Massively http://massively.joystiq.com Massively http://www.blogsmithmedia.com/http://massively.joystiq.com/media/feedlogo.gif Massively http://massively.joystiq.com en-us Copyright 2012 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[Free for All: Istaria's updates, community, and future development]]>http://massively.joystiq.com/2012/05/23/free-for-all-istarias-updates-community-and-future-developme/http://massively.joystiq.com/2012/05/23/free-for-all-istarias-updates-community-and-future-developme/http://massively.joystiq.com/2012/05/23/free-for-all-istarias-updates-community-and-future-developme/#commentsFiled under: , , , , , , ,

Istaria concept art
Before anyone asks in the comments section: Yes, Istaria is still around. I've noticed that many players seem to think if something is out of their sight, it's out of every other player's mind too, but the truth is that there are many, many smallish and indie MMOs in existence that not only continue to do well but offer unique gameplay for anyone who might be interested. Istaria is even still referred to as Horizons by many, even though that change was made a long, long time ago. Despite all of the outdated opinions and its status as an "older" game, interesting things are happening in the world of Istaria.

I took some time and asked Amarie Ancalimon, Community Relations manager from Virtrium, about the latest string of patches and updates. I got plenty of information back, so let's get to it!

Continue reading Free for All: Istaria's updates, community, and future development

MassivelyFree for All: Istaria's updates, community, and future development originally appeared on Massively on Wed, 23 May 2012 22:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>amarie-ancalimonbeau-hindmandragonsf2pfeaturedffafree-for-allfree-to-playfreemiumhorizonsinterviewinterviewsistariaopinionvelvet-ropevirtriumWed, 23 May 2012 22:00:00 EST<![CDATA[The Old Republic interview on patch 1.3 covers LFG, perks, and gear]]>http://massively.joystiq.com/2012/05/23/the-old-republic-interview-on-patch-1-3-covers-lfg-perks-and-g/http://massively.joystiq.com/2012/05/23/the-old-republic-interview-on-patch-1-3-covers-lfg-perks-and-g/http://massively.joystiq.com/2012/05/23/the-old-republic-interview-on-patch-1-3-covers-lfg-perks-and-g/#commentsFiled under: , , , ,

SWTOR
Star Wars: The Old Republic is gonna get some mighty fine updates with the onset of patch 1.3. Game Designer Daniel Erickson had a chat with PC Gamer to shed some light on the changes in the upcoming patch.

Players in SWTOR don't like standing still. As Erickson says: "You can craft on the move, run [war zones] from anywhere, and basically never slow down -- except when looking for a group." To put an end to that difficulty, 1.3 will include a LFG interface that players can use to find a pick-up group to run with (except for Hard Mode Operations, which aren't really designed for uncoordinated PUGs). The tool won't work cross-server, but that's because the dev team is looking to move to servers with a much, much higher population cap in the near future.

The patch will add new perks to the legacy system, most of which are aimed at customizing the way players level their alts. With a high enough legacy and enough credits, players could use XP perks to skip side quests altogether, although Erickson points out that that there are perks for Bonus Series quests that may tempt players to visit planets they've previously left alone.

The last bundle of tidings of great joy for the patch is directed at gear. There's a fine balance between freedom of dress and the importance of visual distinction, and SWTOR aims to find it by allowing "social gear" to be worn anywhere. Additionally, "almost every single item in the game" will get customization options thanks to augment slots. Players can use augment slots on gear to add, well, augments, which will allow them to further customize their character and playstyle.

MassivelyThe Old Republic interview on patch 1.3 covers LFG, perks, and gear originally appeared on Massively on Wed, 23 May 2012 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>1.3biowaredaniel-ericksoneaelectronic-artsinterviewinterviewslegacylucasartspatchpatch-1.3pc-gamersci-fistar-warsstar-wars-the-old-republicsubsubscription-feeswtorthe-old-republictorupdateupdate-1.3Wed, 23 May 2012 18:00:00 EST<![CDATA[MMObility: An exclusive look at the Runespan in RuneScape]]>http://massively.joystiq.com/2012/05/18/mmobility-an-exclusive-look-at-the-runespan-in-runescape/http://massively.joystiq.com/2012/05/18/mmobility-an-exclusive-look-at-the-runespan-in-runescape/http://massively.joystiq.com/2012/05/18/mmobility-an-exclusive-look-at-the-runespan-in-runescape/#commentsFiled under: , , , , , , , , , , , , ,

RuneScape screenshot
Jagex, developer of the ever-popular browser-based game RuneScape, is known for its rapid development schedule. Heck, I fully expect that this article will be outdated by the time I finish its rough draft. Players of the Jagex flagship MMO can log in to find new items, places to explore, and quests to do almost weekly. I tend to poke my nose into the game several times a week, so I know that a more casual player has endless amounts of content to run through. I might level up my construction skill and then switch to something completely different. I just recently spent an afternoon playing with just the new bonfire skill.

Of course, those pesky developers are at it again: giving me more content to go through even though my highest skills hover around only the level 40 mark. This time it's the Runespan, a brand-new area that helps players level runecrafting by offering them a one-stop shop that is more casual and non-competitive than the normal runecraft experience.

I got the chance to call up some of the lead developers on the phone and ask not only about the Runespan but about the new FPS improvements, so be sure to check that out!

Continue reading MMObility: An exclusive look at the Runespan in RuneScape

MassivelyMMObility: An exclusive look at the Runespan in RuneScape originally appeared on Massively on Fri, 18 May 2012 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>beau-hindmanbrowserbrowser-basedclassic-mmof2pfantasyfeaturedfree-to-playinterviewinterviewsjagexjagex-games-studiommobilitymobilemobile-gamingmobile-mmoopinionphonepreviewpreviewsrsrunescapesandboxsmartphonethe-runespanFri, 18 May 2012 19:00:00 EST<![CDATA[The Firing Line: World of Warplanes producer talks matchmaking, progression]]>http://massively.joystiq.com/2012/05/18/the-firing-line-world-of-warplanes-producer-talks-matchmaking/http://massively.joystiq.com/2012/05/18/the-firing-line-world-of-warplanes-producer-talks-matchmaking/http://massively.joystiq.com/2012/05/18/the-firing-line-world-of-warplanes-producer-talks-matchmaking/#commentsFiled under: , , , , , , , , , , ,

The Firing Line - World of Warplanes producer interview
Last week I talked a bit about a couple of flight sim shooters coming soon to a PC near you. One of them is World of Warplanes, the followup title to Wargaming.net's ubiquitous World of Tanks hit.

The World War II action MMO masters are slipping the surly bonds of earth with a new lobby-based battler that's currently flying through the early phases of its global alpha test. I had a few burning questions for the devs, including specifics on the matchmaking system, progression, and the possibility of historical scenarios. Producer Anton Sitnikau was gracious enough to answer those and more, so head past the break to see what he had to say.

Continue reading The Firing Line: World of Warplanes producer talks matchmaking, progression

MassivelyThe Firing Line: World of Warplanes producer talks matchmaking, progression originally appeared on Massively on Fri, 18 May 2012 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>anton-sitnikauexclusivef2pfeaturedfpsfree-to-playhistoricalinterviewinterviewsmassively-exclusivematchmakingmmofpsopinionplaneplanespvptflthe-firing-linethird-person-shootertpswarwargaming.netwargaming.net-matchmakingwarplanewarplanesworld-of-warplanesworld-of-warplanes-interviewworld-of-warplanes-matchmakingworld-of-warplanes-producer-interviewwowpwowp-interviewwowp-matchmakingFri, 18 May 2012 13:00:00 EST<![CDATA[Exclusive Interview: Going global with Fallen Earth's PvP]]>http://massively.joystiq.com/2012/05/17/exclusive-interview-going-global-with-fallen-earths-pvp/http://massively.joystiq.com/2012/05/17/exclusive-interview-going-global-with-fallen-earths-pvp/http://massively.joystiq.com/2012/05/17/exclusive-interview-going-global-with-fallen-earths-pvp/#commentsFiled under: , , , , , , ,

Fallen Earth
Two of the biggest cornerstones of Fallen Earth have always been crafting and PvP, and its these cornerstones that GamersFirst is enriching come patch 2.4. The patch, called Global Territory Control, is taking these elements and firing them up in ways that any PvPer or crafter should find exciting.

We hopped on the phone with Associate Producer Asa Reed, Director of Operations Joe Willmon, and Senior Game Designer Marie Croall to talk about why 2.4 will be the patch that will change the wasteland forever -- and why you should anticipate it, whether you're a crafter or a player-killer.

