Massively http://massively.joystiq.com Massively http://www.blogsmithmedia.com/http://massively.joystiq.com/media/feedlogo.gif Massively http://massively.joystiq.com en-us Copyright 2013 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[Neverwinter State of the Game announces public test shard, raid content]]>http://massively.joystiq.com/2013/05/24/neverwinter-state-of-the-game-announces-public-test-shard-raid/http://massively.joystiq.com/2013/05/24/neverwinter-state-of-the-game-announces-public-test-shard-raid/http://massively.joystiq.com/2013/05/24/neverwinter-state-of-the-game-announces-public-test-shard-raid/#commentsFiled under: , , , , , , , ,

Neverwinter State of the Game announces public test shard, raid content
While still technically beta, Neverwinter joined the rank and file of MMOverse three weeks ago with a soft launch. Since then, the game has experienced its share of issues, bugs, and exploits. To address those, as well as give players a heads-up on what's incoming, Lead Producer Andy Velasquez shared the fantasy game's first State of the Game address.

Velasquez jumped right into discussing the bugs and exploits that have affected the game since open beta started and outlined the fixes that were implemented to squash them. He went on to talk about the top issues that the team was working on currently and then reveal what players can expect to see in the next few weeks. A Public Test Shard is coming to Neverwinter (to hopefully catch bugs and exploits before going live), as is new endgame raid PvE/PvP content called Gauntlgrym. Other new content includes updates in the Foundry and new companions, zones, mounts, mechanics, Paragon Paths, and a new "ranged" class.

MassivelyNeverwinter State of the Game announces public test shard, raid content originally appeared on Massively on Fri, 24 May 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmoAndy-Velasquezcrypticcryptic-studiosdev-blogdndf2pfantasyFoundryfree-to-playneverwinternew-contentopen-betaperfect-worldperfect-world-entertainmentpublic-test-serverpublic-test-shardpweraid-contentraidssoft-lunchstate-fo-the-gameFri, 24 May 2013 11:00:00 EST<![CDATA[City of Steam opens beta doors at 10 p.m. tonight]]>http://massively.joystiq.com/2013/05/10/city-of-steam-opens-beta-doors-at-10-pm-tonight/http://massively.joystiq.com/2013/05/10/city-of-steam-opens-beta-doors-at-10-pm-tonight/http://massively.joystiq.com/2013/05/10/city-of-steam-opens-beta-doors-at-10-pm-tonight/#commentsFiled under: , , , , , , ,

City of Steam opens beta doors at 10 pm tonight
If you've been eagerly awaiting your chance to get into the browser-based steampunk goodness of City of Steam, your wait is nearly over. Clear your Friday night plans because in just a few hours at 10:00 p.m. EDT, the city of Nexus will be welcoming its new residents. And you won't be needing any early access key, as Mechanist Games is throwing the beta doors open wide for any and all!

Returning testers will notice many new features have been added since the closed beta runs, like events, a plethora of new cosmetic items, and more streamlined skill, talent, and crafting systems. And jetpacks -- who can forget the jetpacks! Players will also find over 80 dungeons, over 100 quests, new PvP maps, open Wilderness levels, customizable gear, and more... and that's only to start! The devs have an aggressive release schedule plan of adding new features and content on an almost bi-weekly basis throughout the beta.

For more details on what you can expect, check out Massively's hands-on experience as well as the official open beta features list.

[Source: Mechanist Games press release]

MassivelyCity of Steam opens beta doors at 10 p.m. tonight originally appeared on Massively on Fri, 10 May 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>city-of-steamfantasygoblinmechanistmechanist-gamesnew-contentopen-betasci-fisteampunkThe-NexusFri, 10 May 2013 11:00:00 EST<![CDATA[Chaos Theory: Hoppin' TSW's train to Cairo]]>http://massively.joystiq.com/2013/03/18/chaos-theory-hoppin-tsws-train-to-cairo/http://massively.joystiq.com/2013/03/18/chaos-theory-hoppin-tsws-train-to-cairo/http://massively.joystiq.com/2013/03/18/chaos-theory-hoppin-tsws-train-to-cairo/#commentsFiled under: , , , , , ,

Chaos Theory Hoppin' that train to Cairo in TSW
It doesn't matter one iota what I had planned to talk about today, regardless of how phenomenal it may have been. The fact that The Last Train to Cairo has pulled into the station means I'm hopping on it! Yes, The Secret World's latest update hit this week with barely a day's warning and (thanks to my lifetime membership), I've been sinking my teeth into it since last Thursday.

However, in the interest of full disclosure, I have to say that I have not boarded the actual train part of the adventure. I had no interest in blowing through the new content in just a couple of days; I prefer to savor the new goodies. But I have delved pretty deeply into it and have a experienced a fair share of Issue #6. So how's the ride so far? Keep reading for a test drive, then come watch as Creative Director Joel Bylos joins me for a livestream tour on Thursday, March 21st at 11:00 a.m. EDT on Massively TV.

Continue reading Chaos Theory: Hoppin' TSW's train to Cairo

MassivelyChaos Theory: Hoppin' TSW's train to Cairo originally appeared on Massively on Mon, 18 Mar 2013 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbugsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragonfactionfaction-pvpfantasyfeaturedfuncomhand-to-handhand-to-hand-combathintshorrorilluminatiIssue-6Issue-6-The-Last-Train-to-Cairomythologynew-contentopinionpatchsabotage-missionssci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsThe-Last-Train-to-Cairothe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonupdatesMon, 18 Mar 2013 14:00:00 EST<![CDATA[The Secret World's Last Train to Cairo pulls into the station this March]]>http://massively.joystiq.com/2013/02/22/the-secret-world-issue-6-the-last-train-to-cairo-pulls-into-the/http://massively.joystiq.com/2013/02/22/the-secret-world-issue-6-the-last-train-to-cairo-pulls-into-the/http://massively.joystiq.com/2013/02/22/the-secret-world-issue-6-the-last-train-to-cairo-pulls-into-the/#commentsFiled under: , , , , , , ,

The Secret World Issue #6 to hit in early MarchWhile Funcom's recent restructuring and relocation put the brakes on The Secret World's content release schedule, it wasn't totally derailed. In fact, the next content update will be hitting servers sooner than many expected; Issue # 6 The Last Train to Cairo is scheduled to go live in the beginning of March. While no exact date has been given yet, paid members will get two days of early access to the content.

What awaits denizens of The Secret World in this latest issue? A new storyline, a new foe (of raid proportions), the new veteran reward system, PvP ranking, and a new auxiliary weapon are all a part of this update. A new recruitment system will also be implemented, granting points equal to one month of membership for every new recruit.

In an effort to contain the evil spreading through the sands of Egypt, players will delve deeper into the past of the desert land by actually traveling back in time to uncover powerful artifacts. Remember that petrified undead arms dealer, Said? Tap into his wisdom for advice on working against the cultists and their dark prophet Abdel Daoud. And last but certainly not least, fight atop a speeding train to Cairo with the newest auxiliary weapon, the whip, in true Indiana Jones style.

MassivelyThe Secret World's Last Train to Cairo pulls into the station this March originally appeared on Massively on Fri, 22 Feb 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>auxiliary-weaponbuy-to-playfactionfantasyfuncomhorrorissue-6Issue-6-The-Last-Train-to-Cairomythologynew-contentnew-weaponrecruitment-systemsci-fantasysecret-worldskill-basedsubscriptionlessThe-Last-Train-to-Cairothe-secret-worldtswupdatewhipFri, 22 Feb 2013 11:00:00 EST<![CDATA[Path of Exile update adds new maps, overhauls audio, and improves art]]>http://massively.joystiq.com/2013/02/13/path-of-exile-update-adds-new-maps-overhauls-audio-and-improve/http://massively.joystiq.com/2013/02/13/path-of-exile-update-adds-new-maps-overhauls-audio-and-improve/http://massively.joystiq.com/2013/02/13/path-of-exile-update-adds-new-maps-overhauls-audio-and-improve/#commentsFiled under: , , , , , ,

Path of Exile update adds new maps, overhauls audio, and improves art
With Path of Exile's open beta well under way, players can expect changes here and there as issues are addressed and bugs are squashed. Yesterday, Grinding Gear Games rolled out a new update that included reworked audio and updated artwork as well as added 11 new types of maps. Full details can be found in the 0.10.1 patch notes.

