Massively http://massively.joystiq.com Massively http://www.blogsmithmedia.com/http://massively.joystiq.com/media/feedlogo.gif Massively http://massively.joystiq.com en-us Copyright 2013 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[Quickdraw added to MechWarrior Online's hangar]]>http://massively.joystiq.com/2013/06/18/quickdraw-added-to-mechwarrior-onlines-hangar/http://massively.joystiq.com/2013/06/18/quickdraw-added-to-mechwarrior-onlines-hangar/http://massively.joystiq.com/2013/06/18/quickdraw-added-to-mechwarrior-onlines-hangar/#commentsFiled under: , , , , ,

Just like me, they long to be close to you. They probably don't want to laser you to death afterwards, though.
It can be hard to get close to someone. Especially in MechWarrior Online, where the people you want to get close to are riding walking battle tanks designed to vaporize you at long range. But the newly added Quickdraw is all about getting in close, at which point it can unleash the full might of its short-range missile launchers and medium lasers. Which is probably why people don't want to get close to one another in the first place, really.

Fortunately for Quickdraw pilots, the machine is quick, jump-capable, and generally very able to get in close and unleash its payload. This new 'Mech is available in three variants alongside the new Champion Hunchback, and you can take a look at the precise loadouts in the patch notes. Or you can take a gander at the preview video for the machine embedded just past the cut.

[Source: Piranha Games press release]

Continue reading Quickdraw added to MechWarrior Online's hangar

MassivelyQuickdraw added to MechWarrior Online's hangar originally appeared on Massively on Tue, 18 Jun 2013 19:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>f2pfree-to-playmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwonew-mechpatchpatchespiranhapiranha-gamesquickdrawsci-fivideovideosTue, 18 Jun 2013 19:30:00 EST<![CDATA[MechWarrior Online brings out the Firebrand]]>http://massively.joystiq.com/2013/06/04/mechwarrior-online-brings-out-the-firebrand/http://massively.joystiq.com/2013/06/04/mechwarrior-online-brings-out-the-firebrand/http://massively.joystiq.com/2013/06/04/mechwarrior-online-brings-out-the-firebrand/#commentsFiled under: , , , , , ,

MechWarrior Online brings out the Firebrand
MechWarrior Online's latest update is burning up the charts (or really anything else it comes in contact with), as the game has introduced the Firebrand version of the JagerMech for players to try out. This new hero 'mech is all about dual weapons and long-range damage. It's also water-resistant -- or at least we assume from the video.

This patch includes several other little odds and ends, including a World War 2-themed Sherman tank pattern for 'mechs that want to hunker down and pretend that they're a totally innocent hill. Players also have an even larger library of trial 'mechs to test, including the Spider, Hunchback, and Atlas.

You can watch the Firebrand trailer after the jump!

Continue reading MechWarrior Online brings out the Firebrand

MassivelyMechWarrior Online brings out the Firebrand originally appeared on Massively on Tue, 04 Jun 2013 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>f2pfirebrandfree-to-playmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopatchpiranhapiranha-gamessci-fitrailerupdatevideoTue, 04 Jun 2013 16:30:00 EST<![CDATA[MechWarrior Online introduces new map in which players can die painfully]]>http://massively.joystiq.com/2013/05/21/mechwarrior-online-introduces-new-map-in-which-players-can-die-p/http://massively.joystiq.com/2013/05/21/mechwarrior-online-introduces-new-map-in-which-players-can-die-p/http://massively.joystiq.com/2013/05/21/mechwarrior-online-introduces-new-map-in-which-players-can-die-p/#commentsFiled under: , , , , , ,

MechWarrior Online introduces new map with allnew ways to die
MechWarrior Online's newest map, the Canyon Network, is riddled with slot canyons, steep drops, and high plateaus. As part of MWO's latest update, the Canyon Network is meant to provide a playground for snipers and strategic thinkers.

The Blackjack has been named as the new Mech of the Month, with the Jenner donning the mantle of Champion Mech. As part of the content update, new cobra camo patterns and faction cockpit medallions have been added to the store.

Skip below the cut to check out videos of the new Canyon Network and the Blackjack in action.

[Source: MWO press release]

Continue reading MechWarrior Online introduces new map in which players can die painfully

MassivelyMechWarrior Online introduces new map in which players can die painfully originally appeared on Massively on Tue, 21 May 2013 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>blackjackcanyon-networkf2pfree-to-playjennermechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopiranhapiranha-gamessci-fivideovideosTue, 21 May 2013 17:00:00 EST<![CDATA[The Stream Team: MLT edition, May 13 - 19, 2013]]>http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/#commentsFiled under: , , ,

The Stream Team May 13 19, 2013
Nothing beats an MLT, especially when the tomato is nice and ripe! Except maybe Massively TV. MMmm mmmm. Now there's something you can really sink your teeth into -- the wild and crazy antics of your favorite Stream Team hosts! And they've got a menu for all tastes this week, from space adventures to dragons to WWII planes. Of course, it all comes with a side of reruns and a dessert highlight to complete your meal.

So pull up a chair and grab yourself a helping or two... or 10. Hey, there's no limit here; enjoy as much as you like! While you're enjoying the spread, be sure to join in the after-dinner chat in Outtakes.

Continue reading The Stream Team: MLT edition, May 13 - 19, 2013

MassivelyThe Stream Team: MLT edition, May 13 - 19, 2013 originally appeared on Massively on Mon, 13 May 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmoactivisionage-of-conanage-of-conan-unchainedagonanetaocaoc-unchainedarenanetarkark-hunterarkfallaventurinebiowareblizzardblizzard-entertainmentbuy-to-playccpccp-gamescity-of-steamconanconsoleconsolescrypticcryptic-studiosdarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodefiancedfdnddota-2Dragonrealmseaelectronic-artselswordeq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfree-to-playfuncomgoblinguild-warsgwhi-rezhi-rez-studioshistoricalhorrorhyboriainternet-spaceshipslivestreamlivestreaminglivestreamslucasartsmabinogimassively-metamassively-tvmechmechanistmechanist-gamesmechsmechwarriormechwarrior-mmomechwarrior-onlinemetammo-shootermobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmwomythologyncsoftneverwinternexonnexon-americaopen-pvpperfect-worldperfect-world-entertainmentpiranhapiranha-gamesplaneplanesplaystation-3playstation3pollps3pvppwesandboxsci-fantasysci-fisecret-worldshooterskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicsteampunkstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorsyfythe-old-republicthe-secret-worldthe-stream-teamthird-person-shootertortpstransmedia-synergytriontrion-worldstswtvtwitchtwitch-tvunchainedunholy-warswarwarcraftwargaming.netwarplanewarplanesworld-of-warcraftworld-of-warplaneswowwowpxboxMon, 13 May 2013 09:00:00 EST<![CDATA[MechWarrior Online introduces the Misery with Update 15]]>http://massively.joystiq.com/2013/05/07/mechwarrior-online-introduces-the-misery-with-update-15/http://massively.joystiq.com/2013/05/07/mechwarrior-online-introduces-the-misery-with-update-15/http://massively.joystiq.com/2013/05/07/mechwarrior-online-introduces-the-misery-with-update-15/#commentsFiled under: , , , , ,

MechWarrior Online introduces Misery, a 'mech with 'tude
Misery loves company, they say (look it up), but will people actually go seeking it? Piranha Games hopes players will, as it has introduced the Misery 85-ton 'mech into MechWarrior Online. The metal beast has an armament that includes plenty of lasers, a Gauss rifle, and an SRM-6 (again, look it up).

The new update goes beyond the debut of the Misery. There are four additional trial 'mechs to test out, color customization for Hero 'mechs, and a crazy Buccaneer premium pattern.

Read up on our preview of Update 15 and don't miss out on the video showing off the Misery in action after the jump!

