Massively http://massively.joystiq.com Massively http://www.blogsmithmedia.com/http://massively.joystiq.com/media/feedlogo.gif Massively http://massively.joystiq.com en-us Copyright 2012 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[Raising hell in The Secret World's Hell Raised instance]]>http://massively.joystiq.com/2012/05/24/raising-hell-in-the-secret-worlds-hell-raised-instance/http://massively.joystiq.com/2012/05/24/raising-hell-in-the-secret-worlds-hell-raised-instance/http://massively.joystiq.com/2012/05/24/raising-hell-in-the-secret-worlds-hell-raised-instance/#commentsFiled under: , , , , , , ,

Seems legit.
Welcome to The Secret World's Overlook Motel, where the sheets are clean, the service is friendly, and there's an ominous doorway to Hell in every room. Such is the beginning of the second instanced dungeon of Funcom's upcoming horror-fantasy MMO, which sees players descending deep into the bowels of the underworld to put an end to a raging demonic war that's causing Hell to leak through to the real world.

I had the pleasure of joining Funcom's Tor Andersen on a guided tour of Hell Raised, the first in a series of three dungeons that take place in the fiery depths, and boy did I ever have a hell of a time (sorry). If you're interested in finding out what awaits players of The Secret World in the depths of Hades itself, follow along with me as I give you the ins-and-outs of surviving a confrontation in the midst of an infernal warzone.

Continue reading Raising hell in The Secret World's Hell Raised instance

MassivelyRaising hell in The Secret World's Hell Raised instance originally appeared on Massively on Thu, 24 May 2012 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dungeondungeonsfactionfantasyfeaturedfuncomhands-onhell-raisedhorrorinstanceinstancesmythologypreviewpreviewssci-fantasysecret-worldskill-basedthe-secret-worldtswThu, 24 May 2012 10:00:00 EST<![CDATA[LotRO's Fornost 'joining the modern MMO world']]>http://massively.joystiq.com/2012/05/10/lotros-fornost-joining-the-modern-mmo-world/http://massively.joystiq.com/2012/05/10/lotros-fornost-joining-the-modern-mmo-world/http://massively.joystiq.com/2012/05/10/lotros-fornost-joining-the-modern-mmo-world/#commentsFiled under: , , , , , ,

LotRO
"Fornost was designed and built in a different era of MMO," Turbine's devs said about the newly revised dungeon. "It is time for Fornost to join the modern MMO world." With Fornost slated for a massive overhaul with Update 7, the team posted a developer diary to explain the history of the instance and its hopeful future.

The third instance ever created for Lord of the Rings Online will be chopped up from its current super-long state to four manageable dungeons. The devs said that it was designed from an EverQuest mindset of long dungeon crawls, but so much has changed over time and most players no longer have the time or effort to conquer it.

With Update 7, Fornost will turn into four element-themed six-person dungeons. Each of these dungeons should take well less than an hour to complete and scale from level 30 to 75 with two tiers of difficulty. The team's reworked positioning, bosses, and quests to reflect the upgraded experience. For those who might miss the old Fornost, the team says that playing all four instances back-to-back will replicate the grand tour that it used to be.

MassivelyLotRO's Fornost 'joining the modern MMO world' originally appeared on Massively on Thu, 10 May 2012 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dev-blogdev-diarydungeonf2pfantasyfornostfornost-revampfree-to-playinstancejoe-barrylord-of-the-ringslord-of-the-rings-onlinelotroshades-of-the-pastturbineturbine-entertainmentupdate-7Thu, 10 May 2012 16:00:00 EST<![CDATA[Guided tour of the new SWTOR flashpoint]]>http://massively.joystiq.com/2012/04/06/guided-tour-of-the-new-swtor-flashpoint/http://massively.joystiq.com/2012/04/06/guided-tour-of-the-new-swtor-flashpoint/http://massively.joystiq.com/2012/04/06/guided-tour-of-the-new-swtor-flashpoint/#commentsFiled under: , , , , , ,

SWTOR flashpoint: The Lost Island
Yesterday, BioWare invited some members of the press to take part in a guided tour of the latest update for Star Wars: The Old Republic. In recent Hyperspace Beacons, we've covered everything from the user interface changes to the crew skills system. However, the specifics of some of the new story content have been a bit sparse. Thanks to help from BioWare, that's now changed.