Gallery: Fallen Earth Black Box Gear

Continue reading Exclusive Interview: Going global with Fallen Earth's PvP

MassivelyExclusive Interview: Going global with Fallen Earth's PvP originally appeared on Massively on Thu, 17 May 2012 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2.4asa-reedcraftingf2pfaction-controlfallen-earthfefree-to-playg1gamersfirstglobal-territory-controlharvesterharvestersharvestinginterviewinterviewsJoe-Willmonkeepkeepsmarie-croallpatch-2.4post-apocpost-apocalypticpreviewpvpresourcessandboxsci-fiwastelandsThu, 17 May 2012 18:30:00 EST<![CDATA[The Anvil of Crom: Age of Conan turns four, taps SWG for crafting inspiration]]>http://massively.joystiq.com/2012/05/17/the-anvil-of-crom-age-of-conan-turns-four-taps-swg-for-craftin/http://massively.joystiq.com/2012/05/17/the-anvil-of-crom-age-of-conan-turns-four-taps-swg-for-craftin/http://massively.joystiq.com/2012/05/17/the-anvil-of-crom-age-of-conan-turns-four-taps-swg-for-craftin/#commentsFiled under: , , , , , , , , ,

The Anvil of Crom - Age of Conan turns four, looks to Star Wars Galaxies for inspiration
The last time I did an anniversary retrospective for Age of Conan, we had a recent expansion, some new dungeon content, and several class revamps fresh on our minds. The year before that, we had the earth-shaking combat and itemization changes. This past year, the major development was, of course, the switch to a freemium business model, followed closely by the game's first adventure pack.

Join me after the break for a quick rundown on the last 12 months as they happened in Hyboria, as well as an anniversary interview with game director Craig "Silirrion" Morrison that sheds a bit of light on the crafting revamp.

Continue reading The Anvil of Crom: Age of Conan turns four, taps SWG for crafting inspiration

MassivelyThe Anvil of Crom: Age of Conan turns four, taps SWG for crafting inspiration originally appeared on Massively on Thu, 17 May 2012 10:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>age-of-conanage-of-conan-craftingage-of-conan-star-wars-galaxiesage-of-conan-unchainedanniversaryanvil-of-cromanvil-of-crom-interviewsanvil-of-crom-specialanvil-of-crom-specialsaocaoc-anniversaryaoc-craftingaoc-interviewaoc-unchainedclassic-mmoconancraftingcraig-morrisonf2pfantasyfeaturedfree-to-playfuncomgalaxieshyboriainterviewinterviewsopinionsandboxsci-fisilirrionsoesony-online-entertainmentstar-warsstar-wars-galaxiesswgswgothe-anvil-of-cromThu, 17 May 2012 10:30:00 EST<![CDATA[Swashbucklers, ships, and high seas hijinks: KingsIsle talks Pirate101]]>http://massively.joystiq.com/2012/05/15/swashbucklers-ships-and-high-seas-hijinks-kingsisle-talks-pir/http://massively.joystiq.com/2012/05/15/swashbucklers-ships-and-high-seas-hijinks-kingsisle-talks-pir/http://massively.joystiq.com/2012/05/15/swashbucklers-ships-and-high-seas-hijinks-kingsisle-talks-pir/#commentsFiled under: , , , , ,

Pirate101
Recently, KingsIsle announced that the world of the Spiral was going to branch out into the high seas in the studio's newest MMO, Pirate101. There are many things about Pirate101 that will feel familiar to Wizard101 fans, but the game has several features that definitely make it stand apart as more than just a sequel. Combat is not card-based; it's more like a tactical board game. Companions, rather than trading cards, play a key role in the pirate arsenal, and of course, players will be traveling (and fighting!) on their very own pirate ships.

Massively had a chance to talk with Pirate101's Lead Creative Designer Sam Johnson to hear more about what players will see from KingsIsle's upcoming MMO. So grab your cutlass, don your tricorne, and read on for more details!

Continue reading Swashbucklers, ships, and high seas hijinks: KingsIsle talks Pirate101

MassivelySwashbucklers, ships, and high seas hijinks: KingsIsle talks Pirate101 originally appeared on Massively on Tue, 15 May 2012 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>f2pfamilyfantasyfeaturedfree-to-playinterviewinterviewskid-friendlykids-mmokingsislekingsisle-entertainmentpirate101sam-johnsonthe-spiralwizard101Tue, 15 May 2012 18:00:00 EST<![CDATA[Storybricks demo and interview with Brian 'Psychochild' Green and Kelly Heckman]]>http://massively.joystiq.com/2012/05/14/storybricks-demo-and-interview-with-brian-psychochild-green-an/http://massively.joystiq.com/2012/05/14/storybricks-demo-and-interview-with-brian-psychochild-green-an/http://massively.joystiq.com/2012/05/14/storybricks-demo-and-interview-with-brian-psychochild-green-an/#commentsFiled under: , , , , ,

Screenshot -- Storybricks
Namaste Entertainment's upcoming MMO-narrative-building toolset, Storybricks, is quickly picking up steam among the massively multiplayer gaming community. The quirky title recently released a public alpha client to coincide with the project's Kickstarter campaign, and I had the opportunity to sit down with Namaste's Brian "Psychochild" Green and Kelly Heckman for a tour of the client as well as a short interview on what the future holds for the toolbox-cum-MMOG project.

Follow on past the cut and join me as I try to pinpoint Namaste's goals for the future of Storybricks.

Continue reading Storybricks demo and interview with Brian 'Psychochild' Green and Kelly Heckman

MassivelyStorybricks demo and interview with Brian 'Psychochild' Green and Kelly Heckman originally appeared on Massively on Mon, 14 May 2012 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alphaalphasbrian-greenbrian-psychochild-greeninterviewinterviewskelly-heckmannamastenamaste-entertainmentnamaste-incpreviewpreviewspsychochildstorybricksMon, 14 May 2012 17:00:00 EST<![CDATA[Wizard101 fansite owner hired to be Pirate101's community manager]]>http://massively.joystiq.com/2012/05/09/wizard101-fansite-owner-hired-to-be-pirate101s-community-manage/http://massively.joystiq.com/2012/05/09/wizard101-fansite-owner-hired-to-be-pirate101s-community-manage/http://massively.joystiq.com/2012/05/09/wizard101-fansite-owner-hired-to-be-pirate101s-community-manage/#commentsFiled under: , , , , ,

The Friendly Necromancer logo
Tom Purdue, admired owner and operator of The Friendly Necromancer blog and Wizard101 fansite, has announced today that he will be KingsIsle Entertainment's new community manager for the upcoming Pirate101 MMO.

As that transition from fan to employee is always a fascinating transformation, we recognize that it's not an easy decision. Massively itself has raised a handful of MMO community managers, so this news is particularly of interest to us. For that reason, we tracked Tom down and asked him some questions about his new role at KingsIsle. Follow along below for the complete interview.

Continue reading Wizard101 fansite owner hired to be Pirate101's community manager

MassivelyWizard101 fansite owner hired to be Pirate101's community manager originally appeared on Massively on Wed, 09 May 2012 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>community-managerdream-come-truef2pfamilyfansitefantasyfree-to-playinterviewinterviewskid-friendlykids-mmokingsislekingsisle-entertainmentpirate101the-friendly-necromancertom-purduetransitionwizard101Wed, 09 May 2012 13:00:00 EST<![CDATA[Cryptic Studios' Andy Velasquez talks Neverwinter]]>http://massively.joystiq.com/2012/05/07/cryptic-studios-andy-velasquez-talks-neverwinter/http://massively.joystiq.com/2012/05/07/cryptic-studios-andy-velasquez-talks-neverwinter/http://massively.joystiq.com/2012/05/07/cryptic-studios-andy-velasquez-talks-neverwinter/#commentsFiled under: , , , ,

Screenshot -- Neverwinter
Would-be citizens of Neverwinter are certainly waiting anxiously for Cryptic Studios' upcoming venture into the Jewel of the North, which we received favorably at PAX East last month. Well, unfortunately we're going to have to wait a bit longer, but in the mean time, MMORPG.com has a new interview with Neverwinter's Lead Producer, Andy Velasquez, to shine some light on the most civilized city in Faerun.

Velasquez answers questions on a number of topics, including the decision to use 4th edition rules, the amount of content that will be available at launch, and the difference between a raid and a Dungeon Delve. It's definitely worth a read for anyone interested in the upcoming title, so if you're one of those people, head on over to the full interview and give it a look.

