Massively http://massively.joystiq.com Massively http://www.blogsmithmedia.com/http://massively.joystiq.com/media/feedlogo.gif Massively http://massively.joystiq.com en-us Copyright 2013 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[Massively Speaking Episode 252: Eee Eee Eee]]>http://massively.joystiq.com/2013/06/18/massively-speaking-episode-252-eee-eee-eee/http://massively.joystiq.com/2013/06/18/massively-speaking-episode-252-eee-eee-eee/http://massively.joystiq.com/2013/06/18/massively-speaking-episode-252-eee-eee-eee/#commentsFiled under: , , , ,

Massively Speaking Episode 252 Eee Eee Eee
Jasmine is back from covering this year's Electronic Entertainment Expo, and boy does she have stories! Cool stories, not just ones about bears that get their heads stuck in honeypots. What impressed each of us from E3? Listen and find out!

Have a comment for the podcasters? Shoot an email to podcast@massively.com. We may just read your email on the air!

Get the podcast:
[RSS] Add Massively Speaking to your RSS aggregator.
[MP3] Download the MP3 directly.
[iTunes] Subscribe to the podcast in iTunes.
[Stitcher] Follow the podcast on Stitcher Radio.
Listen here on the page:



Read below the cut for the full show notes.

Continue reading Massively Speaking Episode 252: Eee Eee Eee

MassivelyMassively Speaking Episode 252: Eee Eee Eee originally appeared on Massively on Tue, 18 Jun 2013 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>brantbrianna-roycee3e3-2013featuredhumorjustin-olivettimassively-speakingopinionpodcastpodcastingpodcastsTue, 18 Jun 2013 17:30:00 ESTMassively Speaking Episode 252Massively.com Staff59:02podcast<![CDATA[Jukebox Heroes: Tabula Rasa's soundtrack]]>http://massively.joystiq.com/2013/06/18/jukebox-heroes-tabula-rasas-soundtrack/http://massively.joystiq.com/2013/06/18/jukebox-heroes-tabula-rasas-soundtrack/http://massively.joystiq.com/2013/06/18/jukebox-heroes-tabula-rasas-soundtrack/#commentsFiled under: , , , ,

Jukebox Heroes Tabula Rasa's soundtrack
It's a well-known fact that the ghost of Tabula Rasa haunts the Massively offices. I think it's because Shawn keeps feeding it ectopellets because he's not quite ready to let his beloved MMO go. The ghost is driving the rest of us crazy because it's constantly switching the labels on our lunchboxes and whistling the Tabula Rasa theme through the air ducts while we're trying to get honest work done.

So while the MMO no longer exists outside of a few forlorn collector's editions picking up dust on store shelves, the music persists. Tabula Rasa boasted a strong score thanks to the work of Tracy W. Bush. Bush is a name you should know when it comes to MMO soundtracks: He had a huge hand in the World of Warcraft score and contributed to several NCsoft titles (which are all dead, but that's probably not his fault). [Edit: Several readers wrote in to let me know that Curse Mackey, Stacie Cline, Chris Vrenna, and Clint Walsh also contributed to the score. Thanks!]

I find that sci-fi MMOs, particularly shooter-based ones, tend to elicit heavier tracks and more synth work than orchestral, and they are sometimes relentlessly grim. All of the above certainly can be applied to Tabula Rasa, up to and including its final surprising track.

Continue reading Jukebox Heroes: Tabula Rasa's soundtrack

MassivelyJukebox Heroes: Tabula Rasa's soundtrack originally appeared on Massively on Tue, 18 Jun 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>blue-turns-to-greycomposercomposersfeaturedgame-musicjukeboxjukebox-heroesjustin-olivettimmo-jukeboxmmo-musicmusicncsoftopinionshutdownsoundtracksoundtrackssunsettabula-rasatracy-w-bushworld-of-warcraftTue, 18 Jun 2013 09:00:00 EST<![CDATA[Free for All: My very own top ten list of MMO pet peeves]]>http://massively.joystiq.com/2013/06/12/free-for-all-my-very-own-top-ten-list-of-mmo-pet-peeves/http://massively.joystiq.com/2013/06/12/free-for-all-my-very-own-top-ten-list-of-mmo-pet-peeves/http://massively.joystiq.com/2013/06/12/free-for-all-my-very-own-top-ten-list-of-mmo-pet-peeves/#commentsFiled under: , , , , , , , , , , , , , , , , , , , , ,

Top ten list screenshot
I couldn't just sit back and let Justin Olivetti have all the fun, could I? When he published The Perfect Ten: My gaming pet peeves, I swept my fist to the sky and screamed "Sypsterrrr!" Literally a week earlier I had jotted down an idea for a similar column. I mean jotted down because I keep yellow pads around the house for late-night ideas or dog-walk eurekas.

Of course his will probably end up the superior article as he is the better writer (and has a good bit of facial hair), but I'm going to present mine anyway. In fact I'll do one better by listing 11 of my MMO pet peeves because, well, I jotted down 11.

Continue reading Free for All: My very own top ten list of MMO pet peeves

MassivelyFree for All: My very own top ten list of MMO pet peeves originally appeared on Massively on Wed, 12 Jun 2013 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>anetarenanetbeau-hindmanccpdefianceeve-onlineeverquestEverQuest-2f2pfeaturedffafree-for-allfree-to-playfreemiumGuild-Wars-2justin-olivettilord-of-the-rings-onlinelotromabinogimilmommortsNexonnexon-americaopinionperfect-tenplanetside-2RyzomSandboxsci-fiscience-fictionspellbornthe-chronicles-of-spellbornTop-Tentriontrion-worldsturbinevelvet-ropeWed, 12 Jun 2013 12:00:00 EST<![CDATA[Massively Speaking Episode 251: A new hope]]>http://massively.joystiq.com/2013/06/11/massively-speaking-episode-251-a-new-hope/http://massively.joystiq.com/2013/06/11/massively-speaking-episode-251-a-new-hope/http://massively.joystiq.com/2013/06/11/massively-speaking-episode-251-a-new-hope/#commentsFiled under: , , , , ,

Massively Speaking Episode 251
It's never wise to completely write off MMOs -- even after they've been sunsetted. In today's episode of Massively Speaking, Bree and Justin rejoice in the renewed effort behind a languishing game, muse about the flood of console MMOs, and exalt innovative ideas like flexible raids.

Have a comment for the podcasters? Shoot an email to podcast@massively.com. We may just read your email on the air!

Get the podcast:
[RSS] Add Massively Speaking to your RSS aggregator.
[MP3] Download the MP3 directly.
[iTunes] Subscribe to the podcast in iTunes.
[Stitcher] Follow the podcast on Stitcher Radio.
Listen here on the page:



Read below the cut for the full show notes.

Continue reading Massively Speaking Episode 251: A new hope

MassivelyMassively Speaking Episode 251: A new hope originally appeared on Massively on Tue, 11 Jun 2013 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>brantbrianna-roycefeaturedhumorjustin-olivettimassively-speakingopinionpodcastpodcastingpodcastsTue, 11 Jun 2013 19:00:00 ESTMassively Speaking Episode 251Massively.com Staff56:22podcast<![CDATA[Jukebox Heroes: Starting your MMO music collection]]>http://massively.joystiq.com/2013/06/11/jukebox-heroes-starting-your-mmo-music-collection/http://massively.joystiq.com/2013/06/11/jukebox-heroes-starting-your-mmo-music-collection/http://massively.joystiq.com/2013/06/11/jukebox-heroes-starting-your-mmo-music-collection/#commentsFiled under: , , , ,

Jukebox Heroes Starting your MMO music collection
I love seeing people turned on to MMO music, particularly after it's gotten such a bad rap over the years. But for the new fan, it can be a daunting proposition to start up a collection. After all, it's not as if you can go down to your local vinyl shop, peruse a stack of 45s, and come out with a full set of SOE's greatest hits. Only a fraction of MMO scores are available for purchase these days, with the rest being free, packaged in with collector's editions, out of print, or just tucked away inside of game files somewhere.

So how do you get started on building up a robust library of MMO music? If you don't have deep pockets, which scores would I recommend you pick up first? Well, my friend, I've given it some thought and have put together a guide to six essential purchases that will get you off to a great start. Don't thank me; thank music. And also me because I did this hard work.

Continue reading Jukebox Heroes: Starting your MMO music collection

MassivelyJukebox Heroes: Starting your MMO music collection originally appeared on Massively on Tue, 11 Jun 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>age-of-conanaionchance-thomascity-of-steamcollectioncomposercomposersdark-age-of-cameloteverquestfeaturedfinal-fantasy-xigame-musicguild-warsguild-wars-2inon-zurjeremy-soulejukeboxjukebox-heroesjustin-olivettilord-of-the-rings-onlinemmo-jukeboxmmo-musicmusicopinionpirates-of-the-burning-seariders-of-rohanriftsoundtracksoundtracksspiral-knightsthe-secret-worldworld-of-warcraftTue, 11 Jun 2013 09:00:00 EST<![CDATA[Massively Speaking Episode 250: The Shawn strikes back]]>http://massively.joystiq.com/2013/06/04/massively-speaking-episode-250-the-shawn-strikes-back/http://massively.joystiq.com/2013/06/04/massively-speaking-episode-250-the-shawn-strikes-back/http://massively.joystiq.com/2013/06/04/massively-speaking-episode-250-the-shawn-strikes-back/#commentsFiled under: , , , , ,

Massively Speaking Episode 250
ENGAGE THE SHAWN-2 PROTOCOL. Activation in 3... 2... 1...

