09/01/dcuos-fight-for-the-light-content-pack-free-for-subscribers/http://massively.joystiq.com/2011/09/01/dcuos-fight-for-the-light-content-pack-free-for-subscribers/#commentsFiled under: , , , , , , ,

DC Universe Online - Lantern Corps
DC Universe Online is about to get a bit bigger, and it's also bucking the double-dipping trend that's gripped the MMO industry of late. The good news for subscribers is two-fold: First, there's a lot of new content on the way. Second, it's included in the subscription fee. The Fight for the Light pack, which integrates the legend of the Green Lantern (as well as the rest of the Lantern and Sinestro Corps) into Sony Online Entertainment's massively multiplayer beat-'em-up, debuts on September 6th.

What exactly is in store for loyal denizens of Metropolis and Gotham City? For starters, there's the game's seventh power set (light, of course), followed by new instances like S.T.A.R. Labs, Coast City, and Sciencells Prison. In addition, players will interact with Green Lantern-based friends and foes as they battle to save earth from the clutches of Brainiac.

Gallery: DC Universe Online

MassivelyDCUO's Fight for the Light content pack free for subscribers originally appeared on Massively on Thu, 01 Sep 2011 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dc-comicsdc-universedcuofight-for-the-lightfree-contentgreen-lanternlantern-corpsnew-contentsinestrosinestro-corpssoeSony-Online-Entertainmentsubscription-basedsubscriptionssuperheroThu, 01 Sep 2011 13:00:00 EST<![CDATA[Age of Conan dev update talks new content, crafting revamp]]>http://massively.joystiq.com/2011/08/31/age-of-conan-dev-update-talks-new-content-crafting-revamp/http://massively.joystiq.com/2011/08/31/age-of-conan-dev-update-talks-new-content-crafting-revamp/http://massively.joystiq.com/2011/08/31/age-of-conan-dev-update-talks-new-content-crafting-revamp/#commentsFiled under: , , , , , , , , ,

Age of Conan - Forgotten City entrance
Yeah, you read that right, Age of Conan fans. Funcom is planning on remaking the game's much-maligned tradeskill system. While the exact nature of the changes has not been revealed, and the deployment date is pretty far in the future (sometime in 2012), it's a big step for what has thus far been a squarely combat-focused game.

This month's AoC development update has the details, along with teasers for a new adventure pack in the early part of 2012, not to mention additional content before the end of 2011. That content includes the conclusion of tier four raid progression in Khitai as well as the long-awaited House of Crom dungeon. Funcom game director Craig "Silirrion" Morrison describes the space as part open dungeon (similar to the Onyx Chambers) and part team instance with dynamic opportunities for both cooperation and conflict.

Today also marks the deployment of the Savage Coast of Turan adventure pack to the live servers (though it's worth noting that you won't be able to access it until September 8th unless you ordered the early bird pack), and Funcom currently advises players of a six-hour down time on the AoC patcher. Finally, the devs have put together a community survey that is open to everyone, so be sure and fill it out to make your voice heard with regards to AoC's future development.

MassivelyAge of Conan dev update talks new content, crafting revamp originally appeared on Massively on Wed, 31 Aug 2011 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>age-of-conanage-of-conan-unchainedaocaoc-unchainedcraftingcrafting-updatecraig-morrisondev-diarydev-updatedungeonsf2pfantasyfree-to-playhouse-of-crommonthly-dev-updatenew-contentsilirrionsurveytradeskillstradeskills-updateWed, 31 Aug 2011 12:00:00 EST<![CDATA[SOE releases new War of Zek trailer for EverQuest II]]>http://massively.joystiq.com/2011/08/26/soe-releases-new-war-of-zek-trailer-for-everquest-ii/http://massively.joystiq.com/2011/08/26/soe-releases-new-war-of-zek-trailer-for-everquest-ii/http://massively.joystiq.com/2011/08/26/soe-releases-new-war-of-zek-trailer-for-everquest-ii/#commentsFiled under: , , , , , , , ,

EverQuest II - army of Zek
When poet and philosopher George Santayana wrote that only the dead have seen the end of war, it's doubtful he had Rallos Zek in mind. Sony Online Entertainment, on the other hand, has made quite a good living off of the fictional warlord god, and EverQuest II's latest game update bears both his name and the famous quote as its tag line.

The War of Zek debuted on the live servers yesterday, and despite some equipment and AA bugginess, managed to bring a bunch of interesting tweaks to EQII. Today SOE has released a teaser trailer to hype the newly updated game, and it's heavy on high-end content including Zek himself, as well as a cadre of raid-geared players hellbent on bringing him down. Check it out after the cut, and don't forget that EQII has also reinstated its 14-day free trial.