Continue reading MechWarrior Online introduces the Misery with Update 15

MassivelyMechWarrior Online introduces the Misery with Update 15 originally appeared on Massively on Tue, 07 May 2013 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>f2pfree-to-playhero-mechmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemiserymwopiranhapiranha-gamessci-fiupdate-15videoTue, 07 May 2013 15:30:00 EST<![CDATA[The Stream Team: Seis de Mayo edition, May 6 - 12, 2013]]>http://massively.joystiq.com/2013/05/06/the-stream-team-seis-de-mayo-edition-may-6-12-2013/http://massively.joystiq.com/2013/05/06/the-stream-team-seis-de-mayo-edition-may-6-12-2013/http://massively.joystiq.com/2013/05/06/the-stream-team-seis-de-mayo-edition-may-6-12-2013/#commentsFiled under: , , ,

The Stream Team Seis de Mayo edition, May 6 12, 2013
You have to agree, May is one month that's full of holidays. The first week alone contains May Day, (unofficial) Star Wars Day, and Cinco de Mayo. But the party doesn't stop there! Following quickly on the heels of these is perhaps one you are less familiar with: Seis de Mayo.

Not unlike its cousin the day before, Seis de Mayo is a day of celebration; however, this celebration centers on freedom from boredom via visual entertainment. No, really! And to commemorate the day, we're releasing an all-new Massively TV schedule, giving you the means to celebrate the whole week through with The Stream Team. If you can't celebrate live, just tune into a rerun and party whenever.

Well, even if you don't believe us, you can still commemorate the occasion with us. Just check out the past the cut for a heaping helping of daily festivities.

Continue reading The Stream Team: Seis de Mayo edition, May 6 - 12, 2013

MassivelyThe Stream Team: Seis de Mayo edition, May 6 - 12, 2013 originally appeared on Massively on Mon, 06 May 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmoactivisionage-of-conanage-of-conan-unchainedagonaionanetaocaoc-unchainedarenanetarkark-hunterarkfallascensionaventurinebiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamesclone-warsclone-wars-adventuresconanconsoleconsolescrypticcryptic-studioscwadarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodefiancedfdnddota-2dragondragonsdragons-propheteaelectronic-artseq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfamilyfantasyfeaturedfpsfree-to-playfuncomguild-warsguild-wars-2gwgw2heroes-and-generalshi-rezhi-rez-studioshousinghyboriainfernuminfernum-productionsinternet-spaceshipskid-friendlykidskids-mmokingsislekingsisle-entertainmentlivestreamlivestreaminglivestreamslobbylucasartsmabinogimassively-metamassively-tvmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemetaminigamemmo-shootermmofpsmobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmwoncsoftneverwinternexonnexon-americaopen-pvpperfect-worldperfect-world-entertainmentpiranhapiranha-gamesplanetsideplanetside-2playstation-3playstation3pollps2ps3pvppwerunewakerrunewaker-entertainmentsandboxsci-fantasysci-fishooterSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsuperherosuperheroesswtorsyfythe-old-republicthe-stream-teamthird-person-shootertorTorchlight-2torchlight-iitpstransmedia-synergytriontrion-worldstruly-freetvtwitchtwitch-tvunchainedunholy-warswarcraftwarmage-battlegroundswizard101world-of-warcraftwowxboxMon, 06 May 2013 09:00:00 EST<![CDATA[MechWarrior Online devs talk Update 15, new UI, new mechs]]>http://massively.joystiq.com/2013/04/16/mechwarrior-online-devs-talk-update-15-new-ui-new-mechs/http://massively.joystiq.com/2013/04/16/mechwarrior-online-devs-talk-update-15-new-ui-new-mechs/http://massively.joystiq.com/2013/04/16/mechwarrior-online-devs-talk-update-15-new-ui-new-mechs/#commentsFiled under: , , , , , , , , , ,

MechWarrior Online screenshot
Mechwarrior Online is about to hit its fifth month of open beta, with promises of a late summer launch. With that launch comes continued production, new content, plenty of bug fixes, and tweaks. With all of the new content -- said to be delivered on a regular schedule -- comes plenty of challenges for the developer team.

We sat down with Piranha Games' creative director, Bryan Ekman, and president, Russ Bullock, to talk about how things have been going and where they're going in the future. Not only did we get the scoop on the next community-designed Mech to be released, but we also found out about new HUD improvements, aid for players who suffer from high ping, and much more. Click past the cut for all the details!

Continue reading MechWarrior Online devs talk Update 15, new UI, new mechs

MassivelyMechWarrior Online devs talk Update 15, new UI, new mechs originally appeared on Massively on Tue, 16 Apr 2013 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>beau-hindmanbryan-ekmanf2pfeaturedfree-to-playinterviewinterviewsmechmechsMechWarriormechwarrior-mmomechwarrior-onlinemwopiranhapiranha-gamespreviewpreviewsruss-bullocksci-fiTue, 16 Apr 2013 13:00:00 EST<![CDATA[Look forward to MechWarrior Online updates through April]]>http://massively.joystiq.com/2013/04/03/look-forward-to-mechwarrior-online-updates-through-april/http://massively.joystiq.com/2013/04/03/look-forward-to-mechwarrior-online-updates-through-april/http://massively.joystiq.com/2013/04/03/look-forward-to-mechwarrior-online-updates-through-april/#commentsFiled under: , , , , , , ,

Still no option to outfit your machine with spinners, sadly.
If you thought that April would bring an overhaul of MechWarrior Online that turned the game into a robust farming simulator... well, no. Why would you even think that? But it will bring a whole lot of other updates to the game as outlined in a new letter from the game's creative director, starting with improved team functionality and UI improvements. That goes along nicely with the addition of air strike and artillery consumables, allowing players (especially scouts) to bring down a little extra firepower in a match.

The development team is also introducing a new class of special 'Mech, the Champions, which are custom configurations that sport a permanent 5% experience boost. That's in addition to improvements to the game's overall performance and more community events for MechWarrior Online players the world over. So that's a no on farming, but a yes on several improvements that should make your days of stomping around in an enormous walking tank more enjoyable.

MassivelyLook forward to MechWarrior Online updates through April originally appeared on Massively on Wed, 03 Apr 2013 19:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>consumablesf2pfree-to-playgame-mechanicsgroup-mechanicsmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopatchespiranhapiranha-gamesquality-of-lifesci-fiuiupcoming-improvementsupcoming-patchesuser-interfaceWed, 03 Apr 2013 19:30:00 EST<![CDATA[PAX East 2013: Say hello to MechWarrior Online's new trailer]]>http://massively.joystiq.com/2013/03/22/pax-east-2013-say-hello-to-mechwarrior-onlines-new-trailer/http://massively.joystiq.com/2013/03/22/pax-east-2013-say-hello-to-mechwarrior-onlines-new-trailer/http://massively.joystiq.com/2013/03/22/pax-east-2013-say-hello-to-mechwarrior-onlines-new-trailer/#commentsFiled under: , , , , , , ,

Say hello to Mechwarrior Online's new trailer
There's nothing quite like convention season for bringing out a bumper crop of new videos and trailers. Today we're bringing you MechWarrior Online's new PAX East 2013 trailer, which shows off some new gameplay and highlights the title's newest features and perks.

MechWarrior Online went into open beta late in 2012 and has had six major content patches since then. New testing grounds, cockpit items and consumables, a whole passel of UI and user control updates, and new 'mechs and maps have been added to the game since the open beta launch. March will also see several in-game events going on, which folks are invited to sign up to enjoy.

Skip below the cut to check out the newest trailer.

Continue reading PAX East 2013: Say hello to MechWarrior Online's new trailer

MassivelyPAX East 2013: Say hello to MechWarrior Online's new trailer originally appeared on Massively on Fri, 22 Mar 2013 08:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>conconventioneventevent-coverageeventsexpof2pfree-to-playmassively-event-coveragemechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopaxpax-2013pax-eastpax-east-2013penny-arcade-expopiranhapiranha-gamessci-fitrailertrailersvideovideosFri, 22 Mar 2013 08:00:00 EST<![CDATA[MechWarrior Online adds Jagermech, Tourmaline Desert map]]>http://massively.joystiq.com/2013/03/20/mechwarrior-online-adds-jagermech-tourmaline-desert-map/http://massively.joystiq.com/2013/03/20/mechwarrior-online-adds-jagermech-tourmaline-desert-map/http://massively.joystiq.com/2013/03/20/mechwarrior-online-adds-jagermech-tourmaline-desert-map/#commentsFiled under: , , , ,

MechWarrior Online adds Jagermech, Tourmaline Desert map
MechWarrior Online's March patch has dropped, and with it came a few tons of new hardware and an inhospitable map with which to play around.