MassivelyCryptic Studios' Andy Velasquez talks Neverwinter originally appeared on Massively on Mon, 07 May 2012 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>4e4th-editionaction-mmoandy-velasquezcrypticcryptic-studiosdnddungeon-delvef2pfantasyfree-to-playinterviewinterviewsneverwinterperfect-worldperfect-world-entertainmentpweMon, 07 May 2012 18:00:00 EST<![CDATA[EVE producer: F2P converts were 'failing,' subs still viable]]>http://massively.joystiq.com/2012/05/03/eve-producer-f2p-converts-were-failing-subs-still-viable/http://massively.joystiq.com/2012/05/03/eve-producer-f2p-converts-were-failing-subs-still-viable/http://massively.joystiq.com/2012/05/03/eve-producer-f2p-converts-were-failing-subs-still-viable/#commentsFiled under: , , , , , , , , , ,

EVE Online - ship trio
The death of the subscription model has been greatly exaggerated, according to CCP. This view isn't terribly surprising if you consider the fact that the company's fortunes ebb and flow with sub-based EVE Online. What is somewhat surprising is the frankness with which EVE producer Jon Lander talks about the free-to-play mania that's gripped western dev studios in recent years.

"You look at the companies who did go free-to-play. They retrofitted it on, and that was because their games were failing. They didn't care about the tiny nugget of players who were still playing, because they knew they would get a huge number of other players and it would be more profitable," Lander told PC Gamer, before going on to explain how such a retrofit would kill EVE's essence.

Overall quality and the desire for long-term play also factor into a title's business model, Lander says. "If you have a really good game [...] and people want to spend a long time playing it, not like a month or two but like EVE players for years at a time, they're prepared to pay a subscription fee for a good quality gaming experience."

He also mentions EVE's PLEX system, which allows for real-world money to be injected into the EVE economy sans shady third-party brokers. And of course, CCP is experimenting with free-to-play via its new DUST 514 shooter, which Lander says was built from the ground up for the new business model. It's not necessarily the future, though. "People say the subscription MMO is dead. I fundamentally disagree with that. It's simply not the case," he says. Hit the jump for video excerpts from the interview.

Continue reading EVE producer: F2P converts were 'failing,' subs still viable

MassivelyEVE producer: F2P converts were 'failing,' subs still viable originally appeared on Massively on Thu, 03 May 2012 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>business-modelsccpccp-gamesconsoledustdust-514eveeve-onlinefpsinternet-spaceshipsinterviewsjon-landermmofpsplaystationplaystation-3ps3sandboxsci-fishooterspreadsheets-onlinevideoThu, 03 May 2012 13:00:00 EST<![CDATA[Matt Higby discusses PlanetSide 2's progression and customization]]>http://massively.joystiq.com/2012/05/02/matt-higby-discusses-planetside-2s-progression-and-customizatio/http://massively.joystiq.com/2012/05/02/matt-higby-discusses-planetside-2s-progression-and-customizatio/http://massively.joystiq.com/2012/05/02/matt-higby-discusses-planetside-2s-progression-and-customizatio/#commentsFiled under: , , , , , ,

I'm not actually in the war, I just like riding this ATV.
PlanetSide 2 has but one real game it must live up to, but if you consider the unique elements that its predecessor brought to the table, that's still a tall order. A recent interview with the game's creative director, Matt Higby, highlights the ways that the game is being designed to fulfill the requirements of an engaging MMO and an engaging FPS. That means giving characters plenty of progression without locking out new players who just want to shoot things.

The game's overall progression path is meant to be one of options, not straight power. That's the case for classes as well as advancement; Heavy Assault characters will play distinctly from other classes, but they'll have a variety of unique abilities that players can choose among. The interview also sheds more light on what players can expect from the game's overarching persistent elements, which set the game and its factions apart from standard FPS fare. The game still has a long way to go in development, but what's been shown thus far is definitely an encouraging start.

MassivelyMatt Higby discusses PlanetSide 2's progression and customization originally appeared on Massively on Wed, 02 May 2012 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>developmentfpsinterviewsmatt-higbymmo-shootermmofpsnew-titlesplanetsideplanetside-2previewsps2sci-fishootersoesonysony-online-entertainmentupcoming-titlesWed, 02 May 2012 17:00:00 EST<![CDATA[Captain's Log: Interview with Star Trek Online lead writer Christine Thompson, part two]]>http://massively.joystiq.com/2012/04/30/captains-log-interview-with-star-trek-online-lead-writer-chris/http://massively.joystiq.com/2012/04/30/captains-log-interview-with-star-trek-online-lead-writer-chris/http://massively.joystiq.com/2012/04/30/captains-log-interview-with-star-trek-online-lead-writer-chris/#commentsFiled under: , , , , ,

Cryptic Studios
This week brings to an end my series of interview with Cryptic Studios representatives. We conclude with the second half of my interview with Christine Thompson, lead writer for Star Trek Online.

Thompson confirmed that she essentially writes everything in STO. She admits that she gets some help, sometimes from developers who prefer to write their own work, but she says she writes 90% of everything in the game.

The conversation picked back up with a focus on The Foundry, the user-generated content tool available to players in STO. I asked her if she had any direct advice for authors who use the Foundry to create missions and maps and social zones in the game. She said, "Authors "shouldn't be afraid to tell the stories they want to tell. That's one of the joys of The Foundry. And they should also know not every story is going to work for everybody. Some things people will love, and some things people won't. Use Of Bajor for example. I really enjoyed that episode. We took a chance and did something completely different with that episode, and I liked telling a Bajoran story. But for every person who liked that episode, there was somebody saying" -- and here she dropped her voice to a hoarse whisper -- "oh dear god, why can't I just shoot something?!"

Continue reading Captain's Log: Interview with Star Trek Online lead writer Christine Thompson, part two

MassivelyCaptain's Log: Interview with Star Trek Online lead writer Christine Thompson, part two originally appeared on Massively on Mon, 30 Apr 2012 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>captains-logChristine-Thompsoncrypticcryptic-studiosf2pfeaturedfree-to-playinterviewinterviewsj-michael-straczynskiopinionperfect-worldperfect-world-entertainmentpwesci-fistar-trekstar-trek-mmostar-trek-onlinestoMon, 30 Apr 2012 13:00:00 EST<![CDATA[Captain's Log: Interview with Star Trek Online lead writer Christine Thompson, part one]]>http://massively.joystiq.com/2012/04/23/captains-log-interview-with-star-trek-onlines-lead-writer-chr/http://massively.joystiq.com/2012/04/23/captains-log-interview-with-star-trek-onlines-lead-writer-chr/http://massively.joystiq.com/2012/04/23/captains-log-interview-with-star-trek-onlines-lead-writer-chr/#commentsFiled under: , , , , ,

Image
Today Captain's Log continues with the first of two installments of my interview with Christine Thompson, Star Trek Online's lead writer at Cryptic Studios!

I began the discussion by asking Thompson about her background as a writer and journalist before she began working for Cryptic. She stated that she had held positions as a reporter, editor, page designer, and wire editor for 13 years, after which she found herself in a position of "either having to move up into management or having to find something else to do."

Yet she spent a lot of her personal time playing MMOs, reading comic books and fantasy novels, and watching Star Trek. Since she had to find a new career anyway, she thought, "Why not find a career I actually enjoy?" That's when she began to look for writing positions in the gaming industry.

Continue reading Captain's Log: Interview with Star Trek Online lead writer Christine Thompson, part one

MassivelyCaptain's Log: Interview with Star Trek Online lead writer Christine Thompson, part one originally appeared on Massively on Mon, 23 Apr 2012 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>captains-logChristine-Thompsoncrypticcryptic-studiosf2pfeaturedfree-to-playinterviewinterviewsopinionperfect-worldperfect-world-entertainmentpwesci-fistar-trekstar-trek-mmostar-trek-onlinestar-wars-the-old-republicstostoryswtorwritingMon, 23 Apr 2012 19:00:00 EST<![CDATA[Take a behind-the-scenes tour of ArenaNet's (totally awesome) offices]]>http://massively.joystiq.com/2012/04/23/take-a-behind-the-scenes-tour-of-arenanets-totally-awesome-of/http://massively.joystiq.com/2012/04/23/take-a-behind-the-scenes-tour-of-arenanets-totally-awesome-of/http://massively.joystiq.com/2012/04/23/take-a-behind-the-scenes-tour-of-arenanets-totally-awesome-of/#commentsFiled under: , , ,

I want to go to there.
Guild Wars 2 fans are surely champing at the bit to get their hands on the game next week in the game's first public beta weekend, but you know what's cooler than taking part in GW2's beta weekends? Doing so at ArenaNet's offices in Seattle, which is exactly what the folks at Eurogamer got to do just recently.

Not only did they get the opportunity to sit down and play the Guild Wars 2 beta with the team, but they also got the chance to chat with many of the key figures behind it all. Virtually every department of development is represented in the lengthy article, which includes interviews with head honcho Mike O'Brien, QA manager Mike Zadorojny, art director Daniel Dociu, lead content designer Colin Johanson, and many, many more. So if you're interested in a behind-the-scenes look at the studio behind what could be this year's biggest MMO, just head on over and check out the full piece.