Continue reading SOE releases new War of Zek trailer for EverQuest II

MassivelySOE releases new War of Zek trailer for EverQuest II originally appeared on Massively on Fri, 26 Aug 2011 11:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>eq2eq2-gu-61eqiieverquest-2everquest-iif2pfantasyfree-to-playfree-trialgame-updategame-update-61george-santayanagu-61new-contentonly-the-dead-have-seen-the-end-of-warpatchrallos-zeksoeSony-Online-Entertainmentthe-war-of-zektrailertrialvideowar-of-zekzekFri, 26 Aug 2011 11:30:00 EST<![CDATA[Massively Exclusive: Funcom details Age of Conan adventure pack options [Updated]]]>http://massively.joystiq.com/2011/08/26/massively-exclusive-funcom-details-age-of-conan-adventure-pack/http://massively.joystiq.com/2011/08/26/massively-exclusive-funcom-details-age-of-conan-adventure-pack/http://massively.joystiq.com/2011/08/26/massively-exclusive-funcom-details-age-of-conan-adventure-pack/#commentsFiled under: , , , , , ,

Age of Conan - Turan concept art
Well, Age of Conan fans, we've finally got ourselves a launch date for the much-anticipated Savage Coast of Turan adventure pack. The new content will be rolled out in two phases, and the regular launch date is set for September 8th, while an early access period will begin on August 31st.

Funcom has given us the details on all of the purchasing options, and the Savage Coast will be available in a variety of flavors depending on how soon you'd like to start playing and what side dishes you'd like along with your main course.

Join us after the cut for a look at the Savage Coast menu, and check back with Massively later today for an exclusive new Savage Coast content reveal. Please note that as of press time, Funcom has not provided us with prices for the following options.

[Update]: Funcom has released pricing options as well as confirmed that both subscribers and free-to-play gamers will need to pay for the Savage Coast content. It's also worth noting that the pack is only available through the in-game store.

Continue reading Massively Exclusive: Funcom details Age of Conan adventure pack options [Updated]

MassivelyMassively Exclusive: Funcom details Age of Conan adventure pack options [Updated] originally appeared on Massively on Fri, 26 Aug 2011 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>adventure-package-of-conanage-of-conan-unchainedaocaoc-unchainedconancontent-packearly-accessexclusivef2pfantasyfree-to-playjewels-of-turanlaunch-datenew-contentsavage-coastsavage-coast-of-turanFri, 26 Aug 2011 10:00:00 EST<![CDATA[Funcom teases Age of Conan Turan armor]]>http://massively.joystiq.com/2011/08/24/funcom-teases-age-of-conan-turan-armor/http://massively.joystiq.com/2011/08/24/funcom-teases-age-of-conan-turan-armor/http://massively.joystiq.com/2011/08/24/funcom-teases-age-of-conan-turan-armor/#commentsFiled under: , , , , , ,

Age of Conan - Turan armor
We still don't have a release date for Age of Conan's next content drop, but the Savage Coast of Turan adventure pack is nonetheless looking pretty spiffy. How's that, you say? Well, Funcom has teased a couple of new screenshots featuring gear from the new pack, and you can see for yourself at the AoC Facebook page.

There's a pair of male and a pair of female models on display (and unlike most fantasy MMOs, Age of Conan continues its tradition of providing actual armor for the fairer sex as opposed to thongs and heavy metal bras).

The only question that remains is where will players get the bag or bank space to hold the new sets?

MassivelyFuncom teases Age of Conan Turan armor originally appeared on Massively on Wed, 24 Aug 2011 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>adventure-package-of-conanage-of-conan-unchainedaocaoc-unchainedarmorarmor-screensf2pfantasyfree-to-playfuncomnew-contentno-skimpy-armor-heresavage-coast-of-turanscreenshotsWed, 24 Aug 2011 16:30:00 EST<![CDATA[Funcom talks inspiration and AoC's massive Savage Coast of Turan adventure pack]]>http://massively.joystiq.com/2011/08/13/funcom-talks-inspiration-and-aocs-massive-savage-coast-of-turan/http://massively.joystiq.com/2011/08/13/funcom-talks-inspiration-and-aocs-massive-savage-coast-of-turan/http://massively.joystiq.com/2011/08/13/funcom-talks-inspiration-and-aocs-massive-savage-coast-of-turan/#commentsFiled under: , , , , , ,

Conan - Jason Momoa
Age of Conan faithful, enjoy yourselves. There's simply never been a better time to be a fan of the great barbarian and Funcom's blood-drenched MMORPG based on his Hyborian stomping grounds. The year has already seen the fantasy title adopt a free-to-play business model and push out a ton of new content, and that's really the tip of the proverbial iceberg.

With the new Conan film reboot arriving in theaters this month, Funcom is gearing up to launch a huge amount of tie-in content. Dubbed The Savage Coast of Turan, the upcoming adventure pack adds a large outdoor playfield and over 50 new quests to the gameworld, not to mention two solo instances, a team instance, a new raid, and plenty of new gear.

Join us after the cut as we present Funcom's internally produced look at the inspiration behind all the new content, and stay tuned to Massively this weekend for some exclusive Savage Coast news as well as an Anvil of Crom interview with game director Craig Morrison.