That's right: For the 250th episode of Massively Speaking, the guy who was here at the very beginning has returned to chew the news and spit out opinions. This week we have another launch stumble, clueless CEOs, and plenty of talk about something called "Titan."

Have a comment for the podcasters? Shoot an email to podcast@massively.com. We may just read your email on the air!

Get the podcast:
[RSS] Add Massively Speaking to your RSS aggregator.
[MP3] Download the MP3 directly.
[iTunes] Subscribe to the podcast in iTunes.
[Stitcher] Follow the podcast on Stitcher Radio.
Listen here on the page:



Read below the cut for the full show notes.

Continue reading Massively Speaking Episode 250: The Shawn strikes back

MassivelyMassively Speaking Episode 250: The Shawn strikes back originally appeared on Massively on Tue, 04 Jun 2013 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>brantbrianna-roycefeaturedhumorjustin-olivettimassively-speakingopinionpodcastpodcastingpodcastsTue, 04 Jun 2013 20:00:00 ESTMassively Speaking Episode 250Massively.com Staff50:56podcast<![CDATA[Jukebox Heroes: Warhammer Online's soundtrack]]>http://massively.joystiq.com/2013/06/04/jukebox-heroes-warhammer-onlines-soundtrack/http://massively.joystiq.com/2013/06/04/jukebox-heroes-warhammer-onlines-soundtrack/http://massively.joystiq.com/2013/06/04/jukebox-heroes-warhammer-onlines-soundtrack/#commentsFiled under: , , , ,

Jukebox Heroes Warhammer Online's soundtrack
Even though it's fashionable to bash Warhammer Online these days (or every day since 2008, I guess), I still have a lot of affection for this particular game. It was the MMO that got me into blogging, connected me with many of my current online friends, and provided exciting experiences for well over a year. So when I hear the music, there's a rush of nostalgia that floods my brain and runs down to my extremities.

That's not to say it's a particularly terrific score. I'd probably classify Warhammer Online's soundtrack as slightly below average; it does the job it needed to do, but it doesn't provide any stellar breakout tracks that will endure long after I've logged out. Still, it's worth examining.

The score was handled by Mythic in-house composer Brad Derrick (who also helped to make an amusing Dwarf ballad while he was there). What did he come up with to represent this savagely twisted world? Let's find out!

Continue reading Jukebox Heroes: Warhammer Online's soundtrack

MassivelyJukebox Heroes: Warhammer Online's soundtrack originally appeared on Massively on Tue, 04 Jun 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>brad-derrickcomposercomposerseaelectronic-artsendless-trialfantasyfeaturedgame-musicjukeboxjukebox-heroesjustin-olivettimmo-jukeboxmmo-musicmusicmythicmythic-entertainmentopinionpvprvrsoundtracksoundtrackswarwarhammerwarhammer-onlineTue, 04 Jun 2013 11:00:00 EST<![CDATA[Jukebox Heroes: EVE Online's soundtrack]]>http://massively.joystiq.com/2013/05/28/jukebox-heroes-eve-onlines-soundtrack/http://massively.joystiq.com/2013/05/28/jukebox-heroes-eve-onlines-soundtrack/http://massively.joystiq.com/2013/05/28/jukebox-heroes-eve-onlines-soundtrack/#commentsFiled under: , , ,

Jukebox Heroes EVE Online's soundtrack
EVE Online's soundtrack is a strange puppy to me. I've heard players proclaim their love and undying affection for it, although I believe that a great deal of that is tied into game loyalty and monogamy. From this outsider's perspective, it's a large number of ambient synth tracks that are big on atmosphere and small on catchy melodies or memorable themes.

Even though I wouldn't rate it as one of the most exciting scores I've covered for this column, I don't want to dismiss its atmospheric nature as a negative. Creating a soundscape that communicates the wonder, mystery, and largely empty gulf of the cosmos has proven to be a great asset to gamer immersion for EVE, and at least most of these tracks are soothing and low-key enough to warrant a high rating on the replayability scale.

Icelandic composer Jón Hallur Haraldsson was in charge of this project. Responding to an interview question about the score's musical category, Haraldsson said, "Back in the days I used to concern myself a lot with defining my music, but I don't do that as much anymore. I like to amalgamate, to take whatever I like from whatever style and try to put that into my music."

You can listen to a bulk of the game's music on Sound Cloud, but here are my picks for the six best tracks out of the bunch!

Continue reading Jukebox Heroes: EVE Online's soundtrack

MassivelyJukebox Heroes: EVE Online's soundtrack originally appeared on Massively on Tue, 28 May 2013 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamescomposercomposerseveeve-onlinefanfestfeaturedgame-musicinternet-spaceshipsJón-Hallur-HaraldssonJon-Hallur-Haraldssonjukeboxjukebox-heroesjustin-olivettimmo-jukeboxmmo-musicmusicopinionsandboxsci-fisoundtracksoundtracksspreadsheets-onlinesymphonyTue, 28 May 2013 20:00:00 EST<![CDATA[Jukebox Heroes: Character select music]]>http://massively.joystiq.com/2013/05/21/jukebox-heroes-character-select-music/http://massively.joystiq.com/2013/05/21/jukebox-heroes-character-select-music/http://massively.joystiq.com/2013/05/21/jukebox-heroes-character-select-music/#commentsFiled under: , , , , , , , ,

Jukebox Heroes Character select music
Character select and creation music has always fascinated me. OK, maybe not fascinated; it's interested me. I've always viewed such themes as the overture of the game, the interlude between the title theme and the game proper to come.

These themes don't tend to be rip-roaring in their presentation because that's not their purpose. They have to be pleasant enough without being annoying when looped endlessly. After all, sometimes players spend a loooong time making their characters or sitting there at the select screen, and the last thing you want is for their ears to become fatigued by the experience.

So here are six MMO character select and character creation themes that I've enjoyed over the years. And if you saw the title graphic up there and immediately started hearing this song in your head, then you and I probably grew up in the same era.

Continue reading Jukebox Heroes: Character select music

MassivelyJukebox Heroes: Character select music originally appeared on Massively on Tue, 21 May 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>carbinecarbine-studioscity-of-heroescity-of-villainscohcomposercomposerscovcoxeq-2eq-iieq2eqiieverquest-2everquest-iif2pfantasyfeaturedffff11ffxifinal-fantasyfinal-fantasy-11final-fantasy-xifree-to-playfreedomgame-musicjasper-kydjesper-kydjukeboxjukebox-heroesjustin-olivettimmo-jukeboxmmo-musicmusicncsoftopinionparagonparagon-studiossandboxsandparksci-fantasysci-fisoesonysony-online-entertainmentsoundtracksoundtrackssquaresquare-enixsuperherosuperheroestelonthe-chronicles-of-spellbornvanguardvanguard-saga-of-heroesvgwildstarwsTue, 21 May 2013 18:00:00 EST<![CDATA[Massively Speaking Episode 249: Captain Grumpypants]]>http://massively.joystiq.com/2013/05/21/massively-speaking-episode-249-captain-grumpypants/http://massively.joystiq.com/2013/05/21/massively-speaking-episode-249-captain-grumpypants/http://massively.joystiq.com/2013/05/21/massively-speaking-episode-249-captain-grumpypants/#commentsFiled under: , , , , ,

Massively Speaking Episode 249
When a subscription MMO goes free-to-play, there's always a circus atmosphere surrounding it. The studios use it as an excuse to enjoy a "second launch," players pour out opinions on all sides, and new folks wander into the danger zone out of sheer curiosity.

It's not just about F2P on this week's Massively Speaking; we have game launches, layoffs, previews, and tons of reader mail to cover. Will we have the words to do it? Or will we just end the podcast humming informatively? Jef's on it today, so there definitely will be a song and dance number at some point!

Have a comment for the podcasters? Shoot an email to podcast@massively.com. We may just read your email on the air!

Get the podcast:
[RSS] Add Massively Speaking to your RSS aggregator.
[MP3] Download the MP3 directly.
[iTunes] Subscribe to the podcast in iTunes.
[Stitcher] Follow the podcast on Stitcher Radio.
Listen here on the page:



Read below the cut for the full show notes.