Beyond the break, we have put together a 15-minute video describing the ins and outs of the latest flashpoint: The Lost Island. Together with a member of the BioWare development team, we explored this new level-50 zone, destroying everything in our path and maybe learning something along the way.

Continue reading Guided tour of the new SWTOR flashpoint

MassivelyGuided tour of the new SWTOR flashpoint originally appeared on Massively on Fri, 06 Apr 2012 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>biowaredr-lorrickdungeoneaelectronic-artsflashpointguided-tourinstancelucasartsnew-contentopinionord-mantellpreviewrakghoulRise-of-the-Rakghoulssci-fistar-warsstar-wars-the-old-republicswtorthe-lost-islandthe-old-republictorupdate-1.2videoFri, 06 Apr 2012 19:00:00 EST<![CDATA[Maelforge and Laethys soar into action in RIFT's latest Infernal Dawn trailer]]>http://massively.joystiq.com/2012/04/04/maelforge-and-laethys-soar-into-action-in-rifts-latest-infernal/http://massively.joystiq.com/2012/04/04/maelforge-and-laethys-soar-into-action-in-rifts-latest-infernal/http://massively.joystiq.com/2012/04/04/maelforge-and-laethys-soar-into-action-in-rifts-latest-infernal/#commentsFiled under: , , , , , ,

Screenshot -- RIFT
In the recent weeks, we've been inundated with information on RIFT's upcoming patch 1.8 and the accompanying new raid, Infernal Dawn. We've already gotten up-close-and-personal looks at the big baddies of Infernal Dawn, Laethys and Maelforge, but today Trion Worlds has released a spankin'-new trailer to get players hyped up to take on the dastardly duo of draconic deities.

The trailer itself takes players inside the raid proper to give them a look at the many enemies they'll be squaring off against. It also gives us the first look at Laethys and Maelforge live and in action, and to say that these two appear formidable would be quite an understatement. They look, in layman's terms, like they're willing and able to mess your day/week/life right up. You can see for yourself in the full video, so why don't you go take a gander?

Continue reading Maelforge and Laethys soar into action in RIFT's latest Infernal Dawn trailer

MassivelyMaelforge and Laethys soar into action in RIFT's latest Infernal Dawn trailer originally appeared on Massively on Wed, 04 Apr 2012 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dungeondungeonsfantasyinfernal-dawninstanceinstanceslaethysmaelforgepatch-1.8raidraidsriftrift-literift-planes-of-telaratrailertrailerstriontrion-worldsvideovideosWed, 04 Apr 2012 20:00:00 EST<![CDATA[Delve deeper into RIFT's Infernal Dawn raid with new details, screenshots]]>http://massively.joystiq.com/2012/03/13/delve-deeper-into-rifts-infernal-dawn-raid-with-new-details-sc/http://massively.joystiq.com/2012/03/13/delve-deeper-into-rifts-infernal-dawn-raid-with-new-details-sc/http://massively.joystiq.com/2012/03/13/delve-deeper-into-rifts-infernal-dawn-raid-with-new-details-sc/#commentsFiled under: , , ,

I thought dragons were supposed to DROP loot, not BE loot.
If you've ever looked at an MMO and said something like "this would be a lot better if there was lava-surfing pirate ship helmed by an amazonian captain" or "dragons would be so much cooler if they were made of gold," then you have some very particular and rather peculiar thoughts. Moreover, though, RIFT has just the instance for you.

Last week we took a video tour through the Earth Wing of RIFT's upcoming raid, Infernal Dawn. Now PC Gamer has got some more screenshots and details on the new dungeon, which pits players up against the Golden Maw, the Wanton, and their decidedly daft dragon leaders, Maelforge and Laethys. Laethys, in case we haven't mentioned it yet, is the dragon of earth whose form is composed entirely of delicious gold and precious gems. It's also worth mentioning that this is a dragon whose sacrifice of choice is a pretty boy or girl who has had his or her eyes removed and replaced with rubies. So yeah, may want to take her down ASAP, guys.

Unfortunately, we've still yet to get a look at Maelforge himself, but we're sure Mr. I-want-to-sow-the-seeds-of-discord-and-chaos-everywhere will show his face as the release of Infernal Dawn draws ever closer.