The new 'Mech is the heavy Jagermech, a stout piece of machinery with impressive statistics. Whether or not you pick up the Jagermech, Piranha Games has added a ton of new options for all pilots, including gas pedals, better joystick controls, a new consumables system, and more cosmetics for the cockpit.

The new map is the Tourmaline Desert, an arid map that's mostly rock, giant crystals, and abandoned BattleMechs. Heat management and possible sniper attacks are two of the biggest challenges that this map presents for players.

MassivelyMechWarrior Online adds Jagermech, Tourmaline Desert map originally appeared on Massively on Wed, 20 Mar 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>f2pfree-to-playjagermechmarch-patchmarch-updatemechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopatchpatch-notespiranhapiranha-gamessci-fiTourmaline-Desertupdateupdate-notesWed, 20 Mar 2013 15:00:00 EST<![CDATA[200-player Fields of War mech title looking for Greenlight support]]>http://massively.joystiq.com/2013/03/07/200-player-fields-of-war-mech-title-looking-for-greenlight-suppo/http://massively.joystiq.com/2013/03/07/200-player-fields-of-war-mech-title-looking-for-greenlight-suppo/http://massively.joystiq.com/2013/03/07/200-player-fields-of-war-mech-title-looking-for-greenlight-suppo/#commentsFiled under: , , , , , ,

Fields of War mech fight
Do you feel like mech-based games are criminally under-represented in the MMO space? Would you like to see "PlanetSide with mechs," as one of our tipsters referred to Fields of War? If you answered yes to either of these questions, you should probably check out the game's Steam Greenlight page as well as the alpha gameplay clip after the cut.

Fields of War is aiming for an action-MMO feel with support for 200 simultaneous players, class-based advancement, and more.

[Thanks George!]

Continue reading 200-player Fields of War mech title looking for Greenlight support

Massively200-player Fields of War mech title looking for Greenlight support originally appeared on Massively on Thu, 07 Mar 2013 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alphafields-of-warfields-of-war-videomechmech-combatsci-fishooterthermal-erosiontrailervideoThu, 07 Mar 2013 12:00:00 EST<![CDATA[Mechwarrior Online has big plans for March]]>http://massively.joystiq.com/2013/03/04/mwo-has-big-plans-for-march/http://massively.joystiq.com/2013/03/04/mwo-has-big-plans-for-march/http://massively.joystiq.com/2013/03/04/mwo-has-big-plans-for-march/#commentsFiled under: , , , , , , ,

MWO has big plans for March
March is upon us! March has actually been upon us for a handful of days, but those days were lame. Now is the time of awesome days, and those days will be full of updates and new features for MechWarrior Online. Creative Director Bryan Ekman has laid out the team's plan for the coming month.

Training grounds, an offline game mode that loads a player into a random map with eight enemy targets to test out their current 'Mech, will be made available. This game mode is "just the beginning" of an incoming wealth of training options. Consumables will extend the module system and will be available for C-Bill and MC purchase. A host of UI, user controls, and statistics-tracking improvements are coming in, as is Tourmaline Desert, MWO's largest map to date.

The ability to acquire fuzzy dice for one's cockpit has been hinted at. You know what to do, soldiers.

MassivelyMechwarrior Online has big plans for March originally appeared on Massively on Mon, 04 Mar 2013 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bryan-ekmandev-diaryf2pfree-to-playmarchmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopiranhapiranha-gamessci-fiupdateupdatesMon, 04 Mar 2013 19:00:00 EST<![CDATA[MechWarrior opens up a big map and a medium 'Mech]]>http://massively.joystiq.com/2013/02/19/mechwarrior-opens-up-a-big-map-and-a-medium-mech/http://massively.joystiq.com/2013/02/19/mechwarrior-opens-up-a-big-map-and-a-medium-mech/http://massively.joystiq.com/2013/02/19/mechwarrior-opens-up-a-big-map-and-a-medium-mech/#commentsFiled under: , , , , , ,

The Berkshires, 2/9/13
In the destructive world of MechWarrior Online, every 'Mech has its niche. Some machines thrive on maps with tight corridors and small boundaries, allowing them to get up close and personal. Others live on the ability to reach out and touch their targets at extreme ranges, preferably with missiles. It's the latter type that will enjoy the game's newest map, Alpine Peaks, which is the largest map yet added to the game. As the zone is filled with snowy vistas and sniping points, close-range machines will fare poorly here, but anything with good ranged capacity will find a lot to love.

Not coincidentally, the most recent update also adds a new 'Mech for pilots, the Trebuchet. Available in five variants, this 50-ton machine features twin LRM-15s in all but one variant, allowing players to pack quite a punch at range. It's the perfect sort of 'Mech for tromping around in a snowy environment and spreading damage over a large range, so we can imagine it'll see some use on the new map.

[Source: Piranha Games press release]

MassivelyMechWarrior opens up a big map and a medium 'Mech originally appeared on Massively on Tue, 19 Feb 2013 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>additionsf2pfree-to-playlarge-maplong-range-mechmapmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemedium-mechmwonew-mapnew-mechnewspatchpatchespiranhapiranha-gamessci-fiTue, 19 Feb 2013 19:00:00 EST<![CDATA[MechWarrior Online shows off its pretty new baby]]>http://massively.joystiq.com/2013/02/05/mechwarrior-online-shows-off-its-pretty-new-baby/http://massively.joystiq.com/2013/02/05/mechwarrior-online-shows-off-its-pretty-new-baby/http://massively.joystiq.com/2013/02/05/mechwarrior-online-shows-off-its-pretty-new-baby/#commentsFiled under: , , , , , , , ,

It's not very pretty after all.
Would you call your multi-ton death machine a pretty baby? If you're playing MechWarrior Online you just might, especially since that's the name of the newest hero 'Mech introduced to the game. Considering the machine is loaded with an LRM 15, a PPC, two lasers, and a high top speed for a 80-ton 'Mech, we can see why you might coo affectionately that it's your pretty little darling yes it is.

But maybe your existing 'Mech is already the apple of your eye. That's all right, there's still plenty to like in February. The team at Piranha Games is working on a UI overhaul for the MechLab to allow players a clearer picture of what happens when upgrades are slotted in. There's also the third phase of matchmaking, new patterns for decorating your machine of choice, and performance improvements for all computers. But if you're still excited at the thought of a pretty new machine to pilot, you can check out a trailer for the prettiest of all babies past the cut.

[Source: Piranha Games press release]

Continue reading MechWarrior Online shows off its pretty new baby

MassivelyMechWarrior Online shows off its pretty new baby originally appeared on Massively on Tue, 05 Feb 2013 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>coming-patchesdecorationf2pfree-to-playmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwonew-mechpatchespiranhapiranha-gamespreviewssci-fitrailertrailersuiupcoming-patchesuser-interfacevideovideosTue, 05 Feb 2013 18:30:00 EST<![CDATA[Massively Interview: Piranha Games' Russ Bullock talks MechWarrior Online]]>http://massively.joystiq.com/2013/01/23/massively-interview-piranha-games-russ-bullock-talks-mechwarri/http://massively.joystiq.com/2013/01/23/massively-interview-piranha-games-russ-bullock-talks-mechwarri/http://massively.joystiq.com/2013/01/23/massively-interview-piranha-games-russ-bullock-talks-mechwarri/#commentsFiled under: , , , , , ,

Death's Knell
Is there anything more fun than massive suits of mechanical armor smashing into one another and firing lasers all over the place? MechWarrior Online, the free-to-play MMO-like set in the MechWarrior universe and developed by Piranha Games, would argue that the answer to that question is pretty obvious.

Piranha has just today announced the addition of a new Command Hero Mech, christened Death's Knell. The mech is tiny by MechWarrior standards, weighing in at only 25 tons, but it packs four powerful lasers on each arm and is quite fast to boot. Piranha also confirmed the addition of the familiar Bitching Betty startup sequence, which should give longtime MechWarrior fans a jolt of nostalgia straight through the eardrums.

We sat down with Russ Bullock, president of Piranha Games, to talk mechs, MMOs, and the future of MechWarrior Online. Check out the full interview and a video of Death's Knell in action after the break.