Continue reading Massively Speaking Episode 249: Captain Grumpypants

MassivelyMassively Speaking Episode 249: Captain Grumpypants originally appeared on Massively on Tue, 21 May 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>brantbrianna-roycecaptain-grumpypantsfeaturedhumorjef-reahardjustin-olivettimassively-speakingopinionpodcastpodcastingpodcastsTue, 21 May 2013 15:00:00 ESTMassively Speaking Episode 249Massively.com Staff01:11:15podcast<![CDATA[Jukebox Heroes: Defiance's soundtrack]]>http://massively.joystiq.com/2013/05/14/jukebox-heroes-defiances-soundtrack/http://massively.joystiq.com/2013/05/14/jukebox-heroes-defiances-soundtrack/http://massively.joystiq.com/2013/05/14/jukebox-heroes-defiances-soundtrack/#commentsFiled under: , , , , ,

Jukebox Heroes Defiance's soundtrack
First of all, I wish my first name were a cool animal. Bear McCreary has that on me, so it seems unfair that he's also a geek icon for his work on several beloved TV series (Battlestar Galactica, Eureka, The Walking Dead). And now the guy is composing the soundtrack of one of this spring's hottest MMOs? Where did I go wrong with my life?

Before I go and change my name to Sugar Glider Olivetti, I guess it's only fair that I put a lid on my hurt ego to give Defiance's score a fair listen. McCreary was tapped to create the music for both the MMO and the TV series, giving the crossover project a unified sound.

"I had to make sure that players could hang out in one area for long stretches of time without getting bored by repetitive music," McCreary wrote on his blog. "As a result, melody plays less of a role throughout many of these cues. The real stars of this music are the texture and colors."

Music has texture and colors? If Bear says it, then it must be. Let's dive in!

Continue reading Jukebox Heroes: Defiance's soundtrack

MassivelyJukebox Heroes: Defiance's soundtrack originally appeared on Massively on Tue, 14 May 2013 21:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>arkark-hunterarkfallbear-mccrearycomposercomposersdefiancefeaturedgame-musicjukeboxjukebox-heroesjustin-olivettimmo-jukeboxmmo-musicmmo-shootermusicopinionpvpsci-fishootersoundtracksoundtrackssyfythird-person-shootertpstransmedia-synergytriontrion-worldstvxboxTue, 14 May 2013 21:00:00 EST<![CDATA[Massively Speaking Episode 248: Duped!]]>http://massively.joystiq.com/2013/05/14/massively-speaking-episode-248-duped/http://massively.joystiq.com/2013/05/14/massively-speaking-episode-248-duped/http://massively.joystiq.com/2013/05/14/massively-speaking-episode-248-duped/#commentsFiled under: , , , ,

Massively Speaking Episode 248
Sometimes it's all about the little details in MMOs: How a character moves. How to create billions in gold due to a duping exploit. What goodies the collector's edition will include. Why losing 1.3 million subscribers is "no biggie." And we're nothing if not about the details on Massively Speaking! Listen to Bree and Justin fact-check in real-time, racing against the clock to stop a terrorist plot to bring down auction houses everywhere!

Have a comment for the podcasters? Shoot an email to podcast@massively.com. We may just read your email on the air!

Get the podcast:
[RSS] Add Massively Speaking to your RSS aggregator.
[MP3] Download the MP3 directly.
[iTunes] Subscribe to the podcast in iTunes.
[Stitcher] Follow the podcast on Stitcher Radio.
Listen here on the page:



Read below the cut for the full show notes.

Continue reading Massively Speaking Episode 248: Duped!

MassivelyMassively Speaking Episode 248: Duped! originally appeared on Massively on Tue, 14 May 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>brantbrianna-roycefeaturedhumorjustin-olivettimassively-speakingopinionpodcastpodcastingpodcastsTue, 14 May 2013 15:00:00 ESTMassively Speaking Episode 248Massively.com Staff01:15:29podcast<![CDATA[Jukebox Heroes: Wrath of the Lich King's soundtrack]]>http://massively.joystiq.com/2013/05/07/jukebox-heroes-wrath-of-the-lich-kings-soundtrack/http://massively.joystiq.com/2013/05/07/jukebox-heroes-wrath-of-the-lich-kings-soundtrack/http://massively.joystiq.com/2013/05/07/jukebox-heroes-wrath-of-the-lich-kings-soundtrack/#commentsFiled under: , , , ,

Jukebox Heroes Wrath of the Lich King's soundtrack
After my so-so review of The Burning Crusade's score a few months ago, I'm sure a few of you thought I was barking mad. World of Warcraft is well-known for great orchestra pieces, but I stick by saying that most of the brilliant stuff stayed the heck away from Outland. Fortunately, the sound quality got a lot better when we went up north for Wrath of the Lich King in 2008.

The score was composed and arranged by Russell Brower, Derek Duke, Matt Uelmen, Neal Acree, and Glenn Stafford. As to be expected by that name sandwich, the score features a lot of variety. While there are epic chants and the like that are to be expected from WoW, there's also a lonely, savage feel to the music that represents these far-off lands. There's also a lot of blowing wind that segues between tracks if you listen to the album straight through, and if that doesn't make you envision a snow-blasted landscape, I don't know what would.

The liner notes say that "this is the music of ice and despair, a dirge and a call to arms." I couldn't put it better myself. Let's dive into my picks for the best tracks from this score, shall we?

Continue reading Jukebox Heroes: Wrath of the Lich King's soundtrack

MassivelyJukebox Heroes: Wrath of the Lich King's soundtrack originally appeared on Massively on Tue, 07 May 2013 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>activisionblizzardblizzard-entertainmentcomposercomposersDerek-Dukefantasyfeaturedgame-musicGlenn-Staffordjukeboxjukebox-heroesjustin-olivettiMatt-Uelmenmmo-jukeboxmmo-musicmusicNeal-AcreeopinionRussell-Browersoundtracksoundtrackswarcraftworld-of-warcraftwowwrath-of-the-lich-kingTue, 07 May 2013 12:00:00 EST<![CDATA[Massively Speaking Episode 247: TransMMO synergy!]]>http://massively.joystiq.com/2013/05/07/massively-speaking-episode-247-transmmo-synergy/http://massively.joystiq.com/2013/05/07/massively-speaking-episode-247-transmmo-synergy/http://massively.joystiq.com/2013/05/07/massively-speaking-episode-247-transmmo-synergy/#commentsFiled under: , , , , ,

Massively Speaking Episode 247 TransMMO synergy!
Crossovers are cool, in this humble author's opinion. They not only keep comics spicy and interesting but have offered MMO studios the opportunity to join the hands of two games together in holy geekamony. As Massively Speaking makes a triumphant return this week, we talk about transMMO synergy, Camelot victorious, Flame and Frost, and more.

Have a comment for the podcasters? Shoot an email to podcast@massively.com. We may just read your email on the air!

Get the podcast:
[RSS] Add Massively Speaking to your RSS aggregator.
[MP3] Download the MP3 directly.
[iTunes] Subscribe to the podcast in iTunes.
[Stitcher] Follow the podcast on Stitcher Radio.
Listen here on the page:



Read below the cut for the full show notes.

Continue reading Massively Speaking Episode 247: TransMMO synergy!

MassivelyMassively Speaking Episode 247: TransMMO synergy! originally appeared on Massively on Tue, 07 May 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>brantbrianna-roycefeaturedhumorjustin-olivettimassively-speakingopinionpodcastpodcastingpodcastsTue, 07 May 2013 09:00:00 ESTMassively Speaking Episode 247Massively.com Staff01:26:38podcast<![CDATA[Jukebox Heroes: Battle music!]]>http://massively.joystiq.com/2013/04/23/jukebox-heroes-battle-music/http://massively.joystiq.com/2013/04/23/jukebox-heroes-battle-music/http://massively.joystiq.com/2013/04/23/jukebox-heroes-battle-music/#commentsFiled under: , , , , , , , ,

Jukebox Heroes Battle music!
It's time once again to take a week off from looking at specific MMO soundtracks and open ourselves up to a theme instead. The topic? Battle music. Yeah, it can be some of the most obnoxious music in the game, especially after hearing it for the 3,000th time, but every once in a while I hear a piece that has some merit to it. These are the ones we want to examine today.

What makes for a good battle music track? I think it has to get you excited without being annoying or grating and not so loud or incredibly noticeable that you can't help but get tired of it sooner rather than later. It was actually pretty tricky to pull together six such tracks for this column, but I managed to do with with the help of Colonel Bugle up there. He's got the best MP3 collection around.

Continue reading Jukebox Heroes: Battle music!

MassivelyJukebox Heroes: Battle music! originally appeared on Massively on Tue, 23 Apr 2013 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>anarchy-onlineaoatlanticaatlantica-onlinebiowarecamelotclassic-mmocomposercomposersconsoleconsolesdaocdark-age-of-cameloteaelectronic-artseqeq1everquestf2pfantasyfeaturedffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivfree-to-playfuncomgame-musicjukeboxjukebox-heroesjustin-olivettilord-of-the-ringslord-of-the-rings-onlinelotrommo-jukeboxmmo-musicmusicmythicmythic-entertainmentmythologynexonnexon-americanexon-koreaopinionpvprvrsci-fisoesonysony-online-entertainmentsoundtracksoundtrackssquaresquare-enixtactical-mmoturbineturbine-entertainmentTue, 23 Apr 2013 20:00:00 EST<![CDATA[Massively Speaking Episode 246 -- The princess and the frog in her throat]]>http://massively.joystiq.com/2013/04/23/massively-speaking-episode-246-the-princess-and-the-frog-in-h/http://massively.joystiq.com/2013/04/23/massively-speaking-episode-246-the-princess-and-the-frog-in-h/http://massively.joystiq.com/2013/04/23/massively-speaking-episode-246-the-princess-and-the-frog-in-h/#commentsFiled under: , , , ,

Massively Speaking Episode 246
Bree's sick, but does that mean that her voice has just become 50% more awesome? We think it does. On this week's episode of Massively Speaking, we deal with cash shop trickery, the ups and downs of relaunching an MMO, and plenty of mailbag topics sent in by listeners!