MassivelyTake a behind-the-scenes tour of ArenaNet's (totally awesome) offices originally appeared on Massively on Mon, 23 Apr 2012 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>anetarenanetbehind-the-scenescolin-johansondaniel-dociufantasyguild-wars-2gw2interviewinterviewsmike-obrienmike-zmike-zadorojnyncsoftstudioMon, 23 Apr 2012 15:00:00 EST<![CDATA[Captain's Log: Interview with Star Trek Online's Executive Producer, Daniel Stahl]]>http://massively.joystiq.com/2012/04/16/captains-log-interview-with-star-trek-onlines-executive-produ/http://massively.joystiq.com/2012/04/16/captains-log-interview-with-star-trek-onlines-executive-produ/http://massively.joystiq.com/2012/04/16/captains-log-interview-with-star-trek-onlines-executive-produ/#commentsFiled under: , , , , , ,

Image
Next in this series of interviews conducted on my visit to Cryptic Studios in Los Gatos, California, last month is a chat with Daniel Stahl, Executive Producer of Star Trek Online.

I first asked Stahl to give me an overview of his responsibilities as Executive Producer, as there are many people who are either new to STO (or even to gaming overall) who may not have a clear understanding of his role entails.

He stated his job is "similar to making movies." He has several direct reports, the first being the software person or the person responsible for the team of people who actually create the code for the game. The second is the Content Lead, who is responsible for new missions, new features, and anything to with player experience. Finally, the Quality Assurance team also reports to him.

Continue reading Captain's Log: Interview with Star Trek Online's Executive Producer, Daniel Stahl

MassivelyCaptain's Log: Interview with Star Trek Online's Executive Producer, Daniel Stahl originally appeared on Massively on Mon, 16 Apr 2012 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>captains-logchampions-onlinecrypticcryptic-studiosdan-stahldaniel-stahlf2pfeaturedfree-to-playinterviewinterviewslord-of-the-rings-onlinelotroopinionperfect-worldperfect-world-entertainmentpwesci-fistar-trekstar-trek-mmostar-trek-onlinestoturbineTurbine-EntertainmentMon, 16 Apr 2012 16:00:00 EST<![CDATA[A land corrupted and a city under seige: A look at GU63 with the EQII team]]>http://massively.joystiq.com/2012/04/15/a-land-corrupted-and-a-city-under-seige-a-look-at-gu63-with-the/http://massively.joystiq.com/2012/04/15/a-land-corrupted-and-a-city-under-seige-a-look-at-gu63-with-the/http://massively.joystiq.com/2012/04/15/a-land-corrupted-and-a-city-under-seige-a-look-at-gu63-with-the/#commentsFiled under: , , , , , , , , , ,

Lumpy
This coming Tuesday, EverQuest II will launch Game Update 63, and with it comes a bevy of dragons, new content, a level cap increase, and much more. Recently, EQII Producer Holly "Windstalker" Longdale and Game Designer Carlos "Gninja" Mora took the time to talk about the update and lead a tour of the new zones. Read on for a closer look at the Withered Lands and Skyshrine!

Gallery: EverQuest II Game Update 63

Continue reading A land corrupted and a city under seige: A look at GU63 with the EQII team

MassivelyA land corrupted and a city under seige: A look at GU63 with the EQII team originally appeared on Massively on Sun, 15 Apr 2012 23:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>eq-2eq-iieq2eqiieverquest-2everquest-iif2pfantasyfeaturedfree-to-playgalleriesgallerygame-update-63honvarinterviewinterviewskval-ruinslendiniarapoets-palace-dungeon-makerpreviewpreviewsscreenshotscreenshotsskyshrinesoesonysony-online-entertainmenttradeskill-apprenticestrailertrailersvideovideosvyksudrawithered-landsyelinakSun, 15 Apr 2012 23:00:00 EST<![CDATA[Champions Online's On Alert launches, we interview Rob Overmeyer]]>http://massively.joystiq.com/2012/04/13/rob-overmeyer-discusses-new-changes-coming-for-champions-online/http://massively.joystiq.com/2012/04/13/rob-overmeyer-discusses-new-changes-coming-for-champions-online/http://massively.joystiq.com/2012/04/13/rob-overmeyer-discusses-new-changes-coming-for-champions-online/#commentsFiled under: , , , , ,

Champions Online screenshot
There's been a big buzz for the latest update to Champions Online. The entire game is undergoing a significant overhaul for the newest expansion, On Alert, which has just gone live today. The developers are adding in talent trees for player heroes as well as a dramatic overhaul of the way equipment works.

We sat down with Rob Overmeyer, executive producer for Champions, and asked him a few questions about the update and what it will mean for Millennium City's superhero population. Naturally, he had a lot to say!

Continue reading Champions Online's On Alert launches, we interview Rob Overmeyer

MassivelyChampions Online's On Alert launches, we interview Rob Overmeyer originally appeared on Massively on Fri, 13 Apr 2012 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alertalertschampionschampions-onlinechampscocrypticcryptic-studiosf2pfeaturedfree-to-playinterviewinterviewson-alertperfect-worldperfect-world-entertainmentpwerob-overmeyersuperherosuperheroesFri, 13 Apr 2012 15:00:00 EST<![CDATA[Captain's Log: Interview with Cryptic's Al Rivera, part three]]>http://massively.joystiq.com/2012/04/09/captains-log-interview-with-cryptics-al-rivera-part-three/http://massively.joystiq.com/2012/04/09/captains-log-interview-with-cryptics-al-rivera-part-three/http://massively.joystiq.com/2012/04/09/captains-log-interview-with-cryptics-al-rivera-part-three/#commentsFiled under: , , , , , , , ,

Image
Today Captain's Log continues with the third and final installment of my interview with Al Rivera, Star Trek Online's Lead Designer at Cryptic Studios!

Rivera and I picked up the conversation and talked briefly about the Why I Play STO column that I wrote several weeks ago. I informed him that because of that column, I had received a few emails from brand-new MMO players who expressed frustration over the fact that as new free-to-play players, they weren't immediately allowed into the parts of the game that would give them access to the community, especially fleets, right off the bat.

Continue reading Captain's Log: Interview with Cryptic's Al Rivera, part three

MassivelyCaptain's Log: Interview with Cryptic's Al Rivera, part three originally appeared on Massively on Mon, 09 Apr 2012 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>al-riveracaptains-logcrypticcryptic-studiosf2pfeaturedfree-to-playinterviewinterviewsneverwinteropinionperfect-worldperfect-world-entertainmentpwesci-fistar-trekstar-trek-mmostar-trek-onlinestoMon, 09 Apr 2012 14:00:00 EST<![CDATA[PAX East 2012: Menace of the Underdark brings big changes to Dungeons and Dragons Online]]>http://massively.joystiq.com/2012/04/07/pax-east-2012-menace-of-the-underdark-brings-big-changes-to-dun/http://massively.joystiq.com/2012/04/07/pax-east-2012-menace-of-the-underdark-brings-big-changes-to-dun/http://massively.joystiq.com/2012/04/07/pax-east-2012-menace-of-the-underdark-brings-big-changes-to-dun/#commentsFiled under: , , , , , , , , ,

Dungeons and Dragons Online concept art
Dungeons and Dragons Online players are in for a whole new world of adventure when Menace of the Underdark launches this summer. The expansion, due to release on June 25th, will send players into the Forgotten Realms to fight against the Queen of Spiders, Lolth. Executive Producer Fernando Paiz and Senior Producer Eric Boyer welcomed us into their lair... er, Turbine's booth... to talk about the upcoming expansion at this year's PAX East. Read on for our preview!

Continue reading PAX East 2012: Menace of the Underdark brings big changes to Dungeons and Dragons Online

MassivelyPAX East 2012: Menace of the Underdark brings big changes to Dungeons and Dragons Online originally appeared on Massively on Sat, 07 Apr 2012 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>conconventionddodnddungeons-and-dragonsdungeons-and-dragons-onlineeric-boyerexpansionexpof2pfantasyfeaturedfernando-paizfree-to-playinterviewinterviewsmenace-of-the-underdarkpaxpax-2012pax-eastpax-east-2012penny-arcade-expopreviewpreviewsturbineturbine-entertainmentSat, 07 Apr 2012 12:00:00 EST<![CDATA[PAX East 2012: World of Warplanes impressions]]>http://massively.joystiq.com/2012/04/06/pax-east-2012-world-of-warplanes-impressions/http://massively.joystiq.com/2012/04/06/pax-east-2012-world-of-warplanes-impressions/http://massively.joystiq.com/2012/04/06/pax-east-2012-world-of-warplanes-impressions/#commentsFiled under: , , , , , , , , , , , , ,

This is a game about basketball.
Much like its predecessor, World of Warplanes is not a game with an ambiguous title. This is a game about planes, and not the sort that flies cargo from one point on the globe to another. If flying around and getting into aerial dogfights sounds like an unappealing concept to you, well, you can pretty much just exit stage left when you hear the name.