Continue reading Massively Interview: Piranha Games' Russ Bullock talks MechWarrior Online

MassivelyMassively Interview: Piranha Games' Russ Bullock talks MechWarrior Online originally appeared on Massively on Wed, 23 Jan 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>f2pfeaturedfree-to-playfreemiuminterviewinterviewsmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemicrotransactionmicrotransactionsmwopiranhapiranha-gamespremiumsci-fitrailertrailersvideovideosWed, 23 Jan 2013 15:00:00 EST<![CDATA[MechWarrior Online creeps you out with the new Spider mech]]>http://massively.joystiq.com/2013/01/15/mechwarrior-online-creeps-you-out-with-the-new-spider-mech/http://massively.joystiq.com/2013/01/15/mechwarrior-online-creeps-you-out-with-the-new-spider-mech/http://massively.joystiq.com/2013/01/15/mechwarrior-online-creeps-you-out-with-the-new-spider-mech/#commentsFiled under: , , ,

Mechwarrior Online creeps you out with the new Spider mech
OK, so MechWarrior Online's new Spider mech may not look particularly creepy in screenshots, but when you see it in action, you may have a flare up of the old arachnophobia. The Spider is "one of the most maneuverable and agile of the Light Mechs" complete with eight jumpjets and an unmatched turning radius.

In addition to the new mech, Piranha Games and Infinite Game Publishing have announced the game's first double XP event running from Friday, January 18 at 10 a.m. PST until Monday, January 21 at 10 a.m. PST. Previous XP bonuses are stackable with this event, so gather together those Founder benefits and premium game time boosts to get the most out of the weekend.

Also be sure to check out our MechWarrior Online gallery below, complete with five new screenshots of the Spider mech and two of the upcoming Commando Hero Mech known as Death's Knell, available on January 22.

Gallery: MechWarrior Online screenshots


[Source: Piranha Games press release]

MassivelyMechWarrior Online creeps you out with the new Spider mech originally appeared on Massively on Tue, 15 Jan 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>deaths-knellf2pfree-to-playinfinite-game-publishingmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopiranhapiranha-gamessci-fispiderTue, 15 Jan 2013 18:00:00 EST<![CDATA[MechWarrior delivers whopping update with twin dragon 'Mechs]]>http://massively.joystiq.com/2012/12/18/mechwarrior-delivers-whopping-update-with-twin-dragon-mechs/http://massively.joystiq.com/2012/12/18/mechwarrior-delivers-whopping-update-with-twin-dragon-mechs/http://massively.joystiq.com/2012/12/18/mechwarrior-delivers-whopping-update-with-twin-dragon-mechs/#commentsFiled under: , , , , ,

MechWarrior delivers year's largest update with twin dragon 'Mechs
Right in time for the holidays, Piranha Games has delivered a whopping gift for all of its players in the form of the year's largest content update for MechWarrior Online.

Let's tick off the list, shall we? First up is the brand-new conquest mode, which allows players to capture and hold five different locations. Next is the addition of three new 'Mechs: the Twin Dragons and the Stalker Assault. Following that, players will enjoy an economy update, a bonus to currency acquisition for new players, a night map of River City, new ways to customize a 'Mech's look, and cool holiday items. Finally, the team's throwing in plenty of bug and performance fixes free of charge.

If you give one of the new 'Mechs a try, definitely let us know how it handles! We've got the trailer for this update after the cut.

[Source: Piranha Games' press release]

Continue reading MechWarrior delivers whopping update with twin dragon 'Mechs

MassivelyMechWarrior delivers whopping update with twin dragon 'Mechs originally appeared on Massively on Tue, 18 Dec 2012 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>content-updatef2pfree-to-playin-game-eventmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwonew-yearsnew-years-daypatchpiranhapiranha-gamessci-fiupdatevideoTue, 18 Dec 2012 17:00:00 EST<![CDATA[MechWarrior Online and Penny Arcade team up for game promotion]]>http://massively.joystiq.com/2012/12/13/mechwarrior-online-and-penny-arcade-team-up-for-game-promotion/http://massively.joystiq.com/2012/12/13/mechwarrior-online-and-penny-arcade-team-up-for-game-promotion/http://massively.joystiq.com/2012/12/13/mechwarrior-online-and-penny-arcade-team-up-for-game-promotion/#commentsFiled under: , , , , ,

MechWarrior Online and Penny Arcade team up for game promotion
Geek favorite webcomic Penny Arcade and developer Piranha Games have a deal for you, but be warned: Space Ostriches might be involved. Piranha announced that players now can grab a free one-day premium time upgrade for their MechWarrior Online accounts. This premium time awards players with 50% more experience and 50% more C-bills while it lasts.

The Penny Arcade team penned a two-page pilot safety manual with crucial tips for the game to go with the promotion. Comic co-creator Jerry Holkins said that he took the project partially because of his lifelong interest: "I used to play BattleTech at lunch, when I was in high school. There's a lot of meat in MechWarrior Online, a lot to know, and we wanted to see if we could cover some of the basics in a way that could help people get the most out of it."

[Source: Piranha Games press release]

MassivelyMechWarrior Online and Penny Arcade team up for game promotion originally appeared on Massively on Thu, 13 Dec 2012 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>battletechcomicdealf2pfree-to-playgiveawayhumorJerry-Holkinsmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopenny-arcadepilot-safety-instructionspiranhapiranha-gamespremium-timepromotionsci-fiwebcomicThu, 13 Dec 2012 17:00:00 EST<![CDATA[Today's MechWarrior patch features 8v8 matchmaking, Ilya Muramets, lumps of coal]]>http://massively.joystiq.com/2012/12/04/todays-mechwarrior-patch-features-8v8-matchmaking-ilya-muramet/http://massively.joystiq.com/2012/12/04/todays-mechwarrior-patch-features-8v8-matchmaking-ilya-muramet/http://massively.joystiq.com/2012/12/04/todays-mechwarrior-patch-features-8v8-matchmaking-ilya-muramet/#commentsFiled under: , , , , , , , , ,

New MechWarrior Online hero mech
If the thought of running around 8v8 maps in a giant robot exoskeleton blowing up other players in giant robot exoskeletons makes you go "oh cool," then you'll probably want to continue reading this post about MechWarrior Online.

Today's patch introduces a custom matchmaking feature, new electronic countermeasure functionality, and a new hero mech called the Ilya Muramets CTF-IM Cataphract (say that three times fast). And yes, there's definitely a Santa bobblehead available for your cockpit. You'll find it in the cash shop along with an elf, a lump of coal, and some Christmas lights, all of which may used to pimp out the dashboard of your favorite mech.

Check out the new Ilya via the screenshot gallery below or the video after the break.

[Source: Piranha Games press release]

Gallery: MechWarrior Online screenshots

Continue reading Today's MechWarrior patch features 8v8 matchmaking, Ilya Muramets, lumps of coal

MassivelyToday's MechWarrior patch features 8v8 matchmaking, Ilya Muramets, lumps of coal originally appeared on Massively on Tue, 04 Dec 2012 14:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>f2pfree-to-playgalleryIlya MurametsIlyaMurametsmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwomwo-trailerpiranhapiranha-gamessci-fiscreenshotstrailervideoTue, 04 Dec 2012 14:30:00 EST<![CDATA[MechWarrior Online gives players control over their looks]]>http://massively.joystiq.com/2012/11/27/mechwarrior-online-gives-players-control-over-their-looks/http://massively.joystiq.com/2012/11/27/mechwarrior-online-gives-players-control-over-their-looks/http://massively.joystiq.com/2012/11/27/mechwarrior-online-gives-players-control-over-their-looks/#commentsFiled under: , , , ,

Clown makeup would be way scarier.
Maybe you want your machine of choice to have a careful camouflage pattern to make it harder for your MechWarrior Online opponents to spot you at range. Maybe you just want to cover it in inherently terrifying clown patterns. However you like to decorate your multi-ton 'Mech, you're now able to do so with the release of the game's new Camo Spec patch. This patch adds paint shop functionality to the game and allows players to enjoy a variety of external decorative options as well as cockpit decorations.