Although not deployed yet, players can also expect other changes in this patch series including minion targeting, high-level mods in items, and improved livestreaming features. Then the next big patch, 0.10.2, will mark the beginning of the open beta content schedule that promises even more core content.

For more on Path of Exile, check out Massively's impressions and hands-on experiences. And be sure to watch the action next Sunday, February 17th at 10:00 p.m. EST on Massively TV.

MassivelyPath of Exile update adds new maps, overhauls audio, and improves art originally appeared on Massively on Wed, 13 Feb 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmoaudio-improvementsdiablof2pfantasyfree-to-playgrinding-geargrinding-gear-gamesnew-contentnew-mapspatchpatch-0.10.1path-of-exilepoeroguelikeWed, 13 Feb 2013 11:00:00 EST<![CDATA[The Daily Grind: What game do you still hope will be revitalized?]]>http://massively.joystiq.com/2013/02/05/the-daily-grind-what-game-do-you-still-hope-will-be-revitalized/http://massively.joystiq.com/2013/02/05/the-daily-grind-what-game-do-you-still-hope-will-be-revitalized/http://massively.joystiq.com/2013/02/05/the-daily-grind-what-game-do-you-still-hope-will-be-revitalized/#commentsFiled under: , , , , ,

And as long as I'm dreaming I'd like to see Chaos be a bit more gender-neutral.
I do not play Warhammer Online any longer, but it holds a special place in my heart. I greatly enjoyed playing the game when it was selected for Choose My Adventure back in the day, and I still hold out hope that the game will emerge from its slow stagnancy to be some sort of WAAAGH-based phoenix. The odds of that happening are low, but I'd love to see it happen just the same.

Games have a life cycle, and after a certain point, even the most beloved online title slips into a maintenance mode. But we all have titles that we'd love to see get updates once again, allowing us to relive the glory days. This isn't about games that had been shut down; this is about games that are still running but are no longer at the forefront of the gaming zeitgeist. So what game do you still hope will be revitalized, even if you don't expect it to happen? Would you like to see Ultima Online get another day in the sun, or do you just hope that Champions Online will get a big expansion and some development love?

Every morning, the Massively bloggers probe the minds of their readers with deep, thought-provoking questions about that most serious of topics: massively online gaming. We crave your opinions, so grab your caffeinated beverage of choice and chime in on today's Daily Grind!

MassivelyThe Daily Grind: What game do you still hope will be revitalized? originally appeared on Massively on Tue, 05 Feb 2013 08:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>active-updatesdaily-grindexpansionsmaintenance-modemajor-patchesmajor-updatesnew-contentold-gamesolder-gamesopinionpatchesstatic-gamestdgthe-daily-grindupdatesTue, 05 Feb 2013 08:00:00 EST<![CDATA[EVE Online dev blog details changes to Drone Regions coming in Retribution]]>http://massively.joystiq.com/2012/11/28/eve-online-dev-blog-details-changes-to-drone-regions-coming-in-r/http://massively.joystiq.com/2012/11/28/eve-online-dev-blog-details-changes-to-drone-regions-coming-in-r/http://massively.joystiq.com/2012/11/28/eve-online-dev-blog-details-changes-to-drone-regions-coming-in-r/#commentsFiled under: , , , , , ,

EVE Online dev blog details changes to Drone Regions coming in Retribution
Not all regions are created equally, and that's something EVE Online devs are fixing. No, that doesn't mean all regions will be boring carbon copies. But it does mean that devs are adding content to the eight different areas known collectively as the Drone Regions to bring them more in line with the rest of the New Eden cluster.

When the Retribution expansion hits in December, the Drone Regions (so named for the special drone content located within them) will be getting four officer spawns, five officer modules, and hauler spawns scattered throughout the sectors. Salvage from NPCs is also getting a buff to increase it to the levels seen elsewhere in the game, and rogue drones will give sec status.

In other EVE news, CCP announced that fans can now subscribe to EON magazine using PLEX.

MassivelyEVE Online dev blog details changes to Drone Regions coming in Retribution originally appeared on Massively on Wed, 28 Nov 2012 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesdev-blogDrone-RegionsEONEON-magazineeveeve-onlineexpansioninternet-spaceshipsnew-contentRetributionsandboxsci-fispreadsheets-onlineWed, 28 Nov 2012 11:00:00 EST<![CDATA[Champions Online previews the upcoming vehicle system]]>http://massively.joystiq.com/2012/11/05/champions-online-previews-the-upcoming-vehicle-system/http://massively.joystiq.com/2012/11/05/champions-online-previews-the-upcoming-vehicle-system/http://massively.joystiq.com/2012/11/05/champions-online-previews-the-upcoming-vehicle-system/#commentsFiled under: , , , , , ,

Never purchase or attempt to steal a vehicle too small to ride.
Being able to fly is all well and good, but why fly through the skies unaided when you could sit safely inside the chassis of a heavily armored warplane? That's the idea behind the new vehicle system coming to Champions Online later this week, which will offer players a variety of new rides and ways to enhance those same rides. After all, you deserve to give your legs a rest. Or your arms. Or whatever muscle you flex to fly with no visible means of propulsion.

The vehicle system will start off by offering players just two choices -- jets and hovertanks -- but more will be available in the future. Each vehicle chassis offers a certain set of base stats, which can be further improved by slotting in vehicle equipment from the new vehicle missions. Players can also apply a variety of skins to each vehicle chassis, ensuring that you can make the ride feel unique even around your friends with a similar machine.

MassivelyChampions Online previews the upcoming vehicle system originally appeared on Massively on Mon, 05 Nov 2012 19:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>championschampions-onlinechampscocrypticcryptic-studiosf2pfree-to-playnew-contentnew-mechanicsnew-systemsperfect-worldperfect-world-entertainmentpwesuperherosuperheroesvehicle-contentvehicle-systemvehiclesMon, 05 Nov 2012 19:30:00 EST<![CDATA[SOE Live 2012: EQII's Chains of Eternity adding tradeskill prestige and much more]]>http://massively.joystiq.com/2012/10/20/soe-live-2012-eqiis-chains-of-eternity-adding-tradeskill-pres/http://massively.joystiq.com/2012/10/20/soe-live-2012-eqiis-chains-of-eternity-adding-tradeskill-pres/http://massively.joystiq.com/2012/10/20/soe-live-2012-eqiis-chains-of-eternity-adding-tradeskill-pres/#commentsFiled under: , , , , , , , , ,

SOE Live 2012 EQII Chains of Eternity adding tradeskill prestige and much more
Players were so excited about some of the announcements made in yesterday's EveryQuest II's panel on mechanics for Chains of Eternity at SOE Live that the room erupted into applause multiple times. What types of goodies brokered this response from attendees? How about new tradeskill specializations (including a separate AA pool and a gathering sidekick that can harvest rares!), new guild amenities, new adornments, and even adornment removers?

Of course, those aren't the only incoming changes. Others include increasing in the level cap to 95, alterations to the mentoring system to prevent AFK XP farming, and new prestige abilities.

Continue reading SOE Live 2012: EQII's Chains of Eternity adding tradeskill prestige and much more

MassivelySOE Live 2012: EQII's Chains of Eternity adding tradeskill prestige and much more originally appeared on Massively on Sat, 20 Oct 2012 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>adornment-removeradornmentschains-of-eternityconconventioncraftingcrafting-AAcrafting-prestigeEidolon-Jungleeq-2eq-iieq2eqiieventeverquest-2everquest-iiexpansionf2pfan-fairefantasyfeaturedfree-to-playguild-amenitiesholly-longdalelas-vegasmentoringmentoring-systemmew-zonesnew-contentObol-Plainssoesoe-fan-fairesoe-livesoe-live-2012sonysony-online-entertainmenttradeskill-AAtradeskill-prestigeSat, 20 Oct 2012 15:00:00 EST<![CDATA[Star Wars: The Old Republic livestream discusses free-to-play, HK-51, and scaling]]>http://massively.joystiq.com/2012/09/21/star-wars-the-old-republic-livestream-discusses-free-to-play-h/http://massively.joystiq.com/2012/09/21/star-wars-the-old-republic-livestream-discusses-free-to-play-h/http://massively.joystiq.com/2012/09/21/star-wars-the-old-republic-livestream-discusses-free-to-play-h/#commentsFiled under: , , , , , , ,

Somehow cheery purebloods look more creepy.
The community team behind Star Wars: The Old Republic hosted a livestream, and as you can probably imagine, the whole session has been recorded already by the team from Darth Hater for your viewing pleasure. But if you want to know the highlights and you can't wait for a more detailed take (say, from next week's Hyperspace Beacon), you can always get the rundown of some of the bigger points from the half-hour session.