Have a comment for the podcasters? Shoot an email to podcast@massively.com. We may just read your email on the air!

Get the podcast:
[RSS] Add Massively Speaking to your RSS aggregator.
[MP3] Download the MP3 directly.
[iTunes] Subscribe to the podcast in iTunes.
[Stitcher] Follow the podcast on Stitcher Radio.
Listen here on the page:



Read below the cut for the full show notes.

Continue reading Massively Speaking Episode 246 -- The princess and the frog in her throat

MassivelyMassively Speaking Episode 246 -- The princess and the frog in her throat originally appeared on Massively on Tue, 23 Apr 2013 10:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>brantbrianna-roycefeaturedhumorjustin-olivettimassively-speakingopinionpodcastpodcastingpodcastsTue, 23 Apr 2013 10:30:00 ESTMassively Speaking Episode 246Massively.com Staff01:07:22podcast<![CDATA[Jukebox Heroes: Super Adventure Box's soundtrack]]>http://massively.joystiq.com/2013/04/16/jukebox-heroes-super-adventure-boxs-soundtrack/http://massively.joystiq.com/2013/04/16/jukebox-heroes-super-adventure-boxs-soundtrack/http://massively.joystiq.com/2013/04/16/jukebox-heroes-super-adventure-boxs-soundtrack/#commentsFiled under: , , , , ,

Jukebox Heroes Super Adventure Box's soundtrack
OK, yeah, how could I not do this? I know that we at Massively have gone a little ga-ga over ArenaNet's stellar April Fools' Day prank-slash-massive update, but when I saw that the team released a half-hour of original score in addition to all of the pixelated monkey mayhem, I knew I had to review it.

Your enjoyment of Guild Wars 2's Super Adventure Box and its score will largely depend on your memories or feelings about old-school video games. For a kid who grew up on 8-bit and 16-bit games, the sound of SAB is pure nostalgia (even if it is original composition). I think it's also as catchy as cooties.

Composers Maclaine Diemer and Leif Chappelle put in a lot of effort to not just make a classic-sounding soundtrack here but specifically reference and pay homage to plenty of old-school hits. Hang with me as I highlight the best of Super Adventure Box, and I promise that next week we'll get back to serious business.

Continue reading Jukebox Heroes: Super Adventure Box's soundtrack

MassivelyJukebox Heroes: Super Adventure Box's soundtrack originally appeared on Massively on Tue, 16 Apr 2013 21:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>anetarenanetbattletoadsbuy-to-playcastlevaniachrono-triggercomposercomposersfantasyfeaturedfinal-fantasygame-musicguild-wars-2gw2jukeboxjukebox-heroesjustin-olivettiLeif-ChappelleMaclaine-Diemermmo-jukeboxmmo-musicmusicncsoftnesopinionsabsilent-hillsoundtracksoundtrackssuper-adventure-boxthe-secret-worldzeldaTue, 16 Apr 2013 21:00:00 EST<![CDATA[Massively Speaking Episode 245 -- Wushu sushi]]>http://massively.joystiq.com/2013/04/16/massively-speaking-episode-245-wushu-sushi/http://massively.joystiq.com/2013/04/16/massively-speaking-episode-245-wushu-sushi/http://massively.joystiq.com/2013/04/16/massively-speaking-episode-245-wushu-sushi/#commentsFiled under: , , , , ,

Massively Speaking Episode 245
Big releases? We got 'em! Bugged launches? We're all over them! Betas and previews? We are first on the scene, people! If you thought that MMOs had gone dormant in 2013, then this episode of Massively Speaking is out to kick that assumption in the keister!

Have a comment for the podcasters? Shoot an email to podcast@massively.com. We may just read your email on the air!

Get the podcast:
[RSS] Add Massively Speaking to your RSS aggregator.
[MP3] Download the MP3 directly.
[iTunes] Subscribe to the podcast in iTunes.
[Stitcher] Follow the podcast on Stitcher Radio.
Listen here on the page:



Read below the cut for the full show notes.

Continue reading Massively Speaking Episode 245 -- Wushu sushi

MassivelyMassively Speaking Episode 245 -- Wushu sushi originally appeared on Massively on Tue, 16 Apr 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>brantbrianna-roycefeaturedhumorjustin-olivettimassively-speakingopinionpodcastpodcastingpodcastsTue, 16 Apr 2013 10:00:00 ESTMassively Speaking Episode 245Massively.com Staff01:06:45podcast<![CDATA[The Perfect Ten: Final moments of MMOs, part 1]]>http://massively.joystiq.com/2013/04/11/the-perfect-ten-final-moments-of-mmos-part-1/http://massively.joystiq.com/2013/04/11/the-perfect-ten-final-moments-of-mmos-part-1/http://massively.joystiq.com/2013/04/11/the-perfect-ten-final-moments-of-mmos-part-1/#commentsFiled under: , , , , , , ,

The Perfect Ten Final moments of MMOs
Maybe many of us would just rather remember MMOs as they were in life rather than at the moment of their demise. But I believe that how a game went out is incredibly fascinating for many reasons and worthy of examination.

It's in these final moments when an entire community has to say goodbye. It's in these moments that the developers mourn as well before pulling the plug. It's in these moments that history is being made one last time. And it goes without saying that it's in these moments that everyone curses the unfairness of it all.

Today we're going to watch the first half of 10 videos featuring MMOs in their final moments. It's here we'll see how weird, crazy, sad, and interesting things can get. Maybe you were part of one (or more) of these moments or are simply curious what it was like. Either way, it's the end of the world as we know it. And we feel fine.

Continue reading The Perfect Ten: Final moments of MMOs, part 1

MassivelyThe Perfect Ten: Final moments of MMOs, part 1 originally appeared on Massively on Thu, 11 Apr 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>classic-mmocomposercomposersdungeon-runnerseqoaeverquest-online-adventuresfeaturedfinal-momentsgalaxiesgame-musicjukeboxjukebox-heroesjustin-olivettimmo-jukeboxmmo-musicmusicmxoopinionsandboxsci-fishutdownsoesony-online-entertainmentsoundtracksoundtracksstar-warsstar-wars-galaxiessunsetswgswgotabula-rasathe-matrix-onlineThu, 11 Apr 2013 09:00:00 EST<![CDATA[Jukebox Heroes: Guild Wars Factions' soundtrack]]>http://massively.joystiq.com/2013/04/09/jukebox-heroes-guild-wars-factions-soundtrack/http://massively.joystiq.com/2013/04/09/jukebox-heroes-guild-wars-factions-soundtrack/http://massively.joystiq.com/2013/04/09/jukebox-heroes-guild-wars-factions-soundtrack/#commentsFiled under: , , , ,

Jukebox Heroes Guild Wars Factions' soundtrack
East Asian-themed music in MMOs is something that I generally welcome. Even if the title isn't an Asian MMO, chances are that sooner or later developers like to work an Eastern zone, class, or city into the game -- and with that comes a specific sound. I'm by no means educated on what instruments are used in these tunes, but the result is so distinctive that you can't help but think of the region.

Guild Wars: Factions definitely drew upon the Orient for its theme, and composer Jeremy Soule returned to create a score that would paint a picture of Cantha. Unfortunately, I don't think he was up to the task. While technically sufficient, Factions' score is definitely lacking in the grandeur of Prophecies and the basic catchiness necessary to elevate a soundtrack out of the crowd. The best I can say is that none of the tracks is horrible to hear, but the album as a whole is actually a bit bland and forgettable.

I'm by no means besmirching Soule here. His previous and subsequent Guild Wars projects are heads and shoulders above this one, and everyone has an off day. Perhaps Asian music just wasn't his forte. In any case, I sifted vigorously to discover six tracks that best represent Cantha and its people.

Continue reading Jukebox Heroes: Guild Wars Factions' soundtrack

MassivelyJukebox Heroes: Guild Wars Factions' soundtrack originally appeared on Massively on Tue, 09 Apr 2013 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>anetarenanetcomposercomposersfactionsfantasyfeaturedgame-musicguild-warsguild-wars-factionsgwjeremy-soulejukeboxjukebox-heroesjustin-olivettimmo-jukeboxmmo-musicmusicncsoftopinionsoundtracksoundtracksTue, 09 Apr 2013 16:00:00 EST<![CDATA[Massively Speaking Episode 244: Defiant until the end]]>http://massively.joystiq.com/2013/04/09/massively-speaking-episode-244-defiant-until-the-end/http://massively.joystiq.com/2013/04/09/massively-speaking-episode-244-defiant-until-the-end/http://massively.joystiq.com/2013/04/09/massively-speaking-episode-244-defiant-until-the-end/#commentsFiled under: , , , , ,

Massively Speaking Episode 244 Defiant until the end
Bree pulls into Starbucks because her internet's on the fritz, Justin's giddy about minipets, and a wild Jef arrives to give us his thoughts on the first week of Defiance. Massively Speaking: It's super effective!