MassivelyDelve deeper into RIFT's Infernal Dawn raid with new details, screenshots originally appeared on Massively on Tue, 13 Mar 2012 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dungeondungeonsfantasygolden-mawinfernal-dawninstanceinstanceslaethysmaelforgeraidraidsriftrift-literift-planes-of-telaratriontrion-worldswantonTue, 13 Mar 2012 17:00:00 EST<![CDATA[Wings Over Atreia: The top 19 ways to get your dungeon crawl on, continued]]>http://massively.joystiq.com/2012/02/13/wings-over-atreia-the-top-19-ways-to-get-your-dungeon-crawl-on/http://massively.joystiq.com/2012/02/13/wings-over-atreia-the-top-19-ways-to-get-your-dungeon-crawl-on/http://massively.joystiq.com/2012/02/13/wings-over-atreia-the-top-19-ways-to-get-your-dungeon-crawl-on/#commentsFiled under: , , , ,

Wings Over Atreia header
Ahhh. There's nothing like the feeling of facing down a formidable foe, beating it into submission, then finally conquering it and pulling from its lifeless corpse some rare and valuable treasure to hold above your head as a trophy of your victory. Of course, this feeling cannot be found in the PvP portion of Aion's PvPvE formula; sadly, neither Asmodians nor Elyos drop loot of any kind upon defeat, rare or otherwise (though I have to say adding in the ability to pluck a feather from your vanquished foe would be cool). So that leaves only one way to experience this rush, and that's through the PvE side of the game, and not just any PvE at that: While there is a possibility of valuable drops out in the world, your best chances lie within the instanced dungeons.

Dungeons are a great way to get away from the masses and all the accompanying interruptions that come with sharing the world with others, such as KSing, unwanted PvP ambushes, and mob trains pulled by some idiot next to you. Think of it as an Atreian vacation! And Aion has 19 PvE instanced dungeons ready to whisk you away for a brief respite from the world while simultaneously giving you the chance at some great loot and XP.

Last week we covered dungeons available to Daevas under level 40 as well as solo instances. Of course, in most cases, Daevas don't remain under 40 forever (or even for long if whole months of double-XP weekends crop up!), so there is a need for more places to scratch that dungeon crawl itch. This time around, Wings Over Atreia focuses on the gamut of choices for those advancing in their levels.

Continue reading Wings Over Atreia: The top 19 ways to get your dungeon crawl on, continued

MassivelyWings Over Atreia: The top 19 ways to get your dungeon crawl on, continued originally appeared on Massively on Mon, 13 Feb 2012 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>AdmaAdma-Strongholdaionaion-crucibleaion-gamealquimiaAlquimia-Research-CenterBeshbeshmundir-templedungeondungeon-crawldungeon-crawlingdungeonsempyrean-cruciblefeaturedHigh-level-contentindratuIndratu-Fortressinstanceinstanceslistlistslower-udasnc-softnc-soft-aionncsoftncsoft-aionpadmarashkapadmarashkas-cavepveSRSteel-Raket-labstheobomos-labsudasudas-templeupper-udasWings-Over-AtreiaMon, 13 Feb 2012 15:00:00 EST<![CDATA[Lord of the Rings Online delves into the Ring of Isengard]]>http://massively.joystiq.com/2011/12/12/lord-of-the-rings-online-delves-into-the-ring-of-isengard/http://massively.joystiq.com/2011/12/12/lord-of-the-rings-online-delves-into-the-ring-of-isengard/http://massively.joystiq.com/2011/12/12/lord-of-the-rings-online-delves-into-the-ring-of-isengard/#commentsFiled under: , , , , , ,

Screenshot -- Lord of the Rings Online
Today's Lord of the Rings Online dev diary brings players behind the scenes with the upcoming instance cluster, Ring of Isengard. This new update includes three small fellowships, one fellowship, and one raid, ensuring that there's something for groups of every size. The team is working off the recent success of the instance cluster In Their Absence.

The team states that "[Ring of Isengard] is a return to the classic LotRO cluster model with In Their Absence's added benefit of tiers." The cluster puts a large focus on interacting with the environment, with the addition of ballistas, saw mills, and more. The diary also gives many details on the story of the cluster, but we're not going to give it all away. Head on over to the official dev diary and read it for yourself.