For those currently playing, HK-51 can be expected before the end of the year, with Cathar getting a somewhat more ambiguous release of whenever the species is ready. There will also be other species to be unlocked when the free-to-play conversion goes live, along with moddable gear (without endgame stats), mounts, and pets. The team is also looking into implementing a hood toggle for the Force-using classes of the game and scaling content down in difficulty for smaller groups of players. Check out the full recording past the break, or just take a look at the highlights.

Continue reading Star Wars: The Old Republic livestream discusses free-to-play, HK-51, and scaling

MassivelyStar Wars: The Old Republic livestream discusses free-to-play, HK-51, and scaling originally appeared on Massively on Fri, 21 Sep 2012 20:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>biowarecommunity-q-and-adifficultyeaelectronic-artsf2pfree-to-playlivestreamlucasartsmicrotransactionsnew-contentq-and-ascalingsci-fistar-warsstar-wars-the-old-republicsubsubscription-feeswtorthe-old-republictorupdatesFri, 21 Sep 2012 20:30:00 EST<![CDATA[Uncharted Waters Online expands to include The Wild West]]>http://massively.joystiq.com/2012/06/28/uncharted-waters-online-expands-to-include-the-wild-west/http://massively.joystiq.com/2012/06/28/uncharted-waters-online-expands-to-include-the-wild-west/http://massively.joystiq.com/2012/06/28/uncharted-waters-online-expands-to-include-the-wild-west/#commentsFiled under: , , , ,

Uncharted Waters Online
Yippee-kai-ya and get along li'l doggies! The Wild West is coming to Uncharted Waters Online, bringing with it the chance to explore and discover national monuments in the prairies, grasslands, and steppes of the North American continent. The Great Plains expansion, the third chapter of the Tierra Americana expansion, also introduces a new colony that is the only place in the world where certain grains can grow, which encourages players to build their own cities in that region.

What else can seafaring adventures expect in this expansion? The chance to visit the scholarly city of Oxford, the ability to learn the pirate code, new vessels, and new ways to store stuff are all included. And what better way to celebrate a new expansion than by participating in the Epic Sea Feud from June 28th through the 30th? Hoist the anchors and join the fray!

[Source: CJ E&M press release]

MassivelyUncharted Waters Online expands to include The Wild West originally appeared on Massively on Thu, 28 Jun 2012 12:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>CJ-EMcj-em-gamesexpansionf2pfree-to-playnew-contentnew-shipsNorth-American-continentThe-Great-Plainstierra-americanauncharted-waters-onlineuwoThu, 28 Jun 2012 12:30:00 EST<![CDATA[Ultima Online rolling out a new installment of the Awakening]]>http://massively.joystiq.com/2012/05/21/ultima-online-rolling-out-a-new-installment-of-the-awakening/http://massively.joystiq.com/2012/05/21/ultima-online-rolling-out-a-new-installment-of-the-awakening/http://massively.joystiq.com/2012/05/21/ultima-online-rolling-out-a-new-installment-of-the-awakening/#commentsFiled under: , , , , ,

In some cases, sleep is better than awakening. Like waking up to a fight against a giant squid monster.
Ultima Online is preparing a continuation of the game's latest global arc with tomorrow's patch. Act VI of The Awakening asks players to assist in crafting a number of alchemical preparations, with a number of rewards available for players who actively try to crack the puzzle of the correct ingredients. More information will be available from the official site as well as an in-game NPC. If you need more time to prepare, don't worry -- the quest is going active in July and lasting until mid-August.

If you're not willing to wait, the new patch also sees a revamp of the Covetous Dungeon. The first floor remains largely unchanged, but levels two and three both feature a new system for the game in which players accumulate points for defeating monsters that can later be turned in for new rewards. Last but not least, vanilla plants have been added to the game's gardening system, giving players another new thing to explore when not fighting monsters or preparing for the next part of The Awakening.

MassivelyUltima Online rolling out a new installment of the Awakening originally appeared on Massively on Mon, 21 May 2012 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>classic-mmodungeon-revampsdungeonseaelectronic-artsfantasygame-mechanicsglobal-arclord-britishmythicmythic-entertainmentnew-contentnew-patchnewspatchpatch-notespatchesrevampsthe-awakeningultimaultima onlineuouo-awakeningupdatesMon, 21 May 2012 18:30:00 EST<![CDATA[DC Universe Online shows off the new Shield weapon]]>http://massively.joystiq.com/2012/05/17/dc-universe-online-shows-off-the-new-shield-weapon/http://massively.joystiq.com/2012/05/17/dc-universe-online-shows-off-the-new-shield-weapon/http://massively.joystiq.com/2012/05/17/dc-universe-online-shows-off-the-new-shield-weapon/#commentsFiled under: , , , , , ,

Based off of a Kirby character who was based off of another Kirby character owned by a competing company.
Shields generally aren't thought of as a weapon; they're usually seen as the exact opposite of a weapon. But in the superheroic milieu, all that changes. A shield is something to be used offensively, and in DC Universe Online's next major update, players will begin wielding the shield for their own superheroic (or villainous) capers. A recent interview with creative director Jens Andersen discusses the intended role of the shield in combat.

Andersen explains that while the new weapon comes along in a very PvP-centered update, it's not meant to be used specifically for PvP; the team just wants to have something new for players to enjoy no matter what. In play, shields are similar to a staff weapon, but unlike most other weapons, the shield can continue to build a combo after a heavy strike by moving back to light strikes. That should make the shield a very aggressive option -- perhaps odd for something that's not generally thought of as a weapon.

MassivelyDC Universe Online shows off the new Shield weapon originally appeared on Massively on Thu, 17 May 2012 23:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>combatconsoleconsolesdc-universedc-universe-onlinedcuodlcf2pfree-to-playinterviewnew-abilitiesnew-contentnew-weaponspatchesplaystation-3playstation3ps3shieldshieldssoesony-online-entertainmentsuperherosuperheroesthe-last-laughupdatesweaponweaponsThu, 17 May 2012 23:00:00 EST<![CDATA[Spirit Tales launching Crisis of Jade Forest next week]]>http://massively.joystiq.com/2012/05/17/spirit-tales-launching-crisis-of-jade-forest-next-week/http://massively.joystiq.com/2012/05/17/spirit-tales-launching-crisis-of-jade-forest-next-week/http://massively.joystiq.com/2012/05/17/spirit-tales-launching-crisis-of-jade-forest-next-week/#commentsFiled under: , , , , ,

Diabeetus.
It's really hard to imagine anything in the saccharine world of Spirit Tales being properly termed a crisis, but the game's newest update is aiming in that direction. The Crisis of Jade Forest goes live on May 23rd, giving players a chance to tackle an extra-difficult version of the normal Jade Forest area with extra boss-enriched goodness. Successful players have plenty of motivation, however, as the reward for completion involves a chest that could contain items normally reserved for the game's item mall.

Groups of up to five players can enter the battle once per day, which fills the area with deadly monsters and 10 special bosses. Successfully defeating all of these bosses will grant the chance to earn both rewards that would normally cost real money as well as other little trinkets. it's also meant to be a great way to level up, so if you're already in the open beta, you may want to consider a look at the dungeon.

MassivelySpirit Tales launching Crisis of Jade Forest next week originally appeared on Massively on Thu, 17 May 2012 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>animedungeondungeon-contentf2pfree-to-playkoramgamekoramgame-ltdmicrotransactionsnew-contentpatchespreviewsspecial-contentspirit-talesupdatesThu, 17 May 2012 17:30:00 EST<![CDATA[Star Trek Online posts Ask Cryptic answers for each day of May]]>http://massively.joystiq.com/2012/05/04/star-trek-online-posts-ask-cryptic-answers-for-each-day-of-may/http://massively.joystiq.com/2012/05/04/star-trek-online-posts-ask-cryptic-answers-for-each-day-of-may/http://massively.joystiq.com/2012/05/04/star-trek-online-posts-ask-cryptic-answers-for-each-day-of-may/#commentsFiled under: , , , , ,

Attacking DS9 is always something like content.
Converting a game from a subscription model is hard work. That's the theme throughout the latest installment of Star Trek Online's regular Ask Cryptic feature: The reason that the game has gone for so long without major batches of new content is that the team has been wholly focused on switching models. But there's more coming to the game in the near future, starting with the major Season 6 patch hitting the test server soon.