Have a comment for the podcasters? Shoot an email to podcast@massively.com. We may just read your email on the air!

Get the podcast:
[RSS] Add Massively Speaking to your RSS aggregator.
[MP3] Download the MP3 directly.
[iTunes] Subscribe to the podcast in iTunes.
[Stitcher] Follow the podcast on Stitcher Radio.
Listen here on the page:



Read below the cut for the full show notes.

Continue reading Massively Speaking Episode 244: Defiant until the end

MassivelyMassively Speaking Episode 244: Defiant until the end originally appeared on Massively on Tue, 09 Apr 2013 11:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>arkark-hunterarkfallbrantbrianna-roycedefiancefeaturedhumorjefjef-reahardjustin-olivettimassively-speakingmmo-shooteropinionpodcastpodcastingpodcastspvpsci-fishootersyfythird-person-shootertpstransmedia-synergytriontrion-worldstvxboxTue, 09 Apr 2013 11:30:00 ESTMassively Speaking Episode 244Massively.com Staff01:03:26podcast<![CDATA[Jukebox Heroes: The Sims Online's soundtrack]]>http://massively.joystiq.com/2013/04/02/jukebox-heroes-the-sims-onlines-soundtrack/http://massively.joystiq.com/2013/04/02/jukebox-heroes-the-sims-onlines-soundtrack/http://massively.joystiq.com/2013/04/02/jukebox-heroes-the-sims-onlines-soundtrack/#commentsFiled under: , , , ,

Jukebox Heroes The Sims Online's soundtrack
The recent SimCity is by far not the only botched product that EA's launched with the Sims name on it. The truth is that The Sims Online had a great potential and franchise behind it, but it let the ball drop, big-time. It was already visually obsolete by the time it launched, and that was the least of its worries.

Yet this fizzled MMO-slash-chat room had some pretty solid music backing it up. I've always been partial to the Sims series when it comes to OSTs because sometimes I just want to relax to happy, effervescent tunes. Series composer Jerry Martin produced the score to TSO in the same vein as his other projects, and it's still a delight to hear.

Unfortunately, the only way you can get a copy of the soundtrack today is to find a seller who's got an otherwise-useless copy of The Sims Online: Charter Edition lying around. Otherwise, it might just be easier to forge on in this column and get a taste of the Sims soundscape!

Continue reading Jukebox Heroes: The Sims Online's soundtrack

MassivelyJukebox Heroes: The Sims Online's soundtrack originally appeared on Massively on Tue, 02 Apr 2013 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>composercomposerseaea-landelectronic-artsfeaturedgame-musicjerry-martinjukeboxjukebox-heroesjustin-olivettimmo-jukeboxmmo-musicmusicopinionsimlishsimlish-is-just-nonstop-swearingsimssoundtracksoundtracksthe-sims-onlinetsoTue, 02 Apr 2013 20:00:00 EST<![CDATA[Massively Speaking Episode 243: Super Adventure MJ]]>http://massively.joystiq.com/2013/04/02/massively-speaking-episode-243-super-adventure-mj/http://massively.joystiq.com/2013/04/02/massively-speaking-episode-243-super-adventure-mj/http://massively.joystiq.com/2013/04/02/massively-speaking-episode-243-super-adventure-mj/#commentsFiled under: , , , , , ,

Massively Speaking Episode 243 Super Adventure MJ
MJ returns from her grand GDC adventure, and boy does she have stories to tell! Most of those stories will be to her therapist who will help her overcome the trauma of five days of non-stop interviews, but some of those tales will be related in this podcast. Also, you won't hear her sing the baby monkey song, but she totally did before we started recording and it was awesome. You had to be there.

Have a comment for the podcasters? Shoot an email to podcast@massively.com. We may just read your email on the air!

Get the podcast:
[RSS] Add Massively Speaking to your RSS aggregator.
[MP3] Download the MP3 directly.
[iTunes] Subscribe to the podcast in iTunes.
[Stitcher] Follow the podcast on Stitcher Radio.
Listen here on the page:



Read below the cut for the full show notes.

Continue reading Massively Speaking Episode 243: Super Adventure MJ

MassivelyMassively Speaking Episode 243: Super Adventure MJ originally appeared on Massively on Tue, 02 Apr 2013 09:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>baby-monkeybaby-monkey-going-backwards-on-a-pigbrantbrianna-royceconconferenceconventioneventevent-coverageeventsfeaturedgame-developers-conferencegame-developers-conference-2013gdcgdc-2013humorjustin-olivettimassively-event-coveragemassively-speakingopinionpodcastpodcastingpodcastssuper-adventure-boxTue, 02 Apr 2013 09:30:00 ESTMassively Speaking Episode 243Massively.com Staff01:08:35podcast<![CDATA[Jukebox Heroes: Final Fantasy XI's soundtrack]]>http://massively.joystiq.com/2013/03/26/jukebox-heroes-final-fantasy-xis-soundtrack/http://massively.joystiq.com/2013/03/26/jukebox-heroes-final-fantasy-xis-soundtrack/http://massively.joystiq.com/2013/03/26/jukebox-heroes-final-fantasy-xis-soundtrack/#commentsFiled under: , , , , ,

Jukebox Heroes Final Fantasy XI's soundtrack
Hey you! Want a good way to die a horrible, painful death? Enter into any geek domain and put down the music of the Final Fantasy series. Do it. I double-dog dare you. Even scrubs who couldn't identify a single other composer or notable video game soundtrack will leap to the defense of One-Winged Angel.

While I generally do like the Final Fantasy tunes, especially the earlier 8-bit era stuff and Final Fantasy IX, I haven't seen it as an infallible series in regard to its music. I think along the way Nobuo Uematsu's become this person who can Do No Wrong in the gaming community, which has stifled an honest look at both the highs and lows of his soundtracks.

I don't want to be all about hero worship or mindless bashing today; I want to examine a fairly good but not perfect soundtrack that represented Final Fantasy's first foray into MMOs. Along with Uematsu, Naoshi Mizuta and Kumi Tanioka shared composing duties on this project. There's some terrific stuff here that you'll listen to after the jump, but there are a lot more completely forgettable (and sometimes annoying!) tracks that have been shoehorned into FFXI's expansive game. So let's come down to earth and see what Final Fantasy XI has in store for us.

Continue reading Jukebox Heroes: Final Fantasy XI's soundtrack

MassivelyJukebox Heroes: Final Fantasy XI's soundtrack originally appeared on Massively on Tue, 26 Mar 2013 21:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>battle-themechocobocomposercomposersfantasyfeaturedffff11ffxifinal-fantasyfinal-fantasy-11final-fantasy-viifinal-fantasy-xigame-musicjukeboxjukebox-heroesjustin-olivettiKumi-Taniokammo-jukeboxmmo-musicmusicNaoshi-MizutaNobuo-Uematsuone-winged-angelopinionsoundtracksoundtrackssquaresquare-enixTue, 26 Mar 2013 21:00:00 EST<![CDATA[Massively Speaking Episode 242: PAX East post-mortem]]>http://massively.joystiq.com/2013/03/26/massively-speaking-episode-242-pax-east-post-mortem/http://massively.joystiq.com/2013/03/26/massively-speaking-episode-242-pax-east-post-mortem/http://massively.joystiq.com/2013/03/26/massively-speaking-episode-242-pax-east-post-mortem/#commentsFiled under: , , , , ,

Massively Speaking Episode 242 PAX East postmortem
Another PAX East is in the bag, but we're not quite through with it just yet! The intrepid crew that was on the ground in Boston have returned to share hijinks, opinions, and impressions of their adventures and discoveries over the weekend. Plus, Eliot got a boo-boo.

Have a comment for the podcasters? Shoot an email to podcast@massively.com. We may just read your email on the air!

Get the podcast:
[RSS] Add Massively Speaking to your RSS aggregator.
[MP3] Download the MP3 directly.
[iTunes] Subscribe to the podcast in iTunes.
[Stitcher] Follow the podcast on Stitcher Radio.
Listen here on the page:



Read below the cut for the full show notes.

Continue reading Massively Speaking Episode 242: PAX East post-mortem

MassivelyMassively Speaking Episode 242: PAX East post-mortem originally appeared on Massively on Tue, 26 Mar 2013 09:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>brantbrianna-royceconconventioneventevent-coverageeventsexpofeaturedhumorjustin-olivettimassively-event-coveragemassively-speakingopinionpaxpax-2013pax-eastpax-east-2013penny-arcade-expopodcastpodcastingpodcastsTue, 26 Mar 2013 09:30:00 ESTMassively Speaking Episode 242Massively.com Staff01:03:11podcast<![CDATA[Jukebox Heroes: The Matrix Online's soundtrack]]>http://massively.joystiq.com/2013/03/19/jukebox-heroes-the-matrix-onlines-soundtrack/http://massively.joystiq.com/2013/03/19/jukebox-heroes-the-matrix-onlines-soundtrack/http://massively.joystiq.com/2013/03/19/jukebox-heroes-the-matrix-onlines-soundtrack/#commentsFiled under: , , , , ,

Jukebox Heroes The Matrix Online's soundtrack
It's been almost three-and-a-half years since players were forced to unplug from The Matrix Online for the last time, but the memories and music remain. When I first was wowed by The Matrix back in 1999, the dark, action-packed score became an instant favorite of mine. It's a franchise in which the sound is critical to the feel of the films, and it makes sense that this would extend to the MMO.