But the lack of subtlety in the name, however noteworthy, doesn't really say much about the game itself. Is it fun to play? Does it succeed in what it sets out to do? Really, is it just World of Tanks up in the air? I can't speak to the last one, but I can say that it definitely delivers on its stated design goals. This is a game all about maximizing the rush of an aerial fight and striking a balance between crafting an in-depth flight simulation and providing accessibility to those new to the genre.

Gallery: World of Warplanes

Continue reading PAX East 2012: World of Warplanes impressions

MassivelyPAX East 2012: World of Warplanes impressions originally appeared on Massively on Fri, 06 Apr 2012 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>conconventiondesignexactly-what-it-says-on-the-tinexpof2pfeaturedflightflight-simulatorfree-to-playgalleriesgalleryhands-onhistoricalimpressionsinterviewinterviewsopinionpaxpax-2012pax-eastpax-east-2012penny-arcade-expoplaneplanespreviewpreviewspvpscreenshotscreenshotswarwargaming.netwarplanewarplanesworld-of-warplaneswowpFri, 06 Apr 2012 17:00:00 EST<![CDATA[Wings Over Atreia: An interview sheds light on the new BlackCloud]]>http://massively.joystiq.com/2012/04/05/wings-over-atreia-an-interview-sheds-light-on-the-new-blackclou/http://massively.joystiq.com/2012/04/05/wings-over-atreia-an-interview-sheds-light-on-the-new-blackclou/http://massively.joystiq.com/2012/04/05/wings-over-atreia-an-interview-sheds-light-on-the-new-blackclou/#commentsFiled under: , , , , , ,

Aion
Information is like gold 'round these parts, and I've been out prospecting, sifting, and searching in the hopes of at least finding a few flakes if not hitting pay dirt. But even with Aion Ascension just around the corner, finding many nuggets of information on the new BlackCloud Marketplace hasn't panned out. Until now. Eureka!

Welcome to the Massively Gold Rush. OK, so maybe a "rush" is a bit of an overstatement, but I have discovered a few golden nuggets about Aion's renovated cash shop and impending 3.0 expansion. I had the chance to catch up with Producer Adam Christensen and learn a bit more about what Daevas will find in the BlackCloud Marketplace as well as get some details about various new upcoming features like housing, mounts, and the level 60 Daevanion armor.

And with the BlackCloud Marketplace finally opening its doors, Daevas can check out the selection for themselves and pre-purchase items to be delivered at Ascension's Launch.

Continue reading Wings Over Atreia: An interview sheds light on the new BlackCloud

MassivelyWings Over Atreia: An interview sheds light on the new BlackCloud originally appeared on Massively on Thu, 05 Apr 2012 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3.03.0-patchAdam-ChristensenaionAion-AscensionBlackCloud-Marketplacecash-shopConstructioncraftingcrafting-Constructioncrafting-professionDaevanion-armorexlusive-interviewf2pfantasyfeaturedfree-to-playfurniturehousinginterviewinterviewsmountsncsoftnew-crafting-professionopinionstorage-spacewings-over-atreiaThu, 05 Apr 2012 09:00:00 EST<![CDATA[Captain's Log: Interview with Cryptic's Al Rivera, part two]]>http://massively.joystiq.com/2012/04/02/captains-log-interview-with-cryptics-al-rivera-part-two/http://massively.joystiq.com/2012/04/02/captains-log-interview-with-cryptics-al-rivera-part-two/http://massively.joystiq.com/2012/04/02/captains-log-interview-with-cryptics-al-rivera-part-two/#commentsFiled under: , , , , , , , ,

Today Captain's Log continues with part two of my interview with Al Rivera, Star Trek Online's Lead Designer at Cryptic Studios.

Last week I received a bit of feedback regarding the state of Rivera's desk. I withheld taking pictures of the interior of the office space for fear of inadvertently capturing information that I wasn't free to share. Happily, though, Rivera himself decided to tweet a few photos of the ships and Trek paraphernalia that graced our visit to his office. Yes, it also included a picture of what I had described in my last column as a "funky purple monster." Apparently my comic book naiveté has kept me from recognizing what Rivera informed me is The Maxx.

Sorry, but it will always be that funky purple monster to me.

Continue reading Captain's Log: Interview with Cryptic's Al Rivera, part two

MassivelyCaptain's Log: Interview with Cryptic's Al Rivera, part two originally appeared on Massively on Mon, 02 Apr 2012 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>al-riveracaptains-logcrypticcryptic-studiosf2pfeaturedfree-to-playinterviewinterviewsopinionperfect-worldperfect-world-entertainmentpwesci-fistar-trekstar-trek-mmostar-trek-onlinestoMon, 02 Apr 2012 11:00:00 EST<![CDATA[Some Assembly Required: Revisiting Origins of Malu]]>http://massively.joystiq.com/2012/03/30/some-assembly-required-revisiting-origins-of-malu-an-intervi/http://massively.joystiq.com/2012/03/30/some-assembly-required-revisiting-origins-of-malu-an-intervi/http://massively.joystiq.com/2012/03/30/some-assembly-required-revisiting-origins-of-malu-an-intervi/#commentsFiled under: , , , , , , , , , , ,

Some Assembly Required
Many moons ago when the air just started to cool from summer's heat (aka, last September), Some Assembly Required had the opportunity to talk shop with a new outfit that is developing a promising new sandbox MMORPG, Origins of Malu. And you know me: Sandbox is the magic word! As skeptical as I knew I should be, I still came away from that interview with renewed hope that a game with some of the features for player-generated content could exist again.

Back then, Burning Dog Media made the bold statement that it would absolutely release its flagship game in 2012, with a target of early 2012 to boot. But as the first quarter of the year quickly drew to a close with scant information available, it became pretty clear the game is still a ways off. In the realm of games, no news is not necessarily good news... and we definitely hit a drought in news.

Now that drought has ended. In our second exclusive interview, we spoke with Michael Dunham, Producer, Jason Mitchell, Senior Developer, and Dave Cruikshank, Art Director, to learn what's been going on behind the scenes and get the scoop on more details about those very features that have sandbox lovers salivating.

Continue reading Some Assembly Required: Revisiting Origins of Malu

MassivelySome Assembly Required: Revisiting Origins of Malu originally appeared on Massively on Fri, 30 Mar 2012 19:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>burning-dog-mediaconstructioncraftingDave-Cruikshankeconomyexclusiveexclusive-interviewfaction-warfarefactionsfeaturedgame-mechanicsguildsinterviewinterviewsJason-Mitchellmassively-exclusive-interviewsmichael-dunhamopinionorigins-of-malupgcplayer-contentplayer-economyplayer-generated-contentPvEPvPsandboxsarsome-assembly-requiredFri, 30 Mar 2012 19:30:00 EST<![CDATA[SOE answers Vanguard free-to-play questions]]>http://massively.joystiq.com/2012/03/27/soe-answers-vanguard-free-to-play-questions/http://massively.joystiq.com/2012/03/27/soe-answers-vanguard-free-to-play-questions/http://massively.joystiq.com/2012/03/27/soe-answers-vanguard-free-to-play-questions/#commentsFiled under: , , , , ,

Vanguard screenshot
With the recent announcement from Sony Online Entertainment that Vanguard: Saga of Heroes will be going free-to-play sometime this summer, questions immediately began to surface. How will it effect current players? Will it be anything like the other free-to-play titles that SOE runs? Well, we were as curious as anyone else, so we fired off a few questions to SOE in the hopes of snagging some more insight into the transformation.

We received our answers from Andy Sites, Director of Development, and the ever-familiar Salim Grant, Creative Director.

It's an exciting time to be a Vanguard player, but will putting a free title on a game that has struggled in the past make any difference? Time will tell. In the meanwhile, click past the cut to check out what SOE had to say!