The coming patch will feature new ground and space missions similar to STFs without being quite the same sort of content. The update will also feature a new Fleet Advancement system, which will give player groups a chance to improve themselves and acquire new bonuses. Star Trek Online players will be well-served by taking a look at the full list of answers, which go into further detail about upcoming systems and planned additions for the next patch and beyond.

MassivelyStar Trek Online posts Ask Cryptic answers for each day of May originally appeared on Massively on Fri, 04 May 2012 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ask-crypticcrypticcryptic-studiosdevelopmentf2pfleet-advancementfree-to-playgame-mechanicsmajor-patchmajor-patchesnew-contentpatchpatchesperfect-worldperfect-world-entertainmentpwesci-fistar-trekstar-trek-mmostar-trek-onlinestosto-season-6Fri, 04 May 2012 16:30:00 EST<![CDATA[New preview available for Final Fantasy XIV's Garuda fight]]>http://massively.joystiq.com/2012/04/24/new-preview-available-for-final-fantasy-xivs-garuda-fight/http://massively.joystiq.com/2012/04/24/new-preview-available-for-final-fantasy-xivs-garuda-fight/http://massively.joystiq.com/2012/04/24/new-preview-available-for-final-fantasy-xivs-garuda-fight/#commentsFiled under: , , , , , ,

Many-winged angel.
The primals are among the greatest forces within Eorzea, something that Final Fantasy XIV players are no doubt acutely aware of after the clash with Ifrit. The second primal battle is coming, pitting players against Garuda, deity of the Ixali. That means another pitched battle against a superior foe in the Howling Eye, a battle which the official site has just recently previewed with a video of the fight in hard mode and a video preview of the new weapon rewards.

According to the lore, the Ixali revere Garuda as the Empress of Birds, a soaring deity who maintains an appetite for the flesh of land-dwelling creatures. She is the incarnate strength of the bird-men as well as a source of great terror. But just as with Ifrit, players who defeat her can expect to have a variety of fantastic weapons, as illustrated in the video just past the break. Just be careful -- if you aren't on the ball when you fight her, you could find yourself completely blown away.

[Thanks to Alex for the tip!]

Continue reading New preview available for Final Fantasy XIV's Garuda fight

MassivelyNew preview available for Final Fantasy XIV's Garuda fight originally appeared on Massively on Tue, 24 Apr 2012 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>boss-battlesconsoleconsolesendgamefantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivgarudalorenew-contentpreviewprimalprimalssquaresquare-enixvideovideo-previewvideosTue, 24 Apr 2012 20:00:00 EST<![CDATA[Guided tour of the new SWTOR flashpoint]]>http://massively.joystiq.com/2012/04/06/guided-tour-of-the-new-swtor-flashpoint/http://massively.joystiq.com/2012/04/06/guided-tour-of-the-new-swtor-flashpoint/http://massively.joystiq.com/2012/04/06/guided-tour-of-the-new-swtor-flashpoint/#commentsFiled under: , , , , , ,

SWTOR flashpoint: The Lost Island
Yesterday, BioWare invited some members of the press to take part in a guided tour of the latest update for Star Wars: The Old Republic. In recent Hyperspace Beacons, we've covered everything from the user interface changes to the crew skills system. However, the specifics of some of the new story content have been a bit sparse. Thanks to help from BioWare, that's now changed.

Beyond the break, we have put together a 15-minute video describing the ins and outs of the latest flashpoint: The Lost Island. Together with a member of the BioWare development team, we explored this new level-50 zone, destroying everything in our path and maybe learning something along the way.

Continue reading Guided tour of the new SWTOR flashpoint

MassivelyGuided tour of the new SWTOR flashpoint originally appeared on Massively on Fri, 06 Apr 2012 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>biowaredr-lorrickdungeoneaelectronic-artsflashpointguided-tourinstancelucasartsnew-contentopinionord-mantellpreviewrakghoulRise-of-the-Rakghoulssci-fistar-warsstar-wars-the-old-republicswtorthe-lost-islandthe-old-republictorupdate-1.2videoFri, 06 Apr 2012 19:00:00 EST<![CDATA[No subtlety to Champions Online's SMASH Alerts, just straight-up brawling]]>http://massively.joystiq.com/2012/02/23/no-subtlety-to-champions-onlines-smash-alerts-just-straight-up/http://massively.joystiq.com/2012/02/23/no-subtlety-to-champions-onlines-smash-alerts-just-straight-up/http://massively.joystiq.com/2012/02/23/no-subtlety-to-champions-onlines-smash-alerts-just-straight-up/#commentsFiled under: , , , , , ,

Venom is attacking the city! This looks like a job for... um... darn, what was that guy's name? The dude with the swords? Cutman? Cut-up? Something with cut.
The most basic superhero stories are pretty simple -- a villain is attacking the city and the hero has to go stop him or her. That's the spirit behind the new SMASH Alerts coming to the Champions Online test realm, quick instances that pit players against signature villains in a straight-up brawl. The villain may or may not have any minions, but the real test is to see if the heroes can knock out the villain within the time limit.

Players will notice that the new Alert system also has gained a new minimap icon and improved queue functionality, allowing you to sign up for a quick and dirty brawl with your nemesis of choice from anywhere. There are also new team-up GRAB Alerts available for testing against paired villains, which should give every hero a chance to pop in and beat the living daylights out of a villain up to no good. And, really, isn't that all you can ask from a superhero game?

MassivelyNo subtlety to Champions Online's SMASH Alerts, just straight-up brawling originally appeared on Massively on Thu, 23 Feb 2012 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alert-systemsalertschampions-onlinecocrypticcryptic-studiosf2pfree-to-playnew-contentperfect-world-entertainmentpwequeuequeueing-systemsupcoming-contentThu, 23 Feb 2012 19:00:00 EST<![CDATA[Wings Over Atreia: Ode to 3.0]]>http://massively.joystiq.com/2012/02/20/wings-over-atreia-ode-to-3-0/http://massively.joystiq.com/2012/02/20/wings-over-atreia-ode-to-3-0/http://massively.joystiq.com/2012/02/20/wings-over-atreia-ode-to-3-0/#commentsFiled under: , , , , , , , ,

Wings Over Atreia header
*cue pitch pipe*

Twinkle, twinkle, little patch,
How I wonder where you're at?
In the East they play with ease,
In the West you're just a tease!
Twinkle, twinkle, three point oh,
Hurry please I want you so!

I've tried to be patient. I really have. I even avoided any wayward glances at Aion's Korean patch notes (translated, of course) for 3.0. That way, I could contain my excitement a little better. I mean, we already know I am dying for housing, and I also know mounts are involved. But there is always so much more, and I was trying to make the wait more bearable. I stood firm in my resolve.

Then I broke down. I peeked. And oh how the many-tendriled beast of anticipation took hold of me once again! Of course there is always the requisite "fixed this bug" and "changed that appearance" filler, but when mining deeper, you also find some definite valuable nuggets. Aion's next patch has some "how cool," some "oh wow, that's really unexpected," and some "about time!" thrown in as well. From new zones to new instances to new features, there is plenty coming our way. Don't want to tax your scroll wheel and sift through the entire patch notes yourself? Wings Over Atreia delves in to uncover some of the most tantalizing treasures for you.

Continue reading Wings Over Atreia: Ode to 3.0

MassivelyWings Over Atreia: Ode to 3.0 originally appeared on Massively on Mon, 20 Feb 2012 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3.0-patchaion-3.0aion-ascensionAturam-Sky-Fortressbeshbeshmundir-templeDorgal-Manordungeondungeon-crawldungeon-crawlingdungeonsexpansionfeaturedincreased-level-capLandis-Forestlevel-caplevel-cap-increasenew-contentnew-landsnew-zonespatch-3.0patchesRentus-Baserole-playrole-playingroleplayroleplayerroleplayersSand-Lords-LairSarpanskill-changesSRSteel-RakeTahmesTiamarantaWings-Over-AtreiaMon, 20 Feb 2012 17:00:00 EST<![CDATA[ArenaNet closes the book on Guild Wars' Winds of Change]]>http://massively.joystiq.com/2012/02/14/arenanet-closes-the-book-on-guild-wars-winds-of-change/http://massively.joystiq.com/2012/02/14/arenanet-closes-the-book-on-guild-wars-winds-of-change/http://massively.joystiq.com/2012/02/14/arenanet-closes-the-book-on-guild-wars-winds-of-change/#commentsFiled under: , , , , ,

Guild Wars - I assume this image has something to do with Winds of Change
If you missed the Winds of Change arc that's bridging the gap between Guild Wars and Guild Wars 2, now's a great time to head to the official ArenaNet blog to catch up. The devs have provided a handy summary post and a bit of an explanation for their narrative goals as both Guild Wars and its highly anticipated sequel move forward.