The makers of MxO went to great lengths to retain the look, story, and audio of the films, which is why the trilogy's composer, Don Davis, was called in to create the music for the game. While the films are more dependent on an orchestra for the score, Davis went with a heavy synth sound for the MMO. It's still quite Matrix-y, however, and pretty dang cool to discover (or discover all over again).

Let's boot up this ancient laptop that I found and see if we can coax a few tunes out of it before Windows 98 shuts down on us for good.

Continue reading Jukebox Heroes: The Matrix Online's soundtrack

MassivelyJukebox Heroes: The Matrix Online's soundtrack originally appeared on Massively on Tue, 19 Mar 2013 19:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>composercomposersfeaturedgame-musicjukeboxjukebox-heroesjustin-olivettimatrixmmo-jukeboxmmo-musicmusicmxoopinionsoesoundtracksoundtracksthe-matrixthe-matrix-onlinewbTue, 19 Mar 2013 19:30:00 EST<![CDATA[Massively Speaking Episode 241: Larry-Boy!]]>http://massively.joystiq.com/2013/03/19/massively-speaking-episode-241-larry-boy/http://massively.joystiq.com/2013/03/19/massively-speaking-episode-241-larry-boy/http://massively.joystiq.com/2013/03/19/massively-speaking-episode-241-larry-boy/#commentsFiled under: , , , , ,

Massively Speaking Episode 241
It's one of the best perks of the job that we can sit back and talk about (a) superheroes, (b) Indiana Jones, (c) VeggieTales, (d) editor-endorsed kidnapping, (e) NES-era games, and (f) deep philosophical topics best reserved for college freshman jaw sessions. And then you get to listen to all of it! How special!

Have a comment for the podcasters? Shoot an email to podcast@massively.com. We may just read your email on the air!

Get the podcast:
[RSS] Add Massively Speaking to your RSS aggregator.
[MP3] Download the MP3 directly.
[iTunes] Subscribe to the podcast in iTunes.
[Stitcher] Follow the podcast on Stitcher Radio.
Listen here on the page:



Read below the cut for the full show notes.

Continue reading Massively Speaking Episode 241: Larry-Boy!

MassivelyMassively Speaking Episode 241: Larry-Boy! originally appeared on Massively on Tue, 19 Mar 2013 09:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>brantbrianna-roycefeaturedhumorindiana-jonesjustin-olivettikidnappingmassively-speakingopinionpodcastpodcastingpodcaststerathe-secret-worldveggietalesTue, 19 Mar 2013 09:30:00 ESTMassively Speaking Episode 241Massively.com Staff01:13:40podcast<![CDATA[Music on the frontier: An interview with WildStar composer Jeff Kurtenacker]]>http://massively.joystiq.com/2013/03/12/music-on-the-frontier-an-interview-with-wildstar-composer-jeff/http://massively.joystiq.com/2013/03/12/music-on-the-frontier-an-interview-with-wildstar-composer-jeff/http://massively.joystiq.com/2013/03/12/music-on-the-frontier-an-interview-with-wildstar-composer-jeff/#commentsFiled under: , , , , , ,

Music on the frontier A talk with WildStar's Jeff Kurtenacker
A great soundtrack has the ability to raise the mundane to memorable and the wonderful to epic. It's hard to imagine films like Star Wars or Back to the Future without their iconic scores or video games like Super Mario Bros. and Final Fantasy without their catchy tunes. So I'm always keen to hear the soundtracks of up-and-coming MMOs because they give me an indication of how much care is being given to the overall quality of the project.

I'm doubly excited for WildStar's score because it's being composed by Jeff Kurtenacker. Kurtenacker produced one of my all-time favorite MMO soundtracks, Pirates of the Burning Sea, which is a playful, exuberant romp through the nautical soundscape. And so far from what we've heard of WildStar's score, we can expect much of the same when we make planetfall on Nexus.

On one drizzly afternoon in a country that you've never heard of, Kurtenacker met with us in a small pub to talk about the joys of creating the music that will soon be infecting the brains of thousands (millions?) of gamers worldwide. Read on, space-man or space-woman, and be astounded!

Continue reading Music on the frontier: An interview with WildStar composer Jeff Kurtenacker

MassivelyMusic on the frontier: An interview with WildStar composer Jeff Kurtenacker originally appeared on Massively on Tue, 12 Mar 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>Adam-Gubmancarbinecarbine-studiosCharley-LanussecomposercomposersDan-Savantfeaturedgame-musicinterviewinterviewsJeff-kurtenackerjukeboxjukebox-heroesjustin-olivettimmo-jukeboxmmo-musicmusicncsoftNick-Baxteropinionpirates-of-the-burning-seasandparksci-fantasysci-fisoundtracksoundtrackswildstarwsTue, 12 Mar 2013 15:00:00 EST<![CDATA[Massively Speaking Episode 240: We ain't no scrubs]]>http://massively.joystiq.com/2013/03/12/massively-speaking-episode-240-we-aint-no-scrubs/http://massively.joystiq.com/2013/03/12/massively-speaking-episode-240-we-aint-no-scrubs/http://massively.joystiq.com/2013/03/12/massively-speaking-episode-240-we-aint-no-scrubs/#commentsFiled under: , , , , ,

Massively Speaking Episode 240
With five kajillion MMOs on the market, Bree and Justin struggle to remember just what's what, some weeks. That may seem like scrub behavior, but they ain't no scrubs; they're professional goof-offs with a master's degree in goofery from Goof State University. It's an exciting podcast full of patches, Kickstarters, compensation, and sandboxy talk.

Have a comment for the podcasters? Shoot an email to podcast@massively.com. We may just read your email on the air!

Get the podcast:
[RSS] Add Massively Speaking to your RSS aggregator.
[MP3] Download the MP3 directly.
[iTunes] Subscribe to the podcast in iTunes.
[Stitcher] Follow the podcast on Stitcher Radio.
Listen here on the page:



Read below the cut for the full show notes.

Continue reading Massively Speaking Episode 240: We ain't no scrubs

MassivelyMassively Speaking Episode 240: We ain't no scrubs originally appeared on Massively on Tue, 12 Mar 2013 10:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>brantbrianna-roycefeaturedhumorjustin-olivettimassively-speakingopinionpodcastpodcastingpodcastsTue, 12 Mar 2013 10:30:00 ESTMassively Speaking Episode 240Massively.com Staff01:09:01podcast<![CDATA[Jukebox Heroes: Soul of the Ultimate Nation's soundtrack]]>http://massively.joystiq.com/2013/03/12/jukebox-heroes-soul-of-the-ultimate-nations-soundtrack/http://massively.joystiq.com/2013/03/12/jukebox-heroes-soul-of-the-ultimate-nations-soundtrack/http://massively.joystiq.com/2013/03/12/jukebox-heroes-soul-of-the-ultimate-nations-soundtrack/#commentsFiled under: , , , ,

Jukebox Heroes Soul of the Ultimate Nation's soundtrack
Yes, you're seeing the header graphic correctly; Howard Shore is the powerhouse behind Soul of the Ultimate Nation's soundtrack. Yes, it's that Howard Shore -- The Lord of the Rings guy (not to mention all of his dozens of other film score projects dating back to 1979). How this smallish MMO was able to attract the likes of Mr. Shore I have no idea, but we're faced with the reality that the game did and this exists.

Other than doing a little double-take when I first found this out, I'm really cool with it. I love it when well-known movie composers dip into video games, such as when Harry Gregson-Williams branched out to do several of the Metal Gear Solid titles. Shore's works are really distinctive and give SUN a sound that's far more "professional" than many of the game's contemporaries.

That said, it's not the best score I've ever heard. It's quite noisy and pulls a little too much from the LotR films. Sometimes composers crib their own works (Harry Potter's music is John William's shameless ripoff of his own Home Alone soundtrack), and that's just how it goes. Let's take a look at an MMO scored by a Hollywood bigshot, shall we?

Continue reading Jukebox Heroes: Soul of the Ultimate Nation's soundtrack

MassivelyJukebox Heroes: Soul of the Ultimate Nation's soundtrack originally appeared on Massively on Tue, 12 Mar 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>composercomposersf2pfeaturedfree-to-playgame-musichoward-shorejukeboxjukebox-heroesjustin-olivettilord-of-the-ringsmmo-jukeboxmmo-musicmusicnhn-gamesopinionsoul-of-the-ultimate-nationsoundtracksoundtrackssunwebzenTue, 12 Mar 2013 09:00:00 EST<![CDATA[PlanetSide 2 rocks: An interview with composer Jeff Broadbent]]>http://massively.joystiq.com/2013/03/10/planetside-2-rocks-an-interview-with-composer-jeff-broadbent/http://massively.joystiq.com/2013/03/10/planetside-2-rocks-an-interview-with-composer-jeff-broadbent/http://massively.joystiq.com/2013/03/10/planetside-2-rocks-an-interview-with-composer-jeff-broadbent/#commentsFiled under: , , , , , ,

PlanetSide 2 rocks An interview with Composer Jeff Broadbent
In this post-Halo age, it's hard to imagine any sort of galactic ground battle happening without a stirring score at your back. So the challenge to the SOE audio team and Composer Jeff Broadbent was formidable: PlanetSide 2's soundtrack had to rock so hard that it would bring tears to the eyes of combat-hardened troops.