MassivelyLord of the Rings Online delves into the Ring of Isengard originally appeared on Massively on Mon, 12 Dec 2011 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dungeonsf2pfree-to-playin-their-absenceinstanceinstance-clusterinstance-clustersinstancesisengardlord-of-the-ringslord-of-the-rings-onlinelotrlotroring-of-isengardturbineturbine-entertainmentMon, 12 Dec 2011 16:00:00 EST<![CDATA[Lord of the Rings Online's Update 5 invading Dunland next week]]>http://massively.joystiq.com/2011/12/08/lord-of-the-rings-onlines-update-5-invading-dunland-next-week/http://massively.joystiq.com/2011/12/08/lord-of-the-rings-onlines-update-5-invading-dunland-next-week/http://massively.joystiq.com/2011/12/08/lord-of-the-rings-onlines-update-5-invading-dunland-next-week/#commentsFiled under: , , ,

LOTRO
Turbine's asking you out on a very special date next week -- December 12th, in fact. That's when the studio will show up to your door dressed in a sharp-looking tux, bearing flowers, and eager for you to head out on a magical tour around Middle-earth on a carriage ride.

It's on December 12th that Lord of the Rings Online will be releasing its first major post-Rise of Isengard patch, Update 5. The update comes loaded with endgame activities, including a huge instance cluster, an instance finder, and a new book in the epic storyline: Volume III, Book 5.

You can read more about Update 5 with our Turbine interview, head over to A Casual Stroll to Mordor to listen to what questions fans have about the patch, or check out the gallery below for five new screenshots of one of the instances, The Foundry.

[Source: Turbine press release]

Gallery: Lord of the Rings Online Core Gallery

MassivelyLord of the Rings Online's Update 5 invading Dunland next week originally appeared on Massively on Thu, 08 Dec 2011 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>a-casual-stroll-to-mordorf2pfree-to-playinstanceinstance-clusterinstance-finderinstancesinterviewlord-of-the-rings-onlinelotroprince-of-rohanrise-of-isengardthe-prince-of-rohanturbineturbine-entertainmentupdate-5Thu, 08 Dec 2011 11:00:00 EST<![CDATA[Jade Dynasty: Legacy to introduce new classes, dungeon, and more]]>http://massively.joystiq.com/2011/12/05/jade-dynasty-legacy-to-introduce-new-classes-dungeon-and-more/http://massively.joystiq.com/2011/12/05/jade-dynasty-legacy-to-introduce-new-classes-dungeon-and-more/http://massively.joystiq.com/2011/12/05/jade-dynasty-legacy-to-introduce-new-classes-dungeon-and-more/#commentsFiled under: , , , , , ,

Screenshot -- Jade Dynasty
Perfect World Entertainment announced today that it will be releasing a new expansion for its free-to-play MMORPG, Jade Dynasty. The expansion, known as Jade Dynasty: Legacy, is the largest single update to the game since 2010's Vengeance, and it brings quite a few new features to the martial arts title. For starters, heroes will be able to venture into the mysterious Incense Valley in search of -- what else -- powerful, delicious loot. Players will also be able to step into the shoes of two new classes: the pyromaniacal Incense Valley Mage and the completely uninformatively named Forta.

These classes will no doubt be very helpful in the new Crimson Peaks Voidland instance, which will play host to a party of 10 to 25 players as they face its dangers in hopes of securing the treasures hidden within. A number of balance passes have been made as well, which will hopefully ensure a more fair and enjoyable experience. For the full details, head on over to the Jade Dynasty official site.

[Source: Perfect World Entertainment press release]

MassivelyJade Dynasty: Legacy to introduce new classes, dungeon, and more originally appeared on Massively on Mon, 05 Dec 2011 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>classescrimson-peaks-voidlanddungeondungeonsexpansionf2pfortafree-to-playincense-valleyincense-valley-mageinstanceinstancesjade-dynastyjade-dynasty-legacyjdlegacynew-classesperfect-world-entertainmentpweMon, 05 Dec 2011 19:00:00 EST<![CDATA[LotRO's Devs of the Roundtable sally forth on Update 5's instance cluster]]>http://massively.joystiq.com/2011/12/02/lotros-devs-of-the-roundtable-sally-forth-on-update-5s-instanc/http://massively.joystiq.com/2011/12/02/lotros-devs-of-the-roundtable-sally-forth-on-update-5s-instanc/http://massively.joystiq.com/2011/12/02/lotros-devs-of-the-roundtable-sally-forth-on-update-5s-instanc/#commentsFiled under: , , , ,

LotRO
What's better than one developer sharing the thought process behind a major update to a game? Six. Cut out the middleman and go right to "six," we say. Ergo, it's lightning development caught in a bottle to see a half-dozen Lord of the Rings Online designers and worldbuilders gather together to talk about the instance cluster of the upcoming Update 5.