ArenaNet also acknowledges the community feedback regarding the difficulty of the Winds of Change content, and the firm says that initially "the difficulty was getting in the way of people enjoying the story, making it far more of a slog than we'd intended and actively undermining their enjoyment of it."

Happily, recent updates have led to "major balance tweaks" and second looks at both normal and hard-mode content, so if you were frustrated before, it's worth your time to give it another go.

MassivelyArenaNet closes the book on Guild Wars' Winds of Change originally appeared on Massively on Tue, 14 Feb 2012 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>arena-netarenanetchallengedev-blogfantasyguild-warsguild-wars-2gwgw2mmo-storynarrativencsoftnew-contentwinds-of-changeTue, 14 Feb 2012 20:00:00 EST<![CDATA[Allods Online: Game of Gods coming February 15th]]>http://massively.joystiq.com/2012/02/01/allods-online-game-of-gods-coming-february-15th/http://massively.joystiq.com/2012/02/01/allods-online-game-of-gods-coming-february-15th/http://massively.joystiq.com/2012/02/01/allods-online-game-of-gods-coming-february-15th/#commentsFiled under: , , , , , , ,

Allods Online - Some dude fighting some ghost thing
We knew that Allods' latest expansion was coming soon. We didn't know exactly when, though. Thanks to gPotato, we're now comfortable penciling in February 15th on our free-to-play fantasy calendar.

Game of Gods is "the biggest expansion ever to hit Allods Online," and it will bring a new Bard class, objective-driven PvP arenas, and new raids to the table. New weapons and armor, new allods and astral layers, and some sort of loot-drop lottery card system are also on the way. That's not all, though, and the game's official website has a full listing of the patch's features and functionality.

[Source: gPotato press release]

MassivelyAllods Online: Game of Gods coming February 15th originally appeared on Massively on Wed, 01 Feb 2012 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>allodsallods-onlineastrum-nivalbardclassesexpansionf2pfantasyfree-to-playgame-of-godsgpotatonew-contentpatchesWed, 01 Feb 2012 13:00:00 EST<![CDATA[RIFT's 1.7 patch filled with content, coming soon]]>http://massively.joystiq.com/2012/01/16/rifts-1-7-patch-filled-with-content-coming-soon/http://massively.joystiq.com/2012/01/16/rifts-1-7-patch-filled-with-content-coming-soon/http://massively.joystiq.com/2012/01/16/rifts-1-7-patch-filled-with-content-coming-soon/#commentsFiled under: , , , , , ,

RIFT - some dragon or other
What's next for RIFT? Well, the 1.7 patch, for starters. The update is called Carnival of the Ascended, and if it sounds a bit festive, it is. Telaran weddings are in the offing, as Trion is introducing a marriage mechanic to its fantasy MMO. There's also the new River of Souls Chronicle, which the official forums bill as an "undead adventure for two."

A new master mode dungeon is coming too, as is an expert dungeon overhaul with more options and better loot for endgame avatars. Finally, there's a free weekend coming your way on January 19th, and you can return to Telara (or check it out for the first time) for no charge through January 22nd.

MassivelyRIFT's 1.7 patch filled with content, coming soon originally appeared on Massively on Mon, 16 Jan 2012 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>1.7-patchascendedcarnival-of-the-ascendedchronicledungeonsendgamefantasyin-game-marriagelootmarriagemarriage-mechanicmaster-modemaster-mode-dungeonnew-contentriftrift-1.7rift-planes-of-telarariver-of-souls-chronicletelaratriontrion-worldsweddingMon, 16 Jan 2012 16:00:00 EST<![CDATA[BioWare hints at new SWTOR content, tops one million players]]>http://massively.joystiq.com/2011/12/23/bioware-hints-at-new-swtor-content/http://massively.joystiq.com/2011/12/23/bioware-hints-at-new-swtor-content/http://massively.joystiq.com/2011/12/23/bioware-hints-at-new-swtor-content/#commentsFiled under: , , , ,

Star Wars: The Old Republic - new boss
Star Wars: The Old Republic is less than a week old, and many players are already wondering if and when BioWare is going to add new content. Yes, there are some 50s on the servers already, and James Ohlen has penned a post on the game's official website that should excite those who have already rushed through the game's content.

For starters, January will bring a new flashpoint to the game as well as an expanded operation instance. The former "takes place on a brand new world and involves some pretty epic battles." The latter "takes the existing Karagga's palace scenario and more than triples it in size."

Ohlen says that's just the beginning, too, and BioWare plans on releasing similar new content with regularity. Finally, players concerned over the company's ability to add new story (and voiceover content) will want to check out writer Alexander Freed's post on the official forums. In a nutshell, he says not to worry, as BioWare does have voice actors under contract and can proceed with development without adding much time to the content creation process.

Finally, our sister site reports that TOR has topped one million registered players and over 28 million hours played!

[Thanks to Scratches for the tip!]

MassivelyBioWare hints at new SWTOR content, tops one million players originally appeared on Massively on Fri, 23 Dec 2011 19:15:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alexander-freedbiowarecontentea-biowareElectronic-Artsflashpointjames-ohlennew-contentoperationsci-fistar-wars-the-old-republicswtorthe-old-republictorFri, 23 Dec 2011 19:15:00 EST<![CDATA[RuneScape adds a new dungeon for mold time's sake]]>http://massively.joystiq.com/2011/11/28/runescape-adds-a-new-dungeon-for-mold-times-sake/http://massively.joystiq.com/2011/11/28/runescape-adds-a-new-dungeon-for-mold-times-sake/http://massively.joystiq.com/2011/11/28/runescape-adds-a-new-dungeon-for-mold-times-sake/#commentsFiled under: , , , , , ,

Slime molds.
It's not really a proper fantasy game until you've fought your way through animated fungi, right? That's the premise of the newest dungeon in RuneScape, the just-added Polypore Dungeon. Deep within the dungeon lives a solitary skinweaver who was born to be a healer, but she's turned her powers to creating animated fungi for her own amusement. With her only other companion an ancient merchant that no longer has all of his faculties, her domain isn't a prime vacation spot... unless, of course, you're a skilled adventurer looking for new items and new craftable armor.

The new dungeon can be reached north of the Duel Arena bank, with most of its contents requiring a high level in various skills. The inhabitants are non-aggressive, however, allowing any and all members to take a look at the place freely. Other updates include an improvement to the Slayer interface and the UI option to switch bloom lighting on or off, which should help improve your overall experience whether or not you decide to go mushroom hunting.

MassivelyRuneScape adds a new dungeon for mold time's sake originally appeared on Massively on Mon, 28 Nov 2011 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>craftingdungeonsf2pfree-to-playjagexnew-contentnewspatchespolypore-dungeonrunescapeupdatesMon, 28 Nov 2011 18:00:00 EST<![CDATA[New Champions Online Whiteout comic series content debuts]]>http://massively.joystiq.com/2011/11/18/new-champions-online-whiteout-comic-series-content-debuts/http://massively.joystiq.com/2011/11/18/new-champions-online-whiteout-comic-series-content-debuts/http://massively.joystiq.com/2011/11/18/new-champions-online-whiteout-comic-series-content-debuts/#commentsFiled under: , , , , , ,

Champions Online - Whiteout screenshot
Comic book geeks rejoice! Well, digital comic book geeks, that is. Champions Online has just announced the first issue of its second Comic Series content update. The new stuff is called Whiteout, and like the previous series (Aftershock), it spans multiple weekly issues that take the form of free content packs.

The Champions website says that Comic Series are designed to take you on an "exciting adventure in which you'll encounter new creatures and environments, all the while playing through an intriguing story." The new Whiteout series is accessible to players at level 11 or higher, and on top of the new narrative you'll get special issue rewards and item drops as you progress.