Not enough for you? The patch also adds the classic battle announcer from the original MechWarrior computer games as well as the option for Premium players to choose the start date of their enhanced play time. Only a few decorative options are available at launch, but players can expect more in the future, both earned and (presumably) purchased in the game's cash shop.

[Source: Piranha Games press release]

MassivelyMechWarrior Online gives players control over their looks originally appeared on Massively on Tue, 27 Nov 2012 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>camo-speccustomizationdecorationf2pfree-to-playlooking-prettymechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopaintpatchpatchespiranhapiranha-gamessci-fiupdateupdatesTue, 27 Nov 2012 18:30:00 EST<![CDATA[MechWarrior brings out a new 'Mech and new events]]>http://massively.joystiq.com/2012/11/20/mechwarrior-brings-out-a-new-mech-and-new-events/http://massively.joystiq.com/2012/11/20/mechwarrior-brings-out-a-new-mech-and-new-events/http://massively.joystiq.com/2012/11/20/mechwarrior-brings-out-a-new-mech-and-new-events/#commentsFiled under: , , , ,

AC/5 rounds are how I say thank you.
Sometimes you want to give thanks for the many positive things happening in your life. Other times, you want to give thanks that you're the one piloting a 70-ton marching tank and the other guy isn't. MechWarrior Online is celebrating the latter feeling with the introduction of the Cataphract 'Mech, a heavy unit available with four different loadouts in the game's latest update.

In addition to the new machine, the game has also added a new map, the Frozen City at Night, featuring large shooting lanes and patches of shadow to hide within. There are also two new modules and a new piece of equipment, all of which should help keep a better lock on your target even as they dart around the battlefield.

Last but not least, the development team is hosting a live event tomorrow at 9 p.m. EST on the official livestream channel. If you're a player and want to see how your 'Mech skills hold up against those of the designers, be prepared to throw down with some autocannons tomorrow night.

[Source: Piranha Games press release]

MassivelyMechWarrior brings out a new 'Mech and new events originally appeared on Massively on Tue, 20 Nov 2012 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>cataphractf2pfree-to-playholiday-eventslive-eventlivestreamsmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwonew-mechspatchpatchespiranhapiranha-gamesplay-against-developerssci-fiupdatesTue, 20 Nov 2012 18:30:00 EST<![CDATA[MechWarrior Online celebrates open beta with a new trailer]]>http://massively.joystiq.com/2012/11/05/mechwarrior-online-celebrates-open-beta-with-a-new-trailer/http://massively.joystiq.com/2012/11/05/mechwarrior-online-celebrates-open-beta-with-a-new-trailer/http://massively.joystiq.com/2012/11/05/mechwarrior-online-celebrates-open-beta-with-a-new-trailer/#commentsFiled under: , , , , , , , ,

Shiny new MWO trailer in celebration of glorious beta testing
MechWarrior Online has been in open beta testing for a week now. What better way to celebrate than with a snazzy new trailer? (There is no better way.)

If you're a fan of MWO and its franchise, you're probably part of the open beta already. If you're not already partaking, consider this your official reminder that this is likely the best way to get a sample of the game -- and you'll be helping the team make the game better at the same time! And if you're not a fan, perhaps this trailer can entice you.

Skip below the cut to see the video in all its mech-on-mech glory.

Continue reading MechWarrior Online celebrates open beta with a new trailer

MassivelyMechWarrior Online celebrates open beta with a new trailer originally appeared on Massively on Mon, 05 Nov 2012 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabeta-testbeta-testingbeta-testsbetasf2pfree-to-playmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwoobtopen-betaopen-beta-testingpiranhapiranha-gamessci-fitrailertrailersvideovideosMon, 05 Nov 2012 14:00:00 EST<![CDATA[MechWarrior Online: The story of how one MMO got crowd-funded without Kickstarter]]>http://massively.joystiq.com/2012/10/29/mechwarrior-online-the-story-of-how-one-mmo-got-crowd-funded-wi/http://massively.joystiq.com/2012/10/29/mechwarrior-online-the-story-of-how-one-mmo-got-crowd-funded-wi/http://massively.joystiq.com/2012/10/29/mechwarrior-online-the-story-of-how-one-mmo-got-crowd-funded-wi/#commentsFiled under: , , , , ,

MechWarrior Online The story of how one MMO got crowdfunded without Kickstarter
Kickstarter is kind of A Thing now. Oodles of companies are turning to it for all their crowd-funding needs, to varying levels of success. MechWarrior Online has distinguished itself by raising over $5 million in crowd-funding without touching Kickstarter.

If not Kickstarter, where could all that money have come from? Fans, of course! MWO has the advantage of belonging to an existing franchise with fans, and those fans bought over 70,000 of the game's Founder's packages. The Founder's program allowed fans to buy in at any of three price levels ($30, $60, and $120) with varying perks at each level.

Nick Foster, CEO of Infinite Game Publishing's parent company 7G Entertainment, explained some of the rationale behind this approach to funding. "The product will be a lot better for players because of the crowdfunding. It's allowed us to maintain a higher level of ongoing development in the product than if we were waiting for momentum to build immediately after going live. In the next few months, we'll be able to release a lot more features."

MWO hit open beta today, which means you have the perfect opportunity to see for yourself whether they put fans' funds to good use. To read more about MWO's road to funding, check out Gamasutra's full article.

MassivelyMechWarrior Online: The story of how one MMO got crowd-funded without Kickstarter originally appeared on Massively on Mon, 29 Oct 2012 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabusiness-modelscrowd-fundingf2pfree-to-playfundingigpinfinite-game-publishingkickstartermechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwonick-fosteropen-betapiranhapiranha-gamessci-fiMon, 29 Oct 2012 16:00:00 EST<![CDATA[MechWarrior Online launches open beta on Monday]]>http://massively.joystiq.com/2012/10/26/mechwarrior-online-launches-open-beta-on-monday/http://massively.joystiq.com/2012/10/26/mechwarrior-online-launches-open-beta-on-monday/http://massively.joystiq.com/2012/10/26/mechwarrior-online-launches-open-beta-on-monday/#commentsFiled under: , , , ,

Mechwarrior Online launches open beta on Monday
After a bit of a delay last week, MechWarrior Online has announced that it will be entering open beta -- for real this time -- on October 29th.

The delay decision was made after beta player feedback presented concerns for the studio. Lag issues, new player tutorials, balance tweaks, and more have been improved for this open beta launch. To help boost the game's production, over $5M was raised through the game's pre-order Founder's program since July.

MechWarrior Online is set to launch in Q1 2013.

[Source: Infinite Game Publishing press release]

MassivelyMechWarrior Online launches open beta on Monday originally appeared on Massively on Fri, 26 Oct 2012 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betaf2pfree-to-playinfinite-game-publishingmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwoopen-betapiranhapiranha-gamessci-fiFri, 26 Oct 2012 17:30:00 EST<![CDATA[Mechwarrior Online secures over $5M in funding from preorders]]>http://massively.joystiq.com/2012/10/16/mechwarrior-online-secures-over-5m-in-funding-from-preorders/http://massively.joystiq.com/2012/10/16/mechwarrior-online-secures-over-5m-in-funding-from-preorders/http://massively.joystiq.com/2012/10/16/mechwarrior-online-secures-over-5m-in-funding-from-preorders/#commentsFiled under: , , , ,

Mechwarrior Online secures over $5M in preorder funding
Despite the fact that Mechwarrior Online's open beta has been pushed back, the teams at Piranha Games and Infinite Game Publishing are still showering us with new info to keep us excited about the game until we can get our hands on it.

One exciting bit of news released today revolves around the game's Founder's Program, which allows eager fans to preorder the game at different reward tiers. Since the program launched in July, the game has earned over $5M through Founders' preorders, with 500,000 registrations in the closed beta alone, according to the studio. Interestingly enough, the top tier, Legendary, had the highest number of registrations with over 26,000 players dishing out $120 each.

The Founder's program has closed this last weekend in anticipation of the pending open beta, but it's important to note that Founders will be able to choose exactly when their rewarded premium time will start.

Check out our impressions of Mechwarrior Online for more info.