Continue reading SOE answers Vanguard free-to-play questions

MassivelySOE answers Vanguard free-to-play questions originally appeared on Massively on Tue, 27 Mar 2012 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>andy-sitesbeau-hindmancash-shopconversionf2pfantasyfeaturedfree-to-playftpinterviewinterviewslive-gamerMicrotransactionssalim-grasalim-grantsandboxsoesonysony-online-entertainmenttelonvanguardvanguard-saga-of-heroesvgTue, 27 Mar 2012 20:00:00 EST<![CDATA[Anarchy Online's Fia Tjernberg talks graphics engine update and the future of the game]]>http://massively.joystiq.com/2012/03/27/anarchy-onlines-fia-tjernberg-talks-graphics-engine-update-and/http://massively.joystiq.com/2012/03/27/anarchy-onlines-fia-tjernberg-talks-graphics-engine-update-and/http://massively.joystiq.com/2012/03/27/anarchy-onlines-fia-tjernberg-talks-graphics-engine-update-and/#commentsFiled under: , , , , , ,

Screenshot -- Anarchy Online
Anarchy Online players have been anxiously awaiting the game's upcoming graphics engine upgrade for some time now, and new details are slowly but surely beginning to drip down the pipeline. The latest of these new bits of information is an interview with Game Director Fia Tjernberg that also includes a new preview video showing off "dynamic grass, shadow, water, and god-rays" in the new engine.

The interview itself only touches very briefly on the subject of the new engine itself, however, and in fact focuses more on the history of Anarchy Online as well as the direction that the team plans to take the game in the future. Tjernberg reveals that the team is "working towards a massive overhaul of [the game's] systems mechanics and content interaction," as well as "releasing a new starting area - nay strike that - a completely new starting experience," which should give new players and veterans alike plenty to look forward to in the future. To check out the new graphics engine preview video, just skip on past the cut, then click over to MMORPG.com for the full interview.

Continue reading Anarchy Online's Fia Tjernberg talks graphics engine update and the future of the game

MassivelyAnarchy Online's Fia Tjernberg talks graphics engine update and the future of the game originally appeared on Massively on Tue, 27 Mar 2012 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>anarchy-onlineaoclassic-mmof2pfia-tjernbergfree-to-playfuncomgraphics-enginegraphics-engine-updateinterviewinterviewsnew-player-experiencesci-fiupdatesvideovideosTue, 27 Mar 2012 16:00:00 EST<![CDATA[Captain's Log: Interview with Cryptic's Al Rivera, part one]]>http://massively.joystiq.com/2012/03/26/captain-s-log-interview-with-cryptics-al-rivera-part-one/http://massively.joystiq.com/2012/03/26/captain-s-log-interview-with-cryptics-al-rivera-part-one/http://massively.joystiq.com/2012/03/26/captain-s-log-interview-with-cryptics-al-rivera-part-one/#commentsFiled under: , , , , , , ,

Cryptic Studios
Last week, I headed to Cryptic Studios to meet with several of the folks responsible for the development of Star Trek Online. Over the course of the next few weeks, I will be sharing what I learned from those individuals and from the team on the whole!

This week, I will begin my coverage of a lengthy interview with Al Rivera (@CaptainGeko), the lead designer for STO.

If I had any doubts about the team's love or understanding of our beloved franchise, those doubts were dispelled the moment I walked into the STO work area.

Continue reading Captain's Log: Interview with Cryptic's Al Rivera, part one

MassivelyCaptain's Log: Interview with Cryptic's Al Rivera, part one originally appeared on Massively on Mon, 26 Mar 2012 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>al-riveracaptains-logcrypticcryptic-studiosf2pfeaturedfree-to-playinterviewinterviewsopinionperfect-worldperfect-world-entertainmentpwesci-fistar-trekstar-trek-mmostar-trek-onlinestoThe 2800The2800Mon, 26 Mar 2012 18:30:00 EST<![CDATA[The MMO Report: Aztec pandas make no sense edition]]>http://massively.joystiq.com/2012/03/22/the-mmo-report-aztec-pandas-make-no-sense-edition/http://massively.joystiq.com/2012/03/22/the-mmo-report-aztec-pandas-make-no-sense-edition/http://massively.joystiq.com/2012/03/22/the-mmo-report-aztec-pandas-make-no-sense-edition/#commentsFiled under: , , , , , , , , , , , ,

The MMO Report
Morgan Webb dethrones Casey this week on The MMO Report, having made the journey to Anaheim to interview Blizzard's reps about World of Warcraft's upcoming Mists of Pandaria expansion. J. Allen Brack and Tom Chilton focus on the philosophy of this expansion and its shift from previous expansions' ominous tone to a more playful theme of adventure, exploration, and oh yeah, the war between the Alliance and the Horde.

The pair also highlight changes to underdeveloped zones, pet battles, repurposed classic dungeons, phased farms (actual farms!), and solutions to the faction grind problem. Most interestingly, they tell Morgan that Pandaren came first... and the Asian motif followed. After all, they joke, it just wouldn't have made sense to put Pandaren in Aztec ruins.

Get your panda on in the full video behind the break!

Continue reading The MMO Report: Aztec pandas make no sense edition

MassivelyThe MMO Report: Aztec pandas make no sense edition originally appeared on Massively on Thu, 22 Mar 2012 21:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>activisionanaheimblizzardblizzard-entertainmentcasey-schreinerfantasyhumorinterviewinterviewsj-allen-brackmists-of-pandariammo-reportmorgan-webbnewsopinionpandarenpandariaroundupthe-mmo-reporttom-chiltonvideovideoswarcraftworld-of-warcraftwowThu, 22 Mar 2012 21:00:00 EST<![CDATA[Todd McFarlane says Project Copernicus is coming this year]]>http://massively.joystiq.com/2012/03/16/todd-mcfarlane-says-project-copernicus-coming-this-year/http://massively.joystiq.com/2012/03/16/todd-mcfarlane-says-project-copernicus-coming-this-year/http://massively.joystiq.com/2012/03/16/todd-mcfarlane-says-project-copernicus-coming-this-year/#commentsFiled under: , ,

Concept Art -- Project Copernicus
Gamers got their first look at the Kingdoms of Amalur universe in Kingdoms of Amalur: Reckoning earlier this year, but we here at Massively are still anxiously awaiting more details on 38 Studios' MMO branch of the setting, Project Copernicus. Thankfully, it looks like we won't have to wait too much longer.

In an interview with START, comic artist extraordinaire Todd McFarlane, who is providing art design for Copernicus, nonchalantly dropped news that the studio is aiming to release Project Copernicus "later in the year." He doesn't expound any further on when exactly we can expect to get our hands on the game, but with any luck we'll be getting some more details before long, so stay tuned folks. Oh, and the full interview is embedded past the cut in case you'd like to watch the full thing. The relevant quote hits at about the 11:50 mark, but the full interview is definitely worth a watch.

[Thanks to John for the tip!]

Continue reading Todd McFarlane says Project Copernicus is coming this year

MassivelyTodd McFarlane says Project Copernicus is coming this year originally appeared on Massively on Fri, 16 Mar 2012 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>38-studioscopernicusinterviewinterviewsmcfarlaneproject-copernicusrelease-daterelease-windowtodd-mcfarlanevideovideosFri, 16 Mar 2012 16:00:00 EST<![CDATA[Terrazas talks EverQuest F2P launch and anniversary celebration]]>http://massively.joystiq.com/2012/03/16/terrazas-talks-everquest-f2p-launch-and-anniversary-celebration/http://massively.joystiq.com/2012/03/16/terrazas-talks-everquest-f2p-launch-and-anniversary-celebration/http://massively.joystiq.com/2012/03/16/terrazas-talks-everquest-f2p-launch-and-anniversary-celebration/#commentsFiled under: , , , , , , , , , , , ,

everquest
March is definitely roaring in like a lion for EverQuest. It's launching its new free-to-play program, and it's also celebrating its 13th anniversary with a big bash in game. With all of the changes, players are sure to have more than a few questions about the free-to-play transition and the state of the game today. We recently sat down with SOE Producer Thom Terrazas at a roundtable to answer those questions, so read on for details on the new free-to-play plan as well as the Hero's Journey, revamped maps, birthday celebrations, and the announcement of a brand-new server!

Gallery: EverQuest Free-to-play and 13th anniversary

Continue reading Terrazas talks EverQuest F2P launch and anniversary celebration

MassivelyTerrazas talks EverQuest F2P launch and anniversary celebration originally appeared on Massively on Fri, 16 Mar 2012 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>eqeq-2eq-iieq-revamped-mapseq1eq2eqiieverquesteverquest-13th-birthdayeverquest-2everquest-anniversaryeverquest-free-to-playeverquest-iif2pfantasyfeaturedfree-to-playgalleriesgalleryheros-journeyinterviewinterviewspreviewpreviewsscreenshotscreenshotssoesonysony-online-entertainmentthom-terrazastrailertrailersvideovideosvox-serverFri, 16 Mar 2012 15:00:00 EST<![CDATA[Kickstarting the future of game publishing: An interview with Brian Fargo]]>http://massively.joystiq.com/2012/03/15/kickstarting-the-future-of-game-publishing-an-interview-with-br/http://massively.joystiq.com/2012/03/15/kickstarting-the-future-of-game-publishing-an-interview-with-br/http://massively.joystiq.com/2012/03/15/kickstarting-the-future-of-game-publishing-an-interview-with-br/#commentsFiled under: , , , , , , ,

Wasteland box art
When I was 12 years old, my days mainly consisted of one thing: playing games on my Commodore 64. I would set my alarm early to get some gaming in before school, think about the games all day during school, then come home and play as much as I could before my parents made me stop and do homework or chores. Aside from TSR's Gold Box series, the two games that molded my childhood and my love for gaming were Wasteland and The Bard's Tale. Both of these games were made by Interplay Productions, a company founded by Brian Fargo in 1983.