MassivelyNew Champions Online Whiteout comic series content debuts originally appeared on Massively on Fri, 18 Nov 2011 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>championschampions-onlinecomic-seriescontent-packscrypticcryptic-studiosf2pfree-to-playnew-contentperfect-world-entertainmentpwesuperherowhiteoutFri, 18 Nov 2011 16:30:00 EST<![CDATA[Star Trek Online dev blog talks new content, Dominion featured episode]]>http://massively.joystiq.com/2011/11/17/star-trek-online-dev-blog-talks-new-content-dominion-featured-e/http://massively.joystiq.com/2011/11/17/star-trek-online-dev-blog-talks-new-content-dominion-featured-e/http://massively.joystiq.com/2011/11/17/star-trek-online-dev-blog-talks-new-content-dominion-featured-e/#commentsFiled under: , , , , , , ,

Star Trek Online - captain's viewport
Cryptic executive producer Stephen D'Angelo has posted another Star Trek Online Path to F2P dev diary. For the 23rd installment (yes, 23!), D'Angelo outlines a near future roadmap for the game as the business model transition continues.

D'Angelo says that STO will boast a Featured Episode Replay event for the remainder of November on the live server. The first week of December should see a new game build migrating to the live shard from the Tribble test server. This update will feature "new content, new systems, and many gameplay improvements," and D'Angelo characterizes it as a "significant" release.

How significant? It includes new Borg content (the Invasion of Defera), the new duty officer system, and several new events and dailies. There's more to read at the official STO website (including an upcoming Featured Episode series focused on the Dominion!), so check it out by following the link below.

MassivelyStar Trek Online dev blog talks new content, Dominion featured episode originally appeared on Massively on Thu, 17 Nov 2011 11:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bogborgcrypticdev-blogdev-diarydominionf2pfeatured-episodefeatured-episode-replayfree-to-playnew-contentperfect-world-entertainmentpwesci-fistar-trekstar-trek-onlinestephen-dangeloThu, 17 Nov 2011 11:30:00 EST<![CDATA[Martial Empires Path to Purgatory update brings big content drop]]>http://massively.joystiq.com/2011/11/16/martial-empires-path-to-purgatory-update-brings-big-content-drop/http://massively.joystiq.com/2011/11/16/martial-empires-path-to-purgatory-update-brings-big-content-drop/http://massively.joystiq.com/2011/11/16/martial-empires-path-to-purgatory-update-brings-big-content-drop/#commentsFiled under: , , , , , , ,

Martial Empires - combat screenshot
It's patch day in Martial Empires, and gamigo has a hellish road in store for fans of the free-to-play action MMO. The Path to Purgatory update features a new survival mode challenge that pits players against hordes of monsters as they carve their way through 32 levels of a gigantic tower.

There's also a big nasty waiting at the end of the challenge, and that's only part of the package. The update also features various mounts and battle pets, guild research functionality, and a new quest series that stretches from level one through 55. gamigo is also planning a number of in-game events, according to its latest press release, and you can learn more about Martial Empires on the game's official website.

[Source: gamigo press release]

MassivelyMartial Empires Path to Purgatory update brings big content drop originally appeared on Massively on Wed, 16 Nov 2011 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dungeonseventsf2pfree-to-playgamigoin-game-eventsmartial-empiresnew-contentpatchpatchestower-dungeonWed, 16 Nov 2011 18:30:00 EST<![CDATA[EVE Online's Crucible expansion coming Nov 29th]]>http://massively.joystiq.com/2011/11/15/eve-onlines-crucible-expansion-coming-nov-29th/http://massively.joystiq.com/2011/11/15/eve-onlines-crucible-expansion-coming-nov-29th/http://massively.joystiq.com/2011/11/15/eve-onlines-crucible-expansion-coming-nov-29th/#commentsFiled under: , , , , , , ,

EVE Online - Crucible nebula background
CCP's feel-good post count has been building to a fever pitch in recent weeks, and today the company has announced the ultimate win-back promotion in the form of EVE Online's 15th major expansion. The content drop is called Crucible, and it's currently scheduled to debut on November 29th.

"Crucible evolves the graphics, interface, and game mechanics with over three dozen updated and improved features based on feedback and challenges put forth by its players. This is EVE re-forged," CCP says on the expansion's teaser page. The web portal also provides a handy collated list of the aforementioned developer updates, and in spite of what was unquestionably the rockiest summer in the sci-fi sandbox title's eight-year existence, the future is looking pretty bright.

MassivelyEVE Online's Crucible expansion coming Nov 29th originally appeared on Massively on Tue, 15 Nov 2011 14:15:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>breakingccpccp-gamescrucibleeveeve-crucibleeve-onlineexpansionexpansionsflying-in-spacenew-contentnew-edennew-shipsTue, 15 Nov 2011 14:15:00 EST<![CDATA[Runes of Magic reveals Souls of the Past trailer]]>http://massively.joystiq.com/2011/11/15/runes-of-magic-reveals-souls-of-the-past-trailer/http://massively.joystiq.com/2011/11/15/runes-of-magic-reveals-souls-of-the-past-trailer/http://massively.joystiq.com/2011/11/15/runes-of-magic-reveals-souls-of-the-past-trailer/#commentsFiled under: , , , , , , , ,

Runes of Magic - Tergothen Bay gate
Get ready, Runes of Magic fans. Frogster has unveiled a brand-spanking-new trailer for the fantasy title's upcoming Souls of the Past content patch. According to a developer post on the game's official boards, the update will go live on November 22nd and will feature a level cap increase as well as a new adventuring region.

Players will be able to advance from 67 to 70, and they'll also be able to explore Tergothen Bay, a royal coastal town near the foothills of the Redhill Mountains. The trailer is short, but it shows off a few of the big nasties awaiting players in the region's new dungeon. It also touches on the lore behind the new content, and specifically how the demon Sismond continues to manipulate the citizens of Taborea. Check it out after the break.

Continue reading Runes of Magic reveals Souls of the Past trailer

MassivelyRunes of Magic reveals Souls of the Past trailer originally appeared on Massively on Tue, 15 Nov 2011 13:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>f2pfantasyfree-to-playfrogsternew-contentpatchesredhill-mountainsrunes-of-magicsouls-of-the-pasttaboreatergothen-baytrailervideoTue, 15 Nov 2011 13:30:00 EST<![CDATA[Bounty Hounds Online closed beta featuring new content]]>http://massively.joystiq.com/2011/11/15/bounty-hounds-online-closed-beta-featuring-new-content/http://massively.joystiq.com/2011/11/15/bounty-hounds-online-closed-beta-featuring-new-content/http://massively.joystiq.com/2011/11/15/bounty-hounds-online-closed-beta-featuring-new-content/#commentsFiled under: , , , , , ,

Bounty Hounds Online - mercenary duel
Bounty Hounds Online is talking up its AAA characteristics in the latest press release from Wicked Interactive. According to the blurb, the sci-fi MMORPG "brings triple-A quality to the free-to-play genre" and allows players to choose from five different mercenary class types while directing their avatars through "multiple worlds and environments."

Beginning today, Wicked is rolling out a substantial update to the title's closed beta client. The new content includes five high-level Cambria group instances. There are also new missions and events on tap including objectives in the Wastelands that give both stat and skill point reset items. Finally, earned character titles now unlock unique stat-boost accessories, and XP requirements have been adjusted "so you'll spend less time grinding."

Sound interesting? Head to the official Bounty Hounds website to learn more.

[Source: Wicked Interactive press release]

MassivelyBounty Hounds Online closed beta featuring new content originally appeared on Massively on Tue, 15 Nov 2011 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabhobounty-houndsbounty-hounds-onlineclosed-betadungeonsf2pfree-to-playgrindgroup-dungeonsleveling-curvenew-contentnew-instancessci-fiwickedwicked-interactivexpTue, 15 Nov 2011 12:00:00 EST<![CDATA[Newest test server pass for Star Trek Online aimed at cleaning up [Updated with F2P date!]]]>http://massively.joystiq.com/2011/11/08/newest-test-server-pass-for-star-trek-online-aimed-at-cleaning-u/http://massively.joystiq.com/2011/11/08/newest-test-server-pass-for-star-trek-online-aimed-at-cleaning-u/http://massively.joystiq.com/2011/11/08/newest-test-server-pass-for-star-trek-online-aimed-at-cleaning-u/#commentsFiled under: , , , , , ,

The Borg's susceptibility to computer issues suggests that the Collective is still running on a Windows 98 tower.
Bugs and design issues are present even in the universe of Star Trek Online, ranging from irritating interface bugs on ship consoles to the apparently frequent bug that causes the holodeck to nearly kill everyone on the ship every few weeks. They also crop up in the game itself, of course, but as outlined in the latest Path to F2P blog, the development team is focusing in closely on trying to eliminate several bugs and design issues currently in the game.