[Source: Piranha Games press release]

MassivelyMechwarrior Online secures over $5M in funding from preorders originally appeared on Massively on Tue, 16 Oct 2012 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>f2pfounders-programfree-to-playmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopiranhapiranha-gamespre-orderpreordersci-fiTue, 16 Oct 2012 13:00:00 EST<![CDATA[MechWarrior Online open beta delayed]]>http://massively.joystiq.com/2012/10/15/mechwarrior-online-open-beta-delayed/http://massively.joystiq.com/2012/10/15/mechwarrior-online-open-beta-delayed/http://massively.joystiq.com/2012/10/15/mechwarrior-online-open-beta-delayed/#commentsFiled under: , , ,

MechWarrior Online open beta delayed
Looking forward to jumping into MechWarrior Online's open beta tomorrow? You might want to rein in those expectations. Citing issues with MWO's stability, Piranha Games announced that there will be a "short push back" for the start of the open beta until a better build is released.

The devs cited feedback from current beta testers in making this call, and addressed other concerns that players have expressed. The team said that it is working on lag issues, a better match making system, new player tutorials, and general balance tweaks. Players who have paid for a premium account will also have the option to decide when they want to start using the benefits from the bonus.

There is no word as to when the open beta for MWO will commence.

[Thanks to John for the tip!]

MassivelyMechWarrior Online open beta delayed originally appeared on Massively on Mon, 15 Oct 2012 10:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabeta-delaydelayf2pfree-to-playmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwoopen-betaopen-beta-delaypiranhapiranha-gamessci-fiMon, 15 Oct 2012 10:30:00 EST<![CDATA[The Stream Team: October 15 - 21, 2012]]>http://massively.joystiq.com/2012/10/15/the-stream-team-october-15-12-2012/http://massively.joystiq.com/2012/10/15/the-stream-team-october-15-12-2012/http://massively.joystiq.com/2012/10/15/the-stream-team-october-15-12-2012/#commentsFiled under: , , , ,

The Stream Team October 15 12, 2012
What's worse than a surprise monster troll invasion? Missing watching a surprise monster troll invasion happen to your favorite Stream Team host! It may not happen today. It may not happen tomorrow. In fact, you never know when or where or even to whom it might happen, but it just might happen! Heavens to Betsy: It could be that one has already happened.

Don't take chances; don't risk missing such an iconic moment. Be sure to watch Massively TV this week to catch all of the action, commentary, and surprises that live gaming can bring. And check any missed livestreams from last week. Those trolls could be anywhere! They could even be hiding in the poll at the end of this column...

Continue reading The Stream Team: October 15 - 21, 2012

MassivelyThe Stream Team: October 15 - 21, 2012 originally appeared on Massively on Mon, 15 Oct 2012 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>aionanetarenanetascensionback-to-betabetabiowarebrowserbrowser-basedcamelotcasualccpccp-gamesclassic-mmoconquestdaocdark-age-of-cameloteaelectronic-artseq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfallen-earthfamilyfantasyfefeaturedflashForge-of-Empiresfpsfree-to-playfuncomg1gamersfirstglitchguild-wars-2gw2hipsterhistoricalhorrorinternet-spaceshipskid-friendlykids-mmokingsislekingsisle-entertainmentlivestreamlivestreaminglivestreamslucasartsmassively-metamassively-tvmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemetammo-shootermmofpsmv-guidemv-tvmvguidemvtvmwomythicmythic-entertainmentmythologyncsoftpiranhapiranha-gamespiratepirate101piratesplanetsideplanetside-2pollpollspost-apocpost-apocalypticps2pvpriftrift-literift-planes-of-telararvrsandboxsci-fantasysci-fisecret-worldshooterskill-basedsoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstarcraft-2starcraft-iistreamstream-schedulestream-teamstreamersstreamingstreamteamsubsubscription-feeswtortanktankstelonthe-old-republicthe-secret-worldthe-stream-teamthree-faction-pvpthree-way-pvptinyspecktortorchlight-2torchlight-iitriontrion-worldstruly-freetswtwitchtwitch-tvunlauncheningvanguardvanguard-saga-of-heroesvgwarwargaming.netwastelandsworld-of-tankswotMon, 15 Oct 2012 09:00:00 EST<![CDATA[MechWarrior Online open beta starts October 16th]]>http://massively.joystiq.com/2012/10/10/mechwarrior-online-open-beta-starts-october-16th/http://massively.joystiq.com/2012/10/10/mechwarrior-online-open-beta-starts-october-16th/http://massively.joystiq.com/2012/10/10/mechwarrior-online-open-beta-starts-october-16th/#commentsFiled under: , , , , , , ,

MechWarrior Online open beta starts October 16th
Thanking fans who have helped test MechWarrior Online, president of Piranha Games Russ Bullock stated that the high-quality feedback during its closed beta run has helped bring the game to the point that beta can be opened up to all fans. Commencing October 16th, the open beta period will put all interested players in the pilot seat of giant war machines and pit them against each other in PvP battles.

The Founder's program will officially end on October 14th, two days prior to the start of the open beta. Details about the Founder's packages can be found on the official site.

[Source: Piranha Games press release]

MassivelyMechWarrior Online open beta starts October 16th originally appeared on Massively on Wed, 10 Oct 2012 14:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>f2pfree-to-playmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopiranhapiranha-gamessci-fiWed, 10 Oct 2012 14:30:00 EST<![CDATA[The Stream Team: October 8 - 14, 2012]]>http://massively.joystiq.com/2012/10/08/the-stream-team-october-8-14-2012/http://massively.joystiq.com/2012/10/08/the-stream-team-october-8-14-2012/http://massively.joystiq.com/2012/10/08/the-stream-team-october-8-14-2012/#commentsFiled under: , , , ,

The Stream Team October 8 14, 2012
Awareness. Social, self, spatial -- whatever your flavor of awareness, it's a useful trait. And if livestreamers have got it, great. If not, well then Massively TV is just that much more amusing! Didn't notice that boss mob standing at your heels? Chuckles ensue. Was that actually a cliff two steps back? A good belly laugh commences. Yes sir, these things and more have transpired while all eyes were watching.

Don't miss out on the fun! Tune in this week to watch The Stream Team members as they brave a variety of worlds, or watch the classic episodes of yester-streams, so you can see for yourself how well the Massively livestreamers exhibit awareness. But what about you readers? How does your awareness measure up? You could test yourself with the basketball clip, or you can keep reading and take Massively's own awareness pop quiz at the end!

Continue reading The Stream Team: October 8 - 14, 2012

MassivelyThe Stream Team: October 8 - 14, 2012 originally appeared on Massively on Mon, 08 Oct 2012 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>aionanetarenanetascensionbiowarebrowserbrowser-basedccpccp-gamescode-clubconquestconsoleconsoleseaelectronic-artseq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedforsaken-worldfrfree-realmsfree-to-playfuncomguild-wars-2gw2historicalhorrorinternet-spaceshipskid-friendlykidskids-mmolivestreamlivestreaminglivestreamslucasartsmassively-metamassively-tvmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemetamortal-onlinemv-guidemv-tvmvguidemvtvmwomythologyncsoftopen-pvpperfect-worldperfect-world-entertainmentpiranhapiranha-gamesplaystation-3playstation3pollps3pvppweriftrift-literift-planes-of-telararvrsandboxsci-fantasysci-fisecret-worldskill-basedsoesonysony-online-entertainmentspreadsheets-onlinestar-vaultstar-warsstar-wars-the-old-republicstarcraft-2starcraft-iistarvaultstreamstream-schedulestream-teamstreamersstreamingstreamteamsubsubscription-feeswtortanktankstelonthe-old-republicthe-secret-worldthe-stream-teamthree-faction-pvpthree-way-pvptorTorchlight-2torchlight-iitriontrion-worldstruly-freetswtwitchtwitch-tvvanguardvanguard-saga-of-heroesvgwarwargaming.networld-of-tankswotwurmwurm-onlineMon, 08 Oct 2012 09:00:00 EST<![CDATA[Lips are unsealed as NDA drops for MechWarrior Online]]>http://massively.joystiq.com/2012/10/04/lips-are-unsealed-as-nda-drops-for-mechwarrior-online/http://massively.joystiq.com/2012/10/04/lips-are-unsealed-as-nda-drops-for-mechwarrior-online/http://massively.joystiq.com/2012/10/04/lips-are-unsealed-as-nda-drops-for-mechwarrior-online/#commentsFiled under: , , , , ,

Lips are unsealed as NDA drops for MechWarrior online
Folks eager to hear about MechWarrior Online but who were unable to nab a beta spot can now tackle any friends who did to get the scoop! Pirahna Games has obliterated the NDA, allowing players to share their experiences piloting large mechanized warriors through various landscapes in this sci-fi PvP game.