Whether or not the musicians and audio team succeeded is, of course, your personal opinion, but it's hard not to be impressed with the end result. Broadbent's worked on a variety of projects spanning video games, TV, and film, but PlanetSide 2 is his first crack at scoring an MMO.

We talked with Broadbent about his inspirations, experiences on the project, and his take on the end result. Read on and be enlightened!

Continue reading PlanetSide 2 rocks: An interview with composer Jeff Broadbent

MassivelyPlanetSide 2 rocks: An interview with composer Jeff Broadbent originally appeared on Massively on Sun, 10 Mar 2013 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>composercomposersfeaturedfpsgame-musicjeff-broadbentjohn-smedleyjukeboxjukebox-heroesjustin-olivettimmo-jukeboxmmo-musicmmo-shootermmofpsmusicopinionplanetsideplanetside-2ps2rodney-gatessandboxsci-fishootersoesonysony-online-entertainmentsoundtracksoundtracksSun, 10 Mar 2013 12:00:00 EST<![CDATA[Jukebox Heroes: Spiral Knights' soundtrack]]>http://massively.joystiq.com/2013/03/05/jukebox-heroes-spiral-knights-soundtrack/http://massively.joystiq.com/2013/03/05/jukebox-heroes-spiral-knights-soundtrack/http://massively.joystiq.com/2013/03/05/jukebox-heroes-spiral-knights-soundtrack/#commentsFiled under: , , ,

Jukebox Heroes Spiral Knights' soundtrack
Wow, talk about a soundtrack that leaped up and bit me on the... earbuds! Sometimes I'm surprised how the smaller MMOs get treated to such lavish score releases while big-name games hoard their music to themselves, but in the case of Spiral Knights, I'm sincerely glad that this two-volume set was put out there for the world to enjoy. It truly is a kickin' project.

Spiral Knights was composed and arranged by Harry Mack (Doctor Who: Worlds in Time, Braid). Mack likes the smaller indie projects, so tackling this was one of his more high-profile works. For this album, Mack said that he was inspired by retro games: "It pulls a lot from the 'sound' of an earlier era, coupled in with more modern, easier-on-the-ears instruments."

The end result is a chirpy, peppy ride through a clockwork MMO, and trust me when I say that I had a hard time narrowing it down to just six picks. I hope that by the end of this column I'll have convinced you to listen to the rest of this terrific score.

Continue reading Jukebox Heroes: Spiral Knights' soundtrack

MassivelyJukebox Heroes: Spiral Knights' soundtrack originally appeared on Massively on Tue, 05 Mar 2013 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>composercomposersf2pfantasyfeaturedfree-to-playgame-musicharry-mackjukeboxjukebox-heroesjustin-olivettimmo-jukeboxmmo-musicmusicopinionpromotionregistered-accountsregistered-playerssci-fantasysci-fisegasoundtracksoundtracksspiral-knightssteamthree-ringsthree-rings-designTue, 05 Mar 2013 20:00:00 EST<![CDATA[Massively Speaking Episode 239: Countdown to terror]]>http://massively.joystiq.com/2013/03/05/massively-speaking-episode-239-countdown-to-terror/http://massively.joystiq.com/2013/03/05/massively-speaking-episode-239-countdown-to-terror/http://massively.joystiq.com/2013/03/05/massively-speaking-episode-239-countdown-to-terror/#commentsFiled under: , , , , ,

Massively Speaking Episode 239
Sunrise, sunset. Some games reach new heights and some crash to the ground. Some questions go unanswered while some developers never stop talking. Some game futures are uncertain while some look more promising by the day. It's another week of MMO news, and some of it is more of the same and some of it is genuinely surprising.

Have a comment for the podcasters? Shoot an email to podcast@massively.com. We may just read your email on the air!

Get the podcast:
[RSS] Add Massively Speaking to your RSS aggregator.
[MP3] Download the MP3 directly.
[iTunes] Subscribe to the podcast in iTunes.
[Stitcher] Follow the podcast on Stitcher Radio.
Listen here on the page:



Read below the cut for the full show notes.

Continue reading Massively Speaking Episode 239: Countdown to terror

MassivelyMassively Speaking Episode 239: Countdown to terror originally appeared on Massively on Tue, 05 Mar 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>brantbrianna-roycefeaturedhumorjustin-olivettimassively-speakingopinionpodcastpodcastingpodcastsTue, 05 Mar 2013 11:00:00 ESTMassively Speaking Episode 239Massively.com Staff01:17:43podcast<![CDATA[Jukebox Heroes: Granado Espada's soundtrack]]>http://massively.joystiq.com/2013/02/26/jukebox-heroes-granado-espadas-soundtrack/http://massively.joystiq.com/2013/02/26/jukebox-heroes-granado-espadas-soundtrack/http://massively.joystiq.com/2013/02/26/jukebox-heroes-granado-espadas-soundtrack/#commentsFiled under: , , , , ,

Jukebox Heroes Granado Espada's soundtrack
So here's an impossible task that lies before me right now: picking one musical genre that defines Granado Espada's score. I can't. It simply cannot be done. I've listened to a lot of soundtracks, my friends, and this game's score is literally all over the place. I don't know how or why the composers chose to toss opera, techno, electronic, international, jazz, and epic fantasy together like a bi-polar salad, but the end result is a nutritious blend of the crazy voices and catchy tunes.

Part of the... diversity on display here is the result of of a collaboration between several composers and one composer group: SoundTeMP, S.F.A., Junsung Kim, and Osamu Kubota. The game's sound department defended the decision to host a variety of composers in an interview, saying, "We took such an ambitious approach with the music in terms of different styles and the sheer quantity that we knew relying solely on a single composer would be inadequate."

Granado Espada has survived several transitions between companies and even a couple of name changes, but its soundtrack has endured just fine. It may be one of the most eccentric soundtracks you'll ever absorb, but at least it's never boring!

Continue reading Jukebox Heroes: Granado Espada's soundtrack

MassivelyJukebox Heroes: Granado Espada's soundtrack originally appeared on Massively on Tue, 26 Feb 2013 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>composercomposersfeaturedgame-musicgranado-espadajukeboxjukebox-heroesJunsung-Kimjustin-olivettimmo-jukeboxmmo-musicmusicopinionOsamu-KubotaSFASoundTeMPsoundtracksoundtrackssword-of-the-new-worldTue, 26 Feb 2013 20:00:00 EST<![CDATA[Massively Speaking Episode 238: Justin at top volume]]>http://massively.joystiq.com/2013/02/26/massively-speaking-episode-238-justin-at-top-volume/http://massively.joystiq.com/2013/02/26/massively-speaking-episode-238-justin-at-top-volume/http://massively.joystiq.com/2013/02/26/massively-speaking-episode-238-justin-at-top-volume/#commentsFiled under: , , , , ,

Massively Speaking Episode 238
Yes, something's gone wonky with Justin's mike and he can't figure out why HIS VOICE IS REALLY LOUD. It's not that he's trying to shout you into submission. Promise. Top Massively engineers are looking into the problem and deeply apologize for any profusely bleeding eardrums that the following awesome podcast may cause.

Have a comment for the podcasters? Shoot an email to podcast@massively.com. We may just read your email on the air!

Get the podcast:
[RSS] Add Massively Speaking to your RSS aggregator.
[MP3] Download the MP3 directly.
[iTunes] Subscribe to the podcast in iTunes.
[Stitcher] Follow the podcast on Stitcher Radio.
Listen here on the page:



Read below the cut for the full show notes.

Continue reading Massively Speaking Episode 238: Justin at top volume

MassivelyMassively Speaking Episode 238: Justin at top volume originally appeared on Massively on Tue, 26 Feb 2013 09:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>brantbrianna-roycefeaturedhumorjustin-olivettimassively-speakingopinionpodcastpodcastingpodcastsTue, 26 Feb 2013 09:30:00 ESTMassively Speaking Episode 238Massively.com Staff01:12:23podcast<![CDATA[Jukebox Heroes: A few of my favorite MMO soundtracks]]>http://massively.joystiq.com/2013/02/19/jukebox-heroes-a-few-of-my-favorite-mmo-soundtracks/http://massively.joystiq.com/2013/02/19/jukebox-heroes-a-few-of-my-favorite-mmo-soundtracks/http://massively.joystiq.com/2013/02/19/jukebox-heroes-a-few-of-my-favorite-mmo-soundtracks/#commentsFiled under: , , , , , , , ,

Jukebox Heroes A few of my favorite soundtracks
I could hear some of you thinking in disbelief last week, "If Age of Conan isn't one of your top MMO scores, what is? And just how much am I not sending you a Christmas card this year, you loser?" You were kind enough to just think it and not say it, but I could hear it even so.