Update 5's five instances -- including an epic raid confrontation with Saruman -- presented unique challenges and exciting opportunities for the team. Worldbuilder Dan Ouellette says that Turbine didn't want to limit itself to merely Orthanc: "After looking at all our ideas we knew we didn't want to have them all in the tower, because that would be a very boring cluster. It's a very small space and in general... just really long."

Instead, the team branched out to focus on the surroundings, inner workings, and underneath of Orthanc for the five instances. The different types of instances -- three-, six-, and 12-person -- allowed the team to try out different tricks as well. "It's an exciting and difficult demand when working on a three-man," Content Designer Bob Hess says. "The types of challenges you present to people have to be a little more outside-the-box."

It's a smörgåsbord of delectable information, so if you're craving good group content in LotRO, you'll definitely want to scoop this up.

MassivelyLotRO's Devs of the Roundtable sally forth on Update 5's instance cluster originally appeared on Massively on Fri, 02 Dec 2011 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bob-hessDan-Ouellettedev-q-and-adev-roundtabledeveloper-roundtablef2pfree-to-playinstanceinstance-clusterinstanceslord-of-the-rings-onlinelotroorthancrise-of-isengardrobert-hessroundtablesarumanturbineturbine-entertainmentupdate-5Fri, 02 Dec 2011 17:30:00 EST<![CDATA[The Road to Mordor: Thoughts on Update 5]]>http://massively.joystiq.com/2011/11/19/the-road-to-mordor-thoughts-on-update-5/http://massively.joystiq.com/2011/11/19/the-road-to-mordor-thoughts-on-update-5/http://massively.joystiq.com/2011/11/19/the-road-to-mordor-thoughts-on-update-5/#commentsFiled under: , , , , ,

LotRO
Update 5: Saruman's Obviously Not Compensating for Anything With That Tower will undoubtedly be the last hurrah of Lord of the Rings Online -- this year, that is. It's an interesting update that looks to patch in the rest of Rise of Isengard's content (namely, the instance cluster) and provide a little something-something for players who have already reached the end of the epic storyline and are looking for more.

Earlier this week I took a dev tour through some of the main parts of the update, and while I wasn't able to see all of it (such as the non-raid instances), what I did preview certainly filled my head with opinions, analysis and further questions. Generally I came away pleased with what we're going to experience next month, although the comments section of the tour showed split feelings on what's in store for the patch.

Is this a case of too little, too late for those dissatisfied with Rise of Isengard's release? Will it breathe new life into dungeon-running, especially for the many soloers out there? Is it what this game needs right here and now? Hit the jump and I'll give you my honest thoughts on it all, both the good and the bad.

Continue reading The Road to Mordor: Thoughts on Update 5

MassivelyThe Road to Mordor: Thoughts on Update 5 originally appeared on Massively on Sat, 19 Nov 2011 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>clustercoffeecurrencydungeon-finderf2pfeaturedfree-to-playhaunted-burrowhobbithobbitsinstanceinstance-clusterinstance-finderinstance-joininstancesisengardisengard-clusterlord-of-the-rings-onlinelotropreviewriftrise-of-isengardsarumanthe-prince-of-rohanturbineturbine-entertainmentupdate-5winter-homeworld-of-warcraftwowSat, 19 Nov 2011 12:00:00 EST<![CDATA[Rings and words of power: Going inside LotRO's Update 5]]>http://massively.joystiq.com/2011/11/15/rings-and-words-of-power-going-inside-lotros-update-5/http://massively.joystiq.com/2011/11/15/rings-and-words-of-power-going-inside-lotros-update-5/http://massively.joystiq.com/2011/11/15/rings-and-words-of-power-going-inside-lotros-update-5/#commentsFiled under: , , , , , ,

LOTRO
It's been a couple of days since the news broke that Lord of the Rings Online's Update 5 is going to be bigger than previously thought, with not only a new instance cluster but an additional book in the epic storyline and an Instance Finder system.

As Update 5 goes up on the test server for the remainder of the week, we got in touch with Turbine to talk about the details of this mountain of content heading our way, including an epic confrontation with Rise of Isengard's big baddie himself, Saruman. It wouldn't be a conference call without a few notable surprises as well, and Adam Merskey, Aaron Campbell, Jeff Libby, and Joe Barry were eager to share what the team has been working on for the first update after the expansion.