Patrol missions, for instance, are being changed from a flat sequence of isolated system missions into a more freeform system that scales with level. Crafting changes are also being put in place, giving players "material blocks" to work with that are purchase via dilithium, thereby allowing fleets and groups of players to shunt crafting resources toward a single player. The entry also hints at an entirely new form of content coming to the test server over the next month, although players will have to wait to find out what that means.

[Edit: More details on the F2P switch have also surfaced, thanks to our friends at IGN.]

MassivelyNewest test server pass for Star Trek Online aimed at cleaning up [Updated with F2P date!] originally appeared on Massively on Tue, 08 Nov 2011 22:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>balance-adjustmentsbug-fixescrypticcryptic-star-trekcryptic-studiosdesign-fixesf2pfixesfree-to-playnew-contentpath-to-f2ppreviewst-onlinestar-trek-mmostar-trek-onlinestotrek-onlineupcoming-contentTue, 08 Nov 2011 22:00:00 EST<![CDATA[EverQuest's Veil of Alaris expansion slated for November 15th]]>http://massively.joystiq.com/2011/10/26/everquests-veil-of-alaris-expansion-slated-for-november-15th/http://massively.joystiq.com/2011/10/26/everquests-veil-of-alaris-expansion-slated-for-november-15th/http://massively.joystiq.com/2011/10/26/everquests-veil-of-alaris-expansion-slated-for-november-15th/#commentsFiled under: , , , ,

EverQuest - Veil of Alaris logo
EverQuest's graphics aren't the only thing dated when it comes to Norrath! Oooh, yeah, that was cold, but the good news is that we still love dear old EQ, and we'll be checking out expansion number 1,342,756 (actually, number 18) in just a couple of weeks.

We know this because Sony Online Entertainment has announced the official release date for the Veil of Alaris content update, which is November 15th. Pre-orders have already begun, and you'll want to check out the official pre-order page to see if SOE's digital carrots are enough to entice you to part with your hard-earned dollars prior to release day.

MassivelyEverQuest's Veil of Alaris expansion slated for November 15th originally appeared on Massively on Wed, 26 Oct 2011 23:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>digital-collectors-editioneqeverquestexpansionfantasynew-contentnorrathpatchpre-ordersoeSony-Online-Entertainmentveil-of-alarisWed, 26 Oct 2011 23:00:00 EST<![CDATA[New Dawntide patch due October 17th, release date announcement to follow]]>http://massively.joystiq.com/2011/10/05/new-dawntide-patch-due-october-17th-release-date-announcement-t/http://massively.joystiq.com/2011/10/05/new-dawntide-patch-due-october-17th-release-date-announcement-t/http://massively.joystiq.com/2011/10/05/new-dawntide-patch-due-october-17th-release-date-announcement-t/#commentsFiled under: , , , , ,

Dawntide - Human waiting anxiously for a new release date
Hey kids, it's a Dawntide update! Yes, really. The fantasy sandbox from Working As Intended has been quiet since delaying its planned October 1st release date, but today the devs have issued a brief blurb on the game's official website that suggests a bit of hope for the future.

As it turns out, the delayed release was the result of a funding shortage, but now WAI has secured a new source and the team has "reassembled to resume development." A new patch is due October 17th, and a new release date announcement should roll in before the end of the month. WAI also takes a moment to tip its collective cap to Dawntide's hearty faithful. "Thanks for sticking with us through the rough times, and we still intend to release the best sandbox MMO out there," the site says.

[Thanks to Halldorr for the tip!]

MassivelyNew Dawntide patch due October 17th, release date announcement to follow originally appeared on Massively on Wed, 05 Oct 2011 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dawntidefantasynew-contentnew-patchpatchrelease-daterelease-date-announcementrelease-delaysandboxupdatewaiworking-as-intendedWed, 05 Oct 2011 16:00:00 EST<![CDATA[Fans unearth new Forsaken World patch details]]>http://massively.joystiq.com/2011/10/05/fans-unearth-new-forsaken-world-patch-details/http://massively.joystiq.com/2011/10/05/fans-unearth-new-forsaken-world-patch-details/http://massively.joystiq.com/2011/10/05/fans-unearth-new-forsaken-world-patch-details/#commentsFiled under: , , , , , ,

Forsaken World - skimpy armor girl
If you're a Forsaken World fan, you might be interested to know that Perfect World Entertainment has announced plans for the game's next content update. According to MMO Crunch, it's unclear whether the Storms of War patch is a full-blown expansion or a smaller-scale update. Either way, there's new stuff coming.

Some enterprising Forsaken World forum-dwellers have pieced together what they believe to be a feature list for the new content drop, but since Perfect World's Asian-market releases are normally months ahead of the American and European clients, none of the info has been confirmed.

Highlights of the feature list include memory fruit XP buffs, town teleport abilities, tweaks to dungeon difficulty and arena PvP systems, and a lot more.

MassivelyFans unearth new Forsaken World patch details originally appeared on Massively on Wed, 05 Oct 2011 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>content-updatef2pfantasyforsaken-worldfree-to-playnew-contentpatchpatchesperfect-world-entertainmentpwespeculationstorms-of-warupdateWed, 05 Oct 2011 14:00:00 EST<![CDATA[DCUO's latest update takes you to the Fortress of Solitude]]>http://massively.joystiq.com/2011/10/04/dcuos-latest-update-takes-you-to-the-fortress-of-solitude/http://massively.joystiq.com/2011/10/04/dcuos-latest-update-takes-you-to-the-fortress-of-solitude/http://massively.joystiq.com/2011/10/04/dcuos-latest-update-takes-you-to-the-fortress-of-solitude/#commentsFiled under: , , , , , , ,

DC Universe Online - Superman and the fortress
We still don't have a date for you with regard to DC Universe Online's impending payment model switcheroo. We do have the latest Sony Online Entertainment press release, though, and it's full of details about the superhero MMO's latest content patch.

Listen up, Superman fans, as today's patch brings about the second phase of a three-part raid in which players must stop Brainiac from harnessing Kryptonian technology and using it to destroy the entire planet. The update, appropriately titled The Fate of the Fortress, features Superman's iconic arctic hideout known as the Fortress of Solitude, and the patch allows would-be heroes to team up with Kal-El, Lex Luthor, and their fellow players to tackle a challenging eight-man group combat raid.

There's a bunch of new loot to be had as well, and today's update also features a new hard-mode option for the HIVE tier-two alert as well as a new Batcave PvP map. Finally, SOE has incorporated a new dueling mechanic into DCUO, so fire up your launchpads, button up your underoos, and get ready to save Gotham City and Metropolis from the clutches of the megalomaniacal Brainiac.

[Source: SOE press release]

MassivelyDCUO's latest update takes you to the Fortress of Solitude originally appeared on Massively on Tue, 04 Oct 2011 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>brainiacdc-comicsdc-universedc-universe-onlinedcuofate-of-the-fortressfortress-of-solitudegame-update-5gotham-citygu-5hive-hard-modelex-luthormetropolisnew-contentnew-raidpress-releasesoeSony-Online-Entertainmentsuperherosupermanthe-fate-of-the-fortressTue, 04 Oct 2011 14:00:00 EST<![CDATA[Final Fantasy XIV releases notes for patch 1.19]]>http://massively.joystiq.com/2011/09/30/final-fantasy-xiv-releases-notes-for-patch-1-19/http://massively.joystiq.com/2011/09/30/final-fantasy-xiv-releases-notes-for-patch-1-19/http://massively.joystiq.com/2011/09/30/final-fantasy-xiv-releases-notes-for-patch-1-19/#commentsFiled under: , , , , , ,

Magma axes - for when chopping things up without burning them at the same time just feels too wussy.
It's going to take another few days before Final Fantasy XIV drops the enormous patch 1.19 onto the live servers, but the patch notes have already been released. And most players will likely agree upon glancing at the extensive list of updates that the patch is well worth the wait. Several portions of the update have already been previewed, ranging from the crafting changes to the battle mechanic updates, but there's also a long list of improvements, additions, and other elements to look forward to.