Continue reading Funcom talks inspiration and AoC's massive Savage Coast of Turan adventure pack

MassivelyFuncom talks inspiration and AoC's massive Savage Coast of Turan adventure pack originally appeared on Massively on Sat, 13 Aug 2011 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>age-of-conanage-of-conan-unchainedaocaoc-unchainedconanconan-filmconan-moviecraig-morrisondead-mans-handf2pfantasyfeaturedfree-to-playfuncomhyboriaisle-of-iron-statuesmovie-contentmovie-tie-innew-contentPer-Storlokkensavage-coastsavage-coast-of-turanturanSat, 13 Aug 2011 12:00:00 EST<![CDATA[Star Trek Online's Ask Cryptic featurette hints at new content]]>http://massively.joystiq.com/2011/08/12/star-trek-onlines-ask-cryptic-featurette-hints-at-new-content/http://massively.joystiq.com/2011/08/12/star-trek-onlines-ask-cryptic-featurette-hints-at-new-content/http://massively.joystiq.com/2011/08/12/star-trek-onlines-ask-cryptic-featurette-hints-at-new-content/#commentsFiled under: , , , , ,

Star Trek Online - Borg cube
It's time for the Star Trek Online edition of this month's Ask Cryptic, and executive producer Dan Stahl has stepped up to the plate with a whopping 5,000-word community-powered monster of a post.

Stahl delivers some good news right off the bat, as STO is scheduled to receive several new content additions between now and the end of October. Chief among these are various Borg-related invasion events, new lore quests, the Klingon Academy zone, the duty officer system and assignments, and Feature Episode Series 4.

The vast majority of the rest of the post is devoted to very specific gameplay questions and requests from STO players, and there's even a mention of the fact that Cryptic is hiring. Warp to the official STO website for all the details.

MassivelyStar Trek Online's Ask Cryptic featurette hints at new content originally appeared on Massively on Fri, 12 Aug 2011 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ask-crypticborgcontentcrypticcryptic-studiosdan-stahleventsfeature-episode-series-4feature-episodesjob-openingsjobsklingon-academy-zonenew-contentnow-hiringperfect-world-entertainmentpwesci-fistar-trekstar-trek-onlinestoFri, 12 Aug 2011 12:00:00 EST<![CDATA[Massively Exclusive: Maplestory Age of Triumph trailer]]>http://massively.joystiq.com/2011/08/10/massively-exclusive-maplestory-age-of-triumph-trailer/http://massively.joystiq.com/2011/08/10/massively-exclusive-maplestory-age-of-triumph-trailer/http://massively.joystiq.com/2011/08/10/massively-exclusive-maplestory-age-of-triumph-trailer/#commentsFiled under: , , , , , ,

Last week, Nexon announced the conclusion of the Chaos series in their free-to-play fantasy side-scroller MapleStory -- Age of Triumph. Today, the studio offers Massively an exclusive video trailer for a peek at the action that is scheduled to release on August 17th.

The video highlights the three main features coming up in this patch: The new PvP game Capture the Flag; footage of the new Silent Crusade story line, a full-length quest for players level 37-110; and even the new Crusader Codex, a book highlighting the various monsters that roam Maple World which players can add to after defeating new monsters.

Click past the cut for a look at these upcoming features in Age of Triumph.

Continue reading Massively Exclusive: Maplestory Age of Triumph trailer

MassivelyMassively Exclusive: Maplestory Age of Triumph trailer originally appeared on Massively on Wed, 10 Aug 2011 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>Age-of-Triumphcapture-the-flagchaoscrusader-codexf2pfree-to-playMapleStorymassively-exclusivenew-contentnexonpatchpatchespvpSilent-CrusadetrailerupdatevideoWed, 10 Aug 2011 12:00:00 EST<![CDATA[Aika's Epic II: Exodus expansion debuts August 11th]]>http://massively.joystiq.com/2011/08/05/aikas-epic-ii-exodus-expansion-debuts-august-11th/http://massively.joystiq.com/2011/08/05/aikas-epic-ii-exodus-expansion-debuts-august-11th/http://massively.joystiq.com/2011/08/05/aikas-epic-ii-exodus-expansion-debuts-august-11th/#commentsFiled under: , , , , , , ,

Next week is a big one for fans of Aika Online, as the free-to-play fantasy title will be rolling out its first expansion. The patch is called Epic II: Exodus, and judging by the amount of new content in gPotato's latest press blurb, epic is an apt descriptor.

Aika players are getting a new zone, a level cap increase (to 75), new mounts, and a few choice pre-launch bonus events. These include triple (yes, triple) XP and play-for-rewards summer events which offer a laundry list of cool prizes just for logging in. As for the new zone, Traband was formerly a temperate and beautiful island but is now a frozen wasteland "where only the most bloodthirsty beasts survive." That's OK, though, because what self-respecting MMO adventurer wants to hang out in a tropical safe zone bereft of killable monsters?

The Aika website has more details on Epic II, and you'll also find the client download front and center on the new splash page.

MassivelyAika's Epic II: Exodus expansion debuts August 11th originally appeared on Massively on Fri, 05 Aug 2011 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>aikaaika-epic-iiaika-exodusaika-expansionaika-onlineepic-ii-exodusexpansionf2pfantasyfree-to-playgpotatolevel-cap-increasenew-contentnew-mountspatchespress-releasetrabandFri, 05 Aug 2011 13:00:00 EST