It's time to wave goodbye to the Rangers, stop putting off instance runs, and take the fight to the bearded dude himself. It's time for Update 5. Get all the skinny after the jump!

Continue reading Rings and words of power: Going inside LotRO's Update 5

MassivelyRings and words of power: Going inside LotRO's Update 5 originally appeared on Massively on Tue, 15 Nov 2011 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>Aaron-Campbelladam-merskydungeon-findereagleconentfeaturedgrey-companyinstanceinstance-clusterinstance-finderinstancesjeff-libbylord-of-the-rings-onlinelotroorthancrangersrise-of-isengardsarumanthe-foundrythe-prince-of-rohantheodredtower-of-orthancupdate-5volume-3-book-5volume-iii-book-5Tue, 15 Nov 2011 18:30:00 EST<![CDATA[Instance finder coming to LotRO in Update 5]]>http://massively.joystiq.com/2011/11/14/instance-finder-coming-to-lotro-in-update-5/http://massively.joystiq.com/2011/11/14/instance-finder-coming-to-lotro-in-update-5/http://massively.joystiq.com/2011/11/14/instance-finder-coming-to-lotro-in-update-5/#commentsFiled under: , , , ,

LOTRO
When Lord of the Rings Online: Rise of Isengard launched, it did so with the understanding that it wasn't quite completed. The expansion had no new instanced content apart from a 24-person raid, and Turbine promised that this would be rectified by the end of the year. Enter the redemption of Update 5, where a new instance cluster will be introducing five additional dungeons into the game. These instances include a walk through Fangorn Forest and a personal encounter with Saruman.

Ten Ton Hammer got a chance to talk with the devs about Update 5 and discovered a few previously unreleased details. The biggest of these is word of an instance finder feature -- AKA a "dungeon finder" -- that is similar to those found in World of Warcraft and RIFT. Through the instance finder, players will be able to queue up for level-appropriate runs and be matched up with other eager adventurers.

Update 5 will also include the next book of the epic storyline titled The Prince of Rohan in which players will part with the Grey Company for new vistas.

Stay tuned to Massively as we'll have a hands-on look at Update 5 later this week!

MassivelyInstance finder coming to LotRO in Update 5 originally appeared on Massively on Mon, 14 Nov 2011 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dungeon-finderepic-storylinef2pfangorn-forestfree-to-playinstanceinstance-finderinstanceslord-of-the-rings-onlinelotropatchriftrise-of-isengardsarumanthe-prince-of-rohantthturbineTurbine-Entertainmentupdateupdate-5world-of-warcraftwowMon, 14 Nov 2011 10:00:00 EST<![CDATA[The Daily Grind: Are you a fan of attunement?]]>http://massively.joystiq.com/2011/09/26/the-daily-grind-are-you-a-fan-of-attunement/http://massively.joystiq.com/2011/09/26/the-daily-grind-are-you-a-fan-of-attunement/http://massively.joystiq.com/2011/09/26/the-daily-grind-are-you-a-fan-of-attunement/#commentsFiled under: , , ,

WoW BC attunement map from WoWpedia
Back in the days of EverQuest, my guild spent an inordinate amount of time camping dungeons for keys so that we could get into even more dungeons to camp for even more keys and so on and so forth. In retrospect, I see that the key-grind was SOE's way of slowing us down and gating us from content for as long as possible so that we wouldn't notice how very little there was of it (back then). It's like goetta: a cheap way to stretch out precious pork over more meals.

World of Warcraft had keys too, even for basic 5-man dungeons, but it also introduced long, convoluted quest chains that players had to complete in order to become "attuned" to certain raid instances -- witness the quest map above, courtesy of WoWpedia. Both of these games have since heavily toned down these content blockades due to player feedback, but their influence is seen across the genre.

What about you folks? Are you a fan of gating content until some grind (be it farming for an item or completing lengthy quest lines) is completed? Or do you just want to push the hokum to the side and get on with dungeoning?

Every morning, the Massively bloggers probe the minds of their readers with deep, thought-provoking questions about that most serious of topics: massively online gaming. We crave your opinions, so grab your caffeinated beverage of choice and chime in on today's Daily Grind!