Fargo has always been an iconic figure to me. I regularly name my MMO characters Faran Brygo (a name he used for an NPC in the original Wasteland). I'm certainly not alone in my love for Wasteland (which I have labeled for years as my all-time-favorite RPG), but I think it's safe to say that many gamers who enjoyed Wasteland always wondered why there was no sequel. Fallout 1 and 2 were "spiritual successors" to the game, but for copyright reasons, they were never actually labeled as true sequels. Fargo tried to make a true sequel for 20 years but was always met with brick walls from publishers who weren't interested in resurrecting such an old game.

Enter Kickstarter. After the wild success of Tim Schafer's Double Fine crowdfunding campaign, Fargo got the idea to try it out for himself. The timing was right with the current nostalgic gaming scene, the popularity of the post-apocalyptic genre, and the fact that most of Interplay's original fans are now in a position of making a tad more income than allowance money from childhood chores.

We sat down with Brian Fargo to discuss his views on the potential of Kickstarter, the future of Big Brother game publishers, and Wasteland 2.

Continue reading Kickstarting the future of game publishing: An interview with Brian Fargo

MassivelyKickstarting the future of game publishing: An interview with Brian Fargo originally appeared on Massively on Thu, 15 Mar 2012 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>brian-fargofaran-brygointerplayinterviewinterviewskickstarterpublishersrpgtrailertrailersvideovideoswastelandwasteland-2yes-we-know-its-not-an-mmoThu, 15 Mar 2012 11:00:00 EST<![CDATA[GDC 2012: RIFT's Adam Gershowitz talks raiding, mentoring, and housing]]>http://massively.joystiq.com/2012/03/13/gdc-2012-rifts-adam-gershowitz-talks-raiding-mentoring-and-h/http://massively.joystiq.com/2012/03/13/gdc-2012-rifts-adam-gershowitz-talks-raiding-mentoring-and-h/http://massively.joystiq.com/2012/03/13/gdc-2012-rifts-adam-gershowitz-talks-raiding-mentoring-and-h/#commentsFiled under: , , , , , , ,

Infernal Dawn
Last week's GDC came at a perfect time for Trion. The conference overlaps perfectly with RIFT's one-year anniversary, and Producer Adam Gershowitz took us through some highlights of the past year as well as the current Carnival of the Ascended content. But he also gave a peek at what's planned for the future, not only showing off the new raid zone Infernal Dawn but also talking about the team's plans for some fan-favorites like the leaderboards, mentoring, and housing.

Gallery: Rift Update 1.8

Continue reading GDC 2012: RIFT's Adam Gershowitz talks raiding, mentoring, and housing

MassivelyGDC 2012: RIFT's Adam Gershowitz talks raiding, mentoring, and housing originally appeared on Massively on Tue, 13 Mar 2012 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>adam-gershowitzcarnival-of-the-ascendedconconferenceconventionfantasyfeaturedgalleriesgallerygame-developers-conferencegame-developers-conference-2012gdcgdc-2012housinginfernal-dawninterviewinterviewsriftrift-literift-planes-of-telarascreenshotscreenshotstriontrion-worldsTue, 13 Mar 2012 19:00:00 EST<![CDATA[GDC 2012: A look at Fighters Club Online]]>http://massively.joystiq.com/2012/03/13/gdc-2012-a-look-at-fighters-club-online/http://massively.joystiq.com/2012/03/13/gdc-2012-a-look-at-fighters-club-online/http://massively.joystiq.com/2012/03/13/gdc-2012-a-look-at-fighters-club-online/#commentsFiled under: , , , , , , ,

fighters club
There may be no Brad Pitt and bars of soap, but Fighters Club, an upcoming MMO from KOG Studios, has plenty of pugilistic power to make Jack a happy man. At GDC last week, Massively had a chance to see some of the action and talk to the team about its plans for beta and launch. If you're curious about Fighters Club, then tape up those knuckles, slip into some kick-boxing shoes, and let's get ready to rumble!

Gallery: Fighters Club Online

Continue reading GDC 2012: A look at Fighters Club Online

MassivelyGDC 2012: A look at Fighters Club Online originally appeared on Massively on Tue, 13 Mar 2012 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>conconferenceconventionfeaturedfighters-clubfighting-MMOgalleriesgallerygame-developers-conferencegame-developers-conference-2012gdcgdc-2012hands-oninterviewinterviewsKOG-studioscreenshotscreenshotsTue, 13 Mar 2012 18:00:00 EST<![CDATA[GDC 2012: gPotato showcases Allods, Aika, Sevencore, and Eternal Blade]]>http://massively.joystiq.com/2012/03/13/gdc-2012-gpotato-showcases-allods-aika-sevencore-and-eternal/http://massively.joystiq.com/2012/03/13/gdc-2012-gpotato-showcases-allods-aika-sevencore-and-eternal/http://massively.joystiq.com/2012/03/13/gdc-2012-gpotato-showcases-allods-aika-sevencore-and-eternal/#commentsFiled under: , , , , , , , , , , ,

sevencore
If you're wondering what gPotato has been up to lately, the answer is, lots! At GDC, gPotato reps showed off not one but four titles, two of which are brand-new and on their way to beta. For Allods and Aika fans, there was plenty of news about the new game updates. Meanwhile, gPotato put on demos for Sevencore and Eternal Blade, which are both in production and are being prepped for release sometime later this year. Read on for a hands-on look at each of these titles!

Gallery: gPotato Gallery

Continue reading GDC 2012: gPotato showcases Allods, Aika, Sevencore, and Eternal Blade

MassivelyGDC 2012: gPotato showcases Allods, Aika, Sevencore, and Eternal Blade originally appeared on Massively on Tue, 13 Mar 2012 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>aikaallodsallods-onlineastrum-nivalconconferenceconventioneternal-bladef2pfantasyfeaturedfree-to-playgala-netgame-developers-conferencegame-developers-conference-2012gdcgdc-2012gpotatointerviewinterviewssevencoreTue, 13 Mar 2012 16:00:00 EST<![CDATA[Epic in scope: SWTOR's James Ohlen explains plans for the future]]>http://massively.joystiq.com/2012/03/13/epic-in-scope-swtors-james-ohlen-explains-plans-for-the-future/http://massively.joystiq.com/2012/03/13/epic-in-scope-swtors-james-ohlen-explains-plans-for-the-future/http://massively.joystiq.com/2012/03/13/epic-in-scope-swtors-james-ohlen-explains-plans-for-the-future/#commentsFiled under: , , , , , , ,

James Ohlen
As the Star Wars: The Old Republic guild leaders lined up to get a taste of the Lost Island flashpoint, I was at BioWare studios getting my hands dirty with deeper PvE and PvP content as well as speaking with developers like Combat Designer Georg Zoeller, Lead Writer Daniel Erickson, Art Director Jeff Dobson, and Lead Designer Emmanuel Lusinchi. However, the best part was at the end of the day when I was able to speak one-on-one with Creative Director James Ohlen.

Ohlen touches nearly every aspect of the game's development. It was important to me to find out why this game is as popular as it is and what BioWare was going to do to retain its current playerbase. The first stop was the latest game update, which should hit test servers really soon.

Continue reading Epic in scope: SWTOR's James Ohlen explains plans for the future

MassivelyEpic in scope: SWTOR's James Ohlen explains plans for the future originally appeared on Massively on Tue, 13 Mar 2012 14:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>biowaredaniel-ericksone-sportseaelectronic-artsemmanuel-lusinchiendgameendgame-contentesportsfeaturedgame-testinggeorg-zoellerinterviewinterviewsjames-ohlenjeff-dobsonlevel-50lucasartspublic-test-serverPvPsci-fistar-warsstar-wars-the-old-republicswtorthe-old-republictorupdate-1.2Tue, 13 Mar 2012 14:30:00 EST<![CDATA[GDC 2012: The Repopulation demonstrates world-building elements]]>http://massively.joystiq.com/2012/03/10/gdc-2012-the-repopulation-demonstrates-world-building-elements/http://massively.joystiq.com/2012/03/10/gdc-2012-the-repopulation-demonstrates-world-building-elements/http://massively.joystiq.com/2012/03/10/gdc-2012-the-repopulation-demonstrates-world-building-elements/#commentsFiled under: , , , , , , , , , ,

The Repopulation screnshot
GDC literally has a little of everything, from indie developers to major studios, from free-to-play games to shooters to arena battles to retro to family... there really is something for everyone. As a massive fan of sandboxes myself, I was pleased to get to spend so much time with Above and Beyond Technologies' lead dev and co-owner Josh Halls and artist Kevin Grove as they demonstrated some of the features in their upcoming title, The Repopulation. (And I would have even spent longer if I could have!)