Players can also show off their mad skillz in a video and screenshot contest -- devs will pick their favorite submissions to highlight on the front page of the official site. Entries should be sent to submissions@infinitegamepublishing.com before 11:59 p.m. EDT on October 10th. More contest details can be found on the game's official website.

So now that the NDA has been blasted away, tell us what you think about the game!

MassivelyLips are unsealed as NDA drops for MechWarrior Online originally appeared on Massively on Thu, 04 Oct 2012 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>f2pfree-to-playmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwoNDA-dropNDA-overNDAliftpiranhapiranha-gamessci-fiscreenshot-contestvideo-contestThu, 04 Oct 2012 13:00:00 EST<![CDATA[MechWarrior Online shows off the Catapault]]>http://massively.joystiq.com/2012/08/31/mechwarrior-online-shows-off-the-catapault/http://massively.joystiq.com/2012/08/31/mechwarrior-online-shows-off-the-catapault/http://massively.joystiq.com/2012/08/31/mechwarrior-online-shows-off-the-catapault/#commentsFiled under: , , , , , , ,

Reach out and touch someone with your metal cylinders packed with explosives.
Picture this scene: You log into MechWarrior Online and you're in the most beautiful map. You don't even want to fight, just enjoy the world around you. Birds are singing, the sun is shining, and there are more than two dozen missiles screaming through the air directly into your 'Mech's head. As your machine detonates, you'll know that you just got served an express load of missiles by the Catapault, a heavy 'Mech designed solely for delivering missiles at long range.

Even at 65 tons, the Catapault packs on only 10 tons of armor. That's to conserve weight for its powerful jump jets and twin LRM-15 launchers. If you're not quite down on the game slang, that means this beast of a machine can jump and then unload long-range missiles on targets all across the map at will. Want to see it in action? Click on past the break to view the preview trailer.

Continue reading MechWarrior Online shows off the Catapault

MassivelyMechWarrior Online shows off the Catapault originally appeared on Massively on Fri, 31 Aug 2012 21:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>catapaultf2pfounders-programfree-to-playmachinesmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopiranhapiranha-gamespreviewssci-fitrailertrailersvideovideosFri, 31 Aug 2012 21:00:00 EST<![CDATA[MechWarrior Online invites you to River City]]>http://massively.joystiq.com/2012/08/24/mechwarrior-online-invites-you-to-river-city/http://massively.joystiq.com/2012/08/24/mechwarrior-online-invites-you-to-river-city/http://massively.joystiq.com/2012/08/24/mechwarrior-online-invites-you-to-river-city/#commentsFiled under: , , , , , ,

MechWarrior Online
It's important to remember that for every shell-shocked city that you're rampaging through with your 40-ton 'Mech, there are families who have lost everything in the destruction. But enough about them -- more pew pew! Welcome to MechWarrior Online's River City, where the fun never stops and the human suffering is drowned out by cheers of "PWNED!"

In a new video, Piranha Games shows off the urban battlefield of River City. It's a high-tech metropolis on fire, with hazy smoke and broken highways abounding. In the middle of River City is a fortified building, which is the high ground. Holding this will help players achieve their two objectives: a space port and an industrial port facility.

And yes, the narrator actually uses the words "River City" and "ransom" in the same sentence. There's a strange video game crossover going on here.

You can visit River City after the jump, but you probably won't want to move there.

Continue reading MechWarrior Online invites you to River City

MassivelyMechWarrior Online invites you to River City originally appeared on Massively on Fri, 24 Aug 2012 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betaf2pfree-to-playmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopiranhapiranha-gamespreviewpwnedriverriver-cityriver-city-ransomriver-city-videosci-fivideoFri, 24 Aug 2012 10:00:00 EST<![CDATA[MechWarrior Online shows off the Hunchback]]>http://massively.joystiq.com/2012/08/16/mechwarrior-online-shows-off-the-hunchback/http://massively.joystiq.com/2012/08/16/mechwarrior-online-shows-off-the-hunchback/http://massively.joystiq.com/2012/08/16/mechwarrior-online-shows-off-the-hunchback/#commentsFiled under: , , , , , , ,

Of course, the video doesn't mention what happens to a Hunchback not in an urban setting, but let's just say it's not pretty.
The Hunchback is not the prettiest machine in MechWarrior Online. It's not meant to be, and quite frankly, it doesn't need to be. This little 50-ton machine is all about taking hits and giving back as good as it gets. It's a classic design for showing off what a medium 'Mech can do, and it's also the subject of the newest video from the staff at Piranha Games.

Solidly in the middle of the spectrum of weights, the Hunchback boasts a sizable amount of armor for its frame and a respectable speed as well. Its armaments might seem light at first, but the AC/20 mounted in its shoulder provides a great deal of punch, and the lasers on its arm and head can carve opponents up in short-range engagements. Take a look at the trailer just after the break to see the machine in action -- even if it's not pretty in stills, its performance more than makes up for looking a little ungainly.

Continue reading MechWarrior Online shows off the Hunchback

MassivelyMechWarrior Online shows off the Hunchback originally appeared on Massively on Thu, 16 Aug 2012 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>f2pfree-to-playgameplay-trailersmachinesmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopiranhapiranha-gamespreviewssci-fitrailertrailersvideovideosThu, 16 Aug 2012 19:00:00 EST<![CDATA[MechWarrior Online dev diary gives handy piloting tips]]>http://massively.joystiq.com/2012/08/07/mechwarrior-online-dev-diary-gives-handy-piloting-tips/http://massively.joystiq.com/2012/08/07/mechwarrior-online-dev-diary-gives-handy-piloting-tips/http://massively.joystiq.com/2012/08/07/mechwarrior-online-dev-diary-gives-handy-piloting-tips/#commentsFiled under: , , , , ,

MechWarrior Online dev diary gives handy piloting tips
If you think you're ready to hop into the cockpit of a giant robot in MechWarrior Online and go out there all guns a-blazing, think again. You first need to learn how to pilot such a machine, which the developers say is quite unlike your traditional MMO avatar or vehicle.

For one thing, you need to consider that parts of the 'Mech work independently of each other. You can be going in one direction, have your torso twisted to face another, and have your arms moving in yet another. Plus, there is the issue of heat generation -- and shutdown -- to consider.

So take a moment to brush up on these basics with a developer video on the subject after the jump. Your life may just depend on it.

Continue reading MechWarrior Online dev diary gives handy piloting tips

MassivelyMechWarrior Online dev diary gives handy piloting tips originally appeared on Massively on Tue, 07 Aug 2012 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betadev-diaryf2pfree-to-playheat-sinksmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemovementmwopilotingpiranhapiranha-gamessci-fiTue, 07 Aug 2012 16:30:00 EST<![CDATA[MechWarrior Online developer blog discusses beta stages and launching]]>http://massively.joystiq.com/2012/08/06/mechwarrior-online-developer-blog-discusses-beta-stages-and-laun/http://massively.joystiq.com/2012/08/06/mechwarrior-online-developer-blog-discusses-beta-stages-and-laun/http://massively.joystiq.com/2012/08/06/mechwarrior-online-developer-blog-discusses-beta-stages-and-laun/#commentsFiled under: , , , , , ,

Soon, all Founders can experience the joy of figuring out why in the world this planet is worth figthing over.
The term "open beta" has kind of been kicked around in the world of free-to-play MMOs, with several games entering open beta and essentially remaining there for eternity. MechWarrior Online's latest developer blog leads off by describing this problem, pointing out that terms like "launch" and "beta" don't have the same meaning when applied to a free-to-play game. But the game is still progressing toward open testing and a launched state, and the timeline for both is outlined in the blog.