MassivelyThe Daily Grind: Are you a fan of attunement? originally appeared on Massively on Mon, 26 Sep 2011 08:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>attunementblizzardBlizzard-EntertainmentcampingdungeoneqeverquestgoettainstancekeykeysopinionsoeSony-Online-Entertainmenttdgthe-daily-grindworld-of-warcraftwowMon, 26 Sep 2011 08:00:00 EST<![CDATA[Global Agenda's Recursive Colony launches]]>http://massively.joystiq.com/2011/09/21/global-agendas-recursive-colony-launches/http://massively.joystiq.com/2011/09/21/global-agendas-recursive-colony-launches/http://massively.joystiq.com/2011/09/21/global-agendas-recursive-colony-launches/#commentsFiled under: , , , , , , , , ,

Global Agenda image
Fans of games that tread the line between MMORPG and FPS will be pleased at this news: Today brings the launch of Global Agenda's Recursive Colony expansion, a free update and the "largest content update in the history" of the game, according to Hi-Rez Studios' official website. Chief among the new additions is a new mid- to high-level open zone with a storyline and quests meant to provide an alternate leveling experience for more RPG-minded players. The expansion also includes new daily repeatable quests, a new PvP map called Push Dust, new tutorials, quality-of-life enhancements, crafting tweaks, and a slew of pets, dyes, and other fluff.

To kick off patch day and show off the highlights of the update, Hi-Rez has released a brand-new trailer with a satisfying blend of explosions, robots, and yellowy post-apocalyptic zones. Find it after the cut!

Continue reading Global Agenda's Recursive Colony launches

MassivelyGlobal Agenda's Recursive Colony launches originally appeared on Massively on Wed, 21 Sep 2011 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>expansionfluffgaglobal-agendahi-rezhi-rez-studiosinstancemapnewsopen-zonepatchpush-dustpvppvp-maprecursive-colonytrailertrailersupdatevideovideosWed, 21 Sep 2011 13:00:00 EST<![CDATA[Turbine confirms five new LotRO instances by the end of the year]]>http://massively.joystiq.com/2011/08/24/turbine-confirms-five-new-lotro-instances-by-the-end-of-the-year/http://massively.joystiq.com/2011/08/24/turbine-confirms-five-new-lotro-instances-by-the-end-of-the-year/http://massively.joystiq.com/2011/08/24/turbine-confirms-five-new-lotro-instances-by-the-end-of-the-year/#commentsFiled under: , , , , ,

Rise of Isengard
While a new expansion is usually a cause for celebration, some Lord of the Rings Online players have expressed disappointment that September's Rise of Isengard lacks new instances outside of the much-ballyhooed 24-man raid.

Between convention appearances, Turbine's Sapience confirmed on the forums that while Isengard players won't be enjoying any additional three-man or six-man dungeons, more will come by the end of the year in Update 5:
We are currently preparing five new instances for release post-Isengard.

Rise of Isengard will be released on September 27 along with a 24-player raid. There will be 3 three-player, 1 six-player and 1 twelve-player instance released in Update 5, the first update after the release of Rise of Isengard. These instances will be free to any player who has pre-purchased the Rise of Isengard expansion or who purchases after launch via the Turbine web store.

Update 5 will be available before the end of the year.
Rise of Isengard will be on display at Turbine's booth this weekend at PAX in Seattle.

MassivelyTurbine confirms five new LotRO instances by the end of the year originally appeared on Massively on Wed, 24 Aug 2011 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>12-man12-player24-man-raid24-player-raid3-man3-player6-man6-playerdungeondungeonsexpansionf2pfree-to-playinstanceinstancesisengardlord-of-the-rings-onlinelotropaxraidrise-of-isengardsapienceturbineturbine-entertainmentupdate-5Wed, 24 Aug 2011 18:30:00 EST<![CDATA[Wings Over Atreia: Meeting the (Crucible) Challenge]]>http://massively.joystiq.com/2011/08/15/wings-over-atreia-meeting-the-crucible-challenge/http://massively.joystiq.com/2011/08/15/wings-over-atreia-meeting-the-crucible-challenge/http://massively.joystiq.com/2011/08/15/wings-over-atreia-meeting-the-crucible-challenge/#commentsFiled under: , , , , , , ,

Wings Over Atreia
Can 15 minutes a day really save you more crucible insignia? Is LFG infested with trolls? Last week we touched on the newest addition to Aion's solo instance family, the Crucible Challenge. Although we mentioned that this instance was slightly misnamed (most classes can successfully complete it with one skill bar tied behind their back), that doesn't mean it isn't worthwhile! On the contrary, as with the daily quests, it is nice to have something you can accomplish in just a few minutes a day while still getting closer to meeting a goal. Whether you are trying to coax a platinum medal out of your Runaway Poppy or just collecting insignias for an eternal-grade weapon, fancy new threads, or a pet, just a few minutes a day guarantees progress. How often can you say that?