While I had a monopoly on the team's attention, I had the chance to see some of the customization available to characters, both in appearance and gear, as well as get the lowdown on the world building element. We actually walked through the building of a nation, a feature that will make many a sandbox fan giddy! Although Josh was quick to point out that only a few items were available at this point in development, there was certainly enough to get a feel for the system. And I am looking forward to it!

Continue reading GDC 2012: The Repopulation demonstrates world-building elements

MassivelyGDC 2012: The Repopulation demonstrates world-building elements originally appeared on Massively on Sat, 10 Mar 2012 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>above-and-beyondabove-and-beyond-technologiescharacter-customizationcitiescitycity-buildingcity-building gameconconferenceconventioncraftingcustomizationdemofeaturedgame-developers-conferencegame-developers-conference-2012gdcgdc-2012guildsinterviewinterviewsJosh-HallsJoshua-HallsKevin-Grovenationsplayer-run-economypreviewpreviewsrepopulationrole-playsandboxsandbox-gamesci-fistar-wars-galaxiesswgthe-repopulationSat, 10 Mar 2012 12:00:00 EST<![CDATA[GDC 2012: Bigpoint discusses the Game of Thrones MMO]]>http://massively.joystiq.com/2012/03/09/gdc-2012-bigpoint-discusses-the-game-of-thrones-mmo/http://massively.joystiq.com/2012/03/09/gdc-2012-bigpoint-discusses-the-game-of-thrones-mmo/http://massively.joystiq.com/2012/03/09/gdc-2012-bigpoint-discusses-the-game-of-thrones-mmo/#commentsFiled under: , , , , , , , , ,

Game of Thrones screenshot
The Game is coming.

It had to be said. And for fans of George R.R. Martin's epic fantasy series A Song of Ice and Fire, that one little phrase elicits some powerful and mixed emotions: excitement (to actually wander about Westeros) and dread (will it actually be Westeros?). There was even a collective cringe among some Massively staff when the announcement was made that Game of Thrones was becoming an MMORPG. Could such a complex world translate well into the virtual realm? It made the transition to television pretty well in HBO's series, but a free-to-play browser-based MMO is a whole other beast.

We're pleased to say that fans of the books and the series can breathe a little easier and even look forward to the upcoming title becuse it's going to be gritty, it's going to be gory, and power will shift like the winds across the Dothraki Sea. Massively was able to sit down with Jorgen Tharaldsen (Producer at Artplant), Alan Dunton (Public Relations Director at Bigpoint), and Rob Ollett (Executive Producer at Bigpoint) to discuss details about what's coming.

Continue reading GDC 2012: Bigpoint discusses the Game of Thrones MMO

MassivelyGDC 2012: Bigpoint discusses the Game of Thrones MMO originally appeared on Massively on Fri, 09 Mar 2012 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-combatalan-duntonArtplantBigpointbrowserbrowser-gamecash-shopconconferenceconventiondirectional-action-combatfantasyfeaturedfree-to-playgame-developers-conferencegame-developers-conference-2012game-of-thronesgdcgdc-2012george-r-r-martininterviewinterviewsitem-progressionjorgen-tharaldsenpolitical-systempreviewpreviewspvpRob-Ollettsandboxsiegesiege-systemsiegesFri, 09 Mar 2012 11:00:00 EST<![CDATA[GDC 2012: A look at Dark Legends with Spacetime Studios]]>http://massively.joystiq.com/2012/03/07/gdc-2012-a-look-at-dark-legends-with-spacetime-studios/http://massively.joystiq.com/2012/03/07/gdc-2012-a-look-at-dark-legends-with-spacetime-studios/http://massively.joystiq.com/2012/03/07/gdc-2012-a-look-at-dark-legends-with-spacetime-studios/#commentsFiled under: , , , , , , , , , , , ,

Dark Legends
Life, death, and a return from the grave: That sums up the life of a vampire, but it also sums up the journey of Spacetime Studios. What do the two have in common? The studio's upcoming title called Dark Legends. At GDC 2012 this week, Massively had a chance to talk with Gary Gattis, CEO of Spacetime Studios, and we got a first-hand look at how the company successfully created a game in which people can play together on laptops, tablets, phones, and virtually any mobile device available.

Continue reading GDC 2012: A look at Dark Legends with Spacetime Studios

MassivelyGDC 2012: A look at Dark Legends with Spacetime Studios originally appeared on Massively on Wed, 07 Mar 2012 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>conconferenceconventiondark-legendsfeaturedgame-developers-conferencegame-developers-conference-2012gary-gattisgdcgdc-2012interviewinterviewskaren-bryanmobilemobile-mmospocket-legendsspacetimespacetime-studiosstar-legendsWed, 07 Mar 2012 19:00:00 EST<![CDATA[ArenaNet's Jon Peters talks Guild Wars 2 competitive PvP]]>http://massively.joystiq.com/2012/03/06/arenanets-jon-peters-talks-guild-wars-2-competitive-pvp/http://massively.joystiq.com/2012/03/06/arenanets-jon-peters-talks-guild-wars-2-competitive-pvp/http://massively.joystiq.com/2012/03/06/arenanets-jon-peters-talks-guild-wars-2-competitive-pvp/#commentsFiled under: , , , ,

Screenshot -- Guild Wars 2
Gaming can be a great way to wind down and relax, but as any real gamer knows, relaxation is for sissies. Competition is where the real action's at! Don't worry, Guild Wars 2 designer Jon Peters knows all about competition, and he even took some time out of his certainly busy day to sit down and talk a bit about Guild Wars 2's competitive PvP.

Anyone who played the original Guild Wars knows the heavy focus the game put on balanced, competitive PvP. Well, ArenaNet is taking that to the next level in Guild Wars 2. Peters even goes on to state that the devs "consider it to be one of the primary goals of Guild Wars 2 competitive PvP to make it into an eSport." Peters goes on to discuss how the team is focusing on bringing players a balanced-but-exciting PvP experience. For the full details, just click on through the link below to the full interview at ZAM.

MassivelyArenaNet's Jon Peters talks Guild Wars 2 competitive PvP originally appeared on Massively on Tue, 06 Mar 2012 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>anetarenanetfantasyguild-wars-2gw2interviewinterviewsjon-petersncsoftnullplayer-vs-playerpvpworld-vs-worldworld-vs-world-vs-worldwvwvwTue, 06 Mar 2012 15:00:00 EST<![CDATA[The Game Archaeologist reminisces with EQMac vets]]>http://massively.joystiq.com/2012/02/28/the-game-archaeologist-reminisces-with-eqmac-vets/http://massively.joystiq.com/2012/02/28/the-game-archaeologist-reminisces-with-eqmac-vets/http://massively.joystiq.com/2012/02/28/the-game-archaeologist-reminisces-with-eqmac-vets/#commentsFiled under: , , , , , ,

EverQuest
I can hear you right now: "What, another week on EverQuest Mac? There's, like, six people who play that! Move on to Neocron already!" Oh, be patient my lovelies. I know that the whole EQMac termination/salvation thing is so yesterday's news, particularly with SOE embroiled in a completely different community fiasco last week, but I had one last thing to share with you.

You see, a month ago when I heard that EQMac was going to be shut down, I put out some feelers for any players who might want to share their side of the story. Apparently, this small community is downright fanatical about this game and deluged my inbox with stories and pleas. While it seems like the crisis has passed for these players, I still want to share some of these testimonies with you because that's what this column is about.

So indulge me with one last week of EQMac discussion before we shift our attention elsewhere. If you're curious why players in 2012 would deliberately choose to game on an archaic server with extremely old-school rules, then the answer awaits you after the jump. And if you'd like to try out this completely free version of EverQuest, then head over to the EQMac.com forums for step-by-step instructions.

Continue reading The Game Archaeologist reminisces with EQMac vets

MassivelyThe Game Archaeologist reminisces with EQMac vets originally appeared on Massively on Tue, 28 Feb 2012 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alkaboreqeq-maceqmaceverquesteverquest-maceverquest-macintosheverquest-macintosh-editionfeaturedinterviewinterviewsplanes-of-powerpopsoesonysony-online-entertainmentthe-game-archaeologistworld-of-warcraftwowTue, 28 Feb 2012 19:00:00 EST