As we've mentioned countless times in this column, musical tastes are subjective. What's appealing to you may not be for me and vice-versa. What more is that musical tastes -- and favorites -- are always shifting around. I listen back to the jams that I enjoyed in the '90s and absolutely pity my younger self for such a deficiency in his musical diet.

So I thought that I'd take a week off our normal soundtrack reviews to bring to you my current top six favorite soundtracks. This list comes with the caveat that it's always subject to future changes as I continue to listen through more soundtracks for this column.

Continue reading Jukebox Heroes: A few of my favorite MMO soundtracks

MassivelyJukebox Heroes: A few of my favorite MMO soundtracks originally appeared on Massively on Tue, 19 Feb 2013 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>activisionage-of-conananetarenanetblizzardblizzard-entertainmentchance-thomascomposercomposerseq2everquest-iif2pfantasyfeaturedfree-to-playgame-musicguild-warsguild-wars-2gwharry-mackhistoricalJeff-Kurtenackerjeremy-soulejukeboxjukebox-heroesjustin-olivettilord-of-the-ringslord-of-the-rings-onlinelotrommo-jukeboxmmo-musicmusicncsoftopinionpiratespirates-of-the-burning-seaportalusportalus-gamespotbsriders-of-rohanrunes-of-magicsandboxsci-fantasysci-fisegasoesonysony-online-entertainmentsoundtracksoundtracksspiral-knightsstar-wars-the-old-republicsteamswtortelonthree-ringsthree-rings-designturbineturbine-entertainmentvanguardvanguard-saga-of-heroesvgwarcraftwildstarwizardry101world-of-warcraftwowTue, 19 Feb 2013 13:00:00 EST<![CDATA[Massively Speaking Episode 237: Mark Jacobs interview]]>http://massively.joystiq.com/2013/02/19/massively-speaking-episode-237-mark-jacobs-interview/http://massively.joystiq.com/2013/02/19/massively-speaking-episode-237-mark-jacobs-interview/http://massively.joystiq.com/2013/02/19/massively-speaking-episode-237-mark-jacobs-interview/#commentsFiled under: , , , , , ,

Massively Speaking Episode 237 Mark Jacobs interview
It's realm vs. realm vs. realm on this week's Massively Speaking: Bree Royce vs. Justin Olivetti vs. Mark Jacobs! Jacobs is continuing his pre-Kickstarter world tour for Camelot Unchained, and he's certainly not shy in talking up its various aspects on the podcast. See how an experienced game dev approaches a new title with plenty of old lessons under his belt.

Have a comment for the podcasters? Shoot an email to podcast@massively.com. We may just read your email on the air!

Get the podcast:
[RSS] Add Massively Speaking to your RSS aggregator.
[MP3] Download the MP3 directly.
[iTunes] Subscribe to the podcast in iTunes.
[Stitcher] Follow the podcast on Stitcher Radio.
Listen here on the page:



Read below the cut for the full show notes.

Continue reading Massively Speaking Episode 237: Mark Jacobs interview

MassivelyMassively Speaking Episode 237: Mark Jacobs interview originally appeared on Massively on Tue, 19 Feb 2013 08:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>brantbrianna-roycecamelotcamelot-unchainedcity-statecity-state-entertainmentcsefeaturedhumorinterviewjustin-olivettimark-jacobsmassively-speakingopinionpodcastpodcastingpodcastspvprvrTue, 19 Feb 2013 08:30:00 ESTMassively Speaking Episode 237Massively.com Staff01:19:05podcast<![CDATA[Jukebox Heroes: Hellgate London's soundtrack]]>http://massively.joystiq.com/2013/02/12/jukebox-heroes-hellgate-londons-soundtrack/http://massively.joystiq.com/2013/02/12/jukebox-heroes-hellgate-londons-soundtrack/http://massively.joystiq.com/2013/02/12/jukebox-heroes-hellgate-londons-soundtrack/#commentsFiled under: , , , ,

Jukebox Heroes Hellgate London's soundtrack
Hellgate London was a title that I was highly anticipating back in the day. It was a post-apocalyptic MMO action-RPG brought to us by the makers of Diablo, all with techno-warriors and jaunts through the London Underground. I was on board with that. Sure, we all know how it ended and will probably kvetch about it in the comments, but I feel comfortable in saying that the concept sounded pretty awesome.

Ironically, the sound is what remained with me long after my days in that game were through. It's no surprise, as the composing duo of Cris Velasco and Sascha Dikiciyan have tackled many other high-profile video game projects together, such as Prototype, Mass Effect 2, and Mass Effect 3.

This score is pretty easy to get a hold of these days (try Amazon). It's a solid pick that has a few great tracks, as long as you're willing to tolerate darker themes.

Continue reading Jukebox Heroes: Hellgate London's soundtrack

MassivelyJukebox Heroes: Hellgate London's soundtrack originally appeared on Massively on Tue, 12 Feb 2013 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>composercomposersCris-Velascof2pfantasyfeaturedfree-to-playgame-musicgothic-fantasyhanbitsofthellgatehellgate-londonHGLjukeboxjukebox-heroesjustin-olivettilondonmmo-jukeboxmmo-musicmusicopinionpost-apocalypticSascha-Dikiciyansoundtracksoundtrackst3funtokyoTue, 12 Feb 2013 17:00:00 EST<![CDATA[Massively Speaking Episode 236: Dueling previews]]>http://massively.joystiq.com/2013/02/12/massively-speaking-episode-236-dueling-previews/http://massively.joystiq.com/2013/02/12/massively-speaking-episode-236-dueling-previews/http://massively.joystiq.com/2013/02/12/massively-speaking-episode-236-dueling-previews/#commentsFiled under: , , , , ,

Massively Speaking Episode 236 Duelling previews
While dueling previews of two exciting upcoming MMOs is an event in and of itself, it's no match for the sheer thrill of listening to Bree and Justin break out the banjos for a no-holds-barred hoedown. Unfortunately, as both co-hosts have yet to learn the banjo, you're only going to get the former today. Try to contain your disappointment.

Have a comment for the podcasters? Shoot an email to podcast@massively.com. We may just read your email on the air!

Get the podcast:
[RSS] Add Massively Speaking to your RSS aggregator.
[MP3] Download the MP3 directly.
[iTunes] Subscribe to the podcast in iTunes.
[Stitcher] Follow the podcast on Stitcher Radio.
Listen here on the page:



Read below the cut for the full show notes.

Continue reading Massively Speaking Episode 236: Dueling previews

MassivelyMassively Speaking Episode 236: Dueling previews originally appeared on Massively on Tue, 12 Feb 2013 10:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>brantbrianna-roycefeaturedhumorjustin-olivettimassively-speakingopinionpodcastpodcastingpodcastsTue, 12 Feb 2013 10:30:00 ESTMassively Speaking Episode 236Massively.com Staff01:19:47podcast<![CDATA[Jukebox Heroes: Age of Conan's soundtrack]]>http://massively.joystiq.com/2013/02/05/jukebox-heroes-age-of-conans-soundtrack/http://massively.joystiq.com/2013/02/05/jukebox-heroes-age-of-conans-soundtrack/http://massively.joystiq.com/2013/02/05/jukebox-heroes-age-of-conans-soundtrack/#commentsFiled under: , , , ,

Jukebox Heroes Age of Conan's soundtrack
I'm going to be honest with you: I've been putting off this particular column for months now. I've been dreading it, really. Because what I say next is probably going to turn off a lot of you who seem to worship this score like nothing else I've seen: I only kind of like Age of Conan's soundtrack. It's not really my favorite, nor in my top 10. And I know that this goes really against the feelings for this score that I've seen professed in Jukebox Heroes and elsewhere.

You know what? That's OK. Musical preferences are some of the most subjective things in the world, and we can't be expected to like everything, right? If Age of Conan's soundtrack gets people listening to more MMO (and even video game) scores, then that's a win for our niche-within-a-niche-within-a-niche hobby.

This score (and all of Age of Conan's subsequent music) was composed by Norwegian Knut Avenstroup Haugen. He won several awards for his work on the game, including the International Film Music Critics Association Award for Scoring Excellence. If you're interested in the man, Massively's Jef Reahard did an interview with him back in 2010 that makes for good reading. Otherwise, let's head onward and I'll share my personal favorites from the original game score!

Continue reading Jukebox Heroes: Age of Conan's soundtrack

MassivelyJukebox Heroes: Age of Conan's soundtrack originally appeared on Massively on Tue, 05 Feb 2013 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>age-of-conanage-of-conan-unchainedaocaoc-unchainedcomposercomposersconanf2pfantasyfeaturedfree-to-playfuncomgame-musichyboriajukeboxjukebox-heroesjustin-olivettiknut-avenstroup-haugenknut-haugenmmo-jukeboxmmo-musicmusicopinionsoundtracksoundtracksTurbonegrounchainedTue, 05 Feb 2013 13:00:00 EST