Starting on August 7th, all Founders will have full access to the closed beta, complete with currency to purchase items. All funds spent on purchasing items during closed beta will be refunded with each major patch and refunded again when the game switches to open beta. If you still haven't quite grabbed the Founder's Package yet, you've still got some time, as the package is being extended past the initial cut-off date of August 7th. For more details on the testing schedule and what's next for the game, look through the full rundown of the testing phases and the road to launch.

MassivelyMechWarrior Online developer blog discusses beta stages and launching originally appeared on Massively on Mon, 06 Aug 2012 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabeta-testbeta-testingclosed-betadata-resetsf2pfoundersfounders-packagefree-to-playlaunchmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwoopen-betapiranhapiranha-gamesprogramresetsroad-to-launchsci-fiserver-resetstestingMon, 06 Aug 2012 19:00:00 EST<![CDATA[MechWarrior Online showcases the Atlas [Updated]]]>http://massively.joystiq.com/2012/08/01/mechwarrior-online-showcases-the-atlas/http://massively.joystiq.com/2012/08/01/mechwarrior-online-showcases-the-atlas/http://massively.joystiq.com/2012/08/01/mechwarrior-online-showcases-the-atlas/#commentsFiled under: , , , , ,

NOW WITNESS THE POWER OF THIS FULLY-ARMED AND OPERATIONAL BATTLEMECH!
Last week we showed you MechWarrior Online's light-weight Jenner model, which is available as part of the MWO Founder Package. This week it's the Atlas' turn in the spotlight. The Atlas weighs in at 100 tons, roughly three times the weight of the more agile Jenner, and has a deadly combination of long- and short-range missiles, four medium lasers, and an autocannon.

Because of the weight and weaponry that make it deadly, the Atlas isn't known for being light on its feet. Anyone driving an Atlas will have to have a keen understanding of the battlefield in order to not get caught from behind before being able to bring the mech's technological terror to bear.

Skip below the cut to witness the power of this fully armed and operational battlemech!

[Edit: Took out the word "exclusively" for the Jenner in the Founder's package as non-Founders can also earn this mech.]

Continue reading MechWarrior Online showcases the Atlas [Updated]

MassivelyMechWarrior Online showcases the Atlas [Updated] originally appeared on Massively on Wed, 01 Aug 2012 21:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>atlasf2pfounder-packagefree-to-playmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopiranhapiranha-gamessci-fithe-atlastrailertrailersvideovideosWed, 01 Aug 2012 21:00:00 EST<![CDATA[Hands-on with MechWarrior Online]]>http://massively.joystiq.com/2012/07/30/hands-on-with-mechwarrior-online/http://massively.joystiq.com/2012/07/30/hands-on-with-mechwarrior-online/http://massively.joystiq.com/2012/07/30/hands-on-with-mechwarrior-online/#commentsFiled under: , , , , , , , , , , , ,

Handson with Mechwarrior Online
Last week, we sent San Francisco freelancer Emil Vazquez to the MechWarrior Online Community Day event to get some hands-on time with the game. This article reflects his opinion of his experiences!

The MechWarrior franchise is, unsurprisingly, one that centers on giant mechanical battle-beasts beating the un-living daylights out of each other. Like a lot of mech games, MechWarrior Online makes "big" its modus operandi: You pilot a giant mech with colossal weaponry that unleashes biblical levels of destruction on its surroundings.

It really should be obvious what you're getting into when you slip behind the controls of your own insanely customized mechanical soulmate, and for the most part, the surprises are few. But there are a few things that I came to appreciate during my time with the hands-on demo of MechWarrior Online, and it's the little things that make MechWarrior Online (and the MechWarrior franchise in general) more than just a mech simulation.

Continue reading Hands-on with MechWarrior Online

MassivelyHands-on with MechWarrior Online originally appeared on Massively on Mon, 30 Jul 2012 22:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabeta-testbeta-testingf2pfeaturedfree-to-playhands-onimpressionsmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemechwarrior-online-community-daymwopiranhapiranha-gamespreviewpreviewssci-fitestingMon, 30 Jul 2012 22:00:00 EST<![CDATA[MechWarrior Online answers questions about Founder status]]>http://massively.joystiq.com/2012/07/30/mechwarrior-online-answers-questions-about-founder-status/http://massively.joystiq.com/2012/07/30/mechwarrior-online-answers-questions-about-founder-status/http://massively.joystiq.com/2012/07/30/mechwarrior-online-answers-questions-about-founder-status/#commentsFiled under: , , , , ,

Shortly after this scene, several bug reports were filed about lasers being overpowered.
If you can't wait for the chance to stomp around the battlefield in your very own BattleMech, you probably gave the fine people behind MechWarrior Online your money for the Founder Package as soon as it was available. But perhaps you waited a little longer and have discovered that you still have none of the promised beta access, or perhaps you weren't even sure when the beta access would begin. Fear not, as Piranha Games has posted a brief update clarifying these matters.

Founders should already have access to the game's closed beta, with any recent purchasers receiving it shortly after the transaction clears. However, there was a glitch on the servers last weekend that resulted in some purchasers not being granted beta access as intended. Founders without access should contact customer support for help in resolving that matter, but most everyone affected should be free to log in to the test servers now and start blasting away.

MassivelyMechWarrior Online answers questions about Founder status originally appeared on Massively on Mon, 30 Jul 2012 21:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabeta-accessbeta-testclosed-betaclosed-betasf2pfree-to-playmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwonewspiranhapiranha-gamessci-fiupdatesMon, 30 Jul 2012 21:00:00 EST<![CDATA[MechWarrior Online introduces the Jenner]]>http://massively.joystiq.com/2012/07/25/mechwarrior-online-introduces-the-jenner/http://massively.joystiq.com/2012/07/25/mechwarrior-online-introduces-the-jenner/http://massively.joystiq.com/2012/07/25/mechwarrior-online-introduces-the-jenner/#commentsFiled under: , , , , , ,

MechWarrior Online introduces the Jenner
What good's a battlemech without jumpjets on its legs and a whole bunch of exclusives on the side? Meet the Jenner, a light-armor battlemech that comes as part of the legendary founders package for MechWarrior Online. The MWO early closed beta access, which is bundled into every founders package, starts soon, which makes this the perfect time for the Jenner to strut its stuff.

The Jenner mech is based on speed, with a top speed of 118 km/h and jumpjets to add it its maneuverability.With a short range missile and four medium lasers, it's a mech designed to get into the fight, rip its enemies apart, and get away quickly.

Skip below the cut for a video preview of this intimidating little mech.

Continue reading MechWarrior Online introduces the Jenner

MassivelyMechWarrior Online introduces the Jenner originally appeared on Massively on Wed, 25 Jul 2012 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>f2pfounders-packagefree-to-playjennermechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopiranhapiranha-gamessci-fivideovideosWed, 25 Jul 2012 15:30:00 EST<![CDATA[Piranha reveals MechWarrior Online's Caustic Valley]]>http://massively.joystiq.com/2012/07/23/piranha-reveals-mechwarrior-onlines-caustic-valley/http://massively.joystiq.com/2012/07/23/piranha-reveals-mechwarrior-onlines-caustic-valley/http://massively.joystiq.com/2012/07/23/piranha-reveals-mechwarrior-onlines-caustic-valley/#commentsFiled under: , , , , , , ,

Piranha reveals MechWarrior Online's Caustic Valley
Up for another MechWarrior Online video reveal? Good, because we've got a look at the game's Caustic Valley map embedded after the break. As it turns out, the valley is aptly named. It's "a land of acidic haze and caustic heat," which provides a fine contrast to the sexy mechs striding through the landscape and raining fiery hot death down on one another.

Caustic Valley also plays havoc with heat-based weapons. As Piranha Games says in its latest blog update, the heavy dust and brutal heat "greatly affects your ability to use heat-producing weapons such as lasers, as they will quickly spike to very high levels."

See for yourself after the cut.

Continue reading Piranha reveals MechWarrior Online's Caustic Valley

MassivelyPiranha reveals MechWarrior Online's Caustic Valley originally appeared on Massively on Mon, 23 Jul 2012 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>caustic-valleycaustic-valley-videof2pfree-to-playmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwomwo-videopiranhapiranha-gamessci-fivideoMon, 23 Jul 2012 15:30:00 EST