More details are available regarding the many additions to the Grand Company system, including Company leves, new quests, and the details for obtaining a Company chocobo along with obtaining membership. There's also a listing of new items available, a rundown of the new materia system, and a variety of updates and improvements to stats, mechanics, and abilities. The patch is planned for release on Tuesday, October 4th, a date that the game's players will likely be awaiting with bated breath.

MassivelyFinal Fantasy XIV releases notes for patch 1.19 originally appeared on Massively on Fri, 30 Sep 2011 19:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>endgameffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivgame-mechanicsgrand-companiesguildleveslevequestslevesmechanicsnew-contentnewspatch-notespatchessquaresquare-enixupdatesFri, 30 Sep 2011 19:30:00 EST<![CDATA[Age of Conan dev update outlines a year's worth of content]]>http://massively.joystiq.com/2011/09/30/age-of-conan-dev-update-outlines-a-years-worth-of-content/http://massively.joystiq.com/2011/09/30/age-of-conan-dev-update-outlines-a-years-worth-of-content/http://massively.joystiq.com/2011/09/30/age-of-conan-dev-update-outlines-a-years-worth-of-content/#commentsFiled under: , , , , , , , , ,

Age of Conan - concept art
Age of Conan's latest monthly development update is hot off the presses, and it's kind of a doozy. Funcom game director Craig "Silirrion" Morrison takes the gloves off and lists five major updates coming to AoC over the next year -- and he also offers a few disclaimers in terms of schedule changes and dates. As far as content goes, fans can look forward to new Turan boss encounters, the House of Crom dungeon, tier four raids, and a major Dreamworld/quality-of-life update prior to the end of the year.

Moving into 2012, Age of Conan will be adding a new multi-feat specification system (apparently the feature was a landslide winner in the recent summer survey). The devs will also be giving Priest archetypes some "care and attention" as well as implementing the single-server tech that will allow for cross-server minigames and "all manner of cool things." There will also be new variants on The Breach, The Forgotten City, and Dead Man's Hand dungeons, all balanced for high-level characters.

Finally, the second quarter of 2012 is the tentative launch date for AoC's latest adventure pack as well as the tradeskill revamp. There's more too, so head to the official website to check it out.

MassivelyAge of Conan dev update outlines a year's worth of content originally appeared on Massively on Fri, 30 Sep 2011 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>adventure-package-of-conanaoccraftingcrafting-revampcraig-morrisoncross-server-minigamesdev-diarydev-updatedreamworlddungeonsf2pfantasyfeatsfree-to-playfuncomhouse-of-cromkhitai-raidsmonthly-development-updatemulti-feat-specializationnew-contentsilirrionsingle-server-technologytier-four-raidsFri, 30 Sep 2011 11:00:00 EST<![CDATA[Caravan security missions marching to Final Fantasy XIV]]>http://massively.joystiq.com/2011/09/15/caravan-security-missions-marching-to-final-fantasy-xiv/http://massively.joystiq.com/2011/09/15/caravan-security-missions-marching-to-final-fantasy-xiv/http://massively.joystiq.com/2011/09/15/caravan-security-missions-marching-to-final-fantasy-xiv/#commentsFiled under: , , , , ,

We've got a great big convoy rolling through the night, we've got a great big convoy, ain't she a beautiful sight? Come on and join our convoy, ain't nothing gonna get in our way, we'll ride this rocking convoy for seals all through the day. CONVOY!
The list of features being added to Final Fantasy XIV in patch 1.19 just keeps growing. Not only will players be able to ride on the back of a chocobo, but a new set of missions for caravan defense will let players beat marauding fiends away from those selfsame yellow birds. And there are even Grand Company seals to be obtained in the exchange, which just sweetens the deal for players investing time and effort into the system.

Each of the Grand Companies will have a different caravan to protect and will enlist the aid of full members in ensuring the caravan's safety during its march from an aetheryte camp to one of the nearby hamlets. Monsters will attack the caravan in turn, sometimes driving off birds and sometimes outright damaging the cargo, and it will be up to players to feed, calm, and protect the chocobos laden with supplies. Once the caravan arrives at its destination, players will receive seals based on how much cargo actually made it to its objective -- a chance to earn more currency and get some nice experience out of the event.

MassivelyCaravan security missions marching to Final Fantasy XIV originally appeared on Massively on Thu, 15 Sep 2011 19:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>caravan-defensecaravan-securitychocobosdefenseffff14ffxivffxiv-patch-1.19final-fantasyfinal-fantasy-14final-fantasy-xivmission-typesmissionsnew-contentnew-missionsnewssquaresquare-enixThu, 15 Sep 2011 19:30:00 EST<![CDATA[Wargaming.net publishes World of Tanks development plan]]>http://massively.joystiq.com/2011/09/12/wargaming-net-publishes-world-of-tanks-development-plan/http://massively.joystiq.com/2011/09/12/wargaming-net-publishes-world-of-tanks-development-plan/http://massively.joystiq.com/2011/09/12/wargaming-net-publishes-world-of-tanks-development-plan/#commentsFiled under: , , , , , , , , ,

World of Tanks - screenshot
Wargaming.net has gifted World of Tanks fans with a development roadmap for the World War II-based action MMO, and a visit to the game's official website will give you a preview of what's coming down the pike over the next year.

The post lays out quite a bit of information, most of it marked with vague release windows like Q3 2012 and so on. There's the standard "dates are subject to change" disclaimer, but it's nonetheless interesting to see what looks to be a fairly complete development schedule. What are the highlights? Well, more tank models, of course, followed by new game types including historical battle, escort, garage battle, assault, and company battle modes.

There's also an expansion of the clan wars map in the works, as well as new customization options, vehicle physics, and more.

[Thanks to Greg for the tip!]

MassivelyWargaming.net publishes World of Tanks development plan originally appeared on Massively on Mon, 12 Sep 2011 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>assaultcompany-battle-divisionscustomizationdev-plandev-roadmapdevelopment-roadmapescortf2pfree-to-playgarage-battlehistorical-battlenew-contentnew-game-modesnew-tankstankswargaming.networld-of-tanksworld-war-2world-war-iiwotww2wwiMon, 12 Sep 2011 10:00:00 EST<![CDATA[The Anvil of Crom: Evaluating the dev update - crafting edition]]>http://massively.joystiq.com/2011/09/11/the-anvil-of-crom-evaluating-the-dev-update-crafting-edition/http://massively.joystiq.com/2011/09/11/the-anvil-of-crom-evaluating-the-dev-update-crafting-edition/http://massively.joystiq.com/2011/09/11/the-anvil-of-crom-evaluating-the-dev-update-crafting-edition/#commentsFiled under: , , , , , ,

Anvil of Crom - banner
Hallelujah, amen, and by frickin' Crom! What's got me all excitable this week? Well, the latest dev update, for starters, and I apologize in advance for reneging on last week's promise to devote today's column to a deeper examination of the new Savage Coast of Turan content. The last time we met, I gave you a quick rundown on the Ardashir Coast, but with all due respect to Funcom's content designers, the most interesting bit of Age of Conan news from the last little while is the crafting revamp that Silirrion hinted at in the August 31st update letter.

But Jef, how interesting could it be if it's taken you over a week to write about it? Well, you got me there, and I could throw in some excuses about needing to get something Turan-related out last week, as well as the fact that I was doing the DragonCon shuffle, but I won't.

Anyhow, holy shitaki mushrooms! Funcom mentioned AoC's tradeskills! Join me after the cut and bring the smelling salts.

Continue reading The Anvil of Crom: Evaluating the dev update - crafting edition

MassivelyThe Anvil of Crom: Evaluating the dev update - crafting edition originally appeared on Massively on Sun, 11 Sep 2011 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>age-of-craftinganvil-of-cromcraftingcrafting-revampcraig-morrisondev-diarydev-updatef2pfantasyfeaturedfree-to-playhouse-of-cromhyboriamonthly-dev-updatemonthly-development-updatemonthly-updatenew-contentnon-combat-gameplaysilirrionsingle-serversthe-anvil-of-cromtradeskill-revamptradeskillswelfare-epicsSun, 11 Sep 2011 12:00:00 EST