For those who haven't yet had the opportunity to check this instance out, this week will guide you through the nuts and bolts of it. And for those who just want to maximize their experience, I will toss in a few tips and tricks to zip you through.

Are you up to the challenge? Zone in past the cut to begin!

Gallery: Aion -- Crucible Challenge

Continue reading Wings Over Atreia: Meeting the (Crucible) Challenge

MassivelyWings Over Atreia: Meeting the (Crucible) Challenge originally appeared on Massively on Mon, 15 Aug 2011 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>aionaion-gamecrucible-challengefeaturedgalleriesgallerygodstonesguideinstancenc-softnc-soft-aionncsoftncsoft-aionplatinum-medalsPoppyscreenshotscreenshotssolo-instancesWings-Over-AtreiaMon, 15 Aug 2011 19:00:00 EST<![CDATA[Bounty Bay Online expands into the Raging Seas today]]>http://massively.joystiq.com/2011/08/03/bounty-bay-online-expands-into-the-raging-seas-today/http://massively.joystiq.com/2011/08/03/bounty-bay-online-expands-into-the-raging-seas-today/http://massively.joystiq.com/2011/08/03/bounty-bay-online-expands-into-the-raging-seas-today/#commentsFiled under: , , , , ,

Man the crow's nest! Tighten that jib! Swab the poopdeck! For today, Bounty Bay Online is sailing away from safe harbors and into the Raging Seas content update.

This free-to-play pirate MMO is no stranger to constant peril and sizable patches. Raging Seas adds three new ships to the game and a much improved system to upgrade your boat, with special items that can boost your rudder, hull, cannon range, and more. Also included in the patch is an exciting group instance called the Naval Battle of Gravelines that throws you into an epic sea battle during the Spanish Armada era.

Raging Seas follows this past May's Bounty Bay land-based Atlantis update. You can watch the short trailer for the patch after the jump!

Continue reading Bounty Bay Online expands into the Raging Seas today

MassivelyBounty Bay Online expands into the Raging Seas today originally appeared on Massively on Wed, 03 Aug 2011 13:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>atlantisbounty-baybounty-bay-onlinefrogsterhee-poopdeckinstancenaval-battle-of-gravelinesraging-seasship-improvement-systemspanish-armadatrailervideoWed, 03 Aug 2011 13:30:00 EST<![CDATA[SWTOR walks us through the Flashpoint 'Esseles']]>http://massively.joystiq.com/2011/07/29/swtor-walks-us-through-the-flashpoint-esseles/http://massively.joystiq.com/2011/07/29/swtor-walks-us-through-the-flashpoint-esseles/http://massively.joystiq.com/2011/07/29/swtor-walks-us-through-the-flashpoint-esseles/#commentsFiled under: , , , ,

BioWare and LucasArts have said since the first announcement of Star Wars: The Old Republic that choices will matter. No one witnessed that more than visitors to the BioWare booth at San Diego Comic-Con. These fans had to choose between saving the engineering crew or saving the bridge crew in the Flashpoint called The Esseles.

In this fast-paced instance, you and your party are trapped aboard the Republic cruiser called the Esseles. Like Darth Vader asking for the ambassador on board the Corellian Corvette at the beginning of A New Hope, the commander of an Imperial Star Destroyer in this Flashpoint is also seeking a Republic ambassador. The difference here is the Imperial forces haven't boarded yet. It is your job to hold them off.

After the break, catch the full 13-and-a-half-minute walkthrough narrated by Director of Production Dallas Dickinson, sans epic beard unfortunately.

Continue reading SWTOR walks us through the Flashpoint 'Esseles'

MassivelySWTOR walks us through the Flashpoint 'Esseles' originally appeared on Massively on Fri, 29 Jul 2011 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>BioWarechoicesdallas-dickinsondungeonEAElectronic-ArtsesselesflashpointinstanceLucasArtsrepublicsan-diego-comic-consan-diego-comic-con-2011sdccsdcc-2011Star-Warsstar-wars-the-old-republicswtorthe-old-republictorwalkthroughFri, 29 Jul 2011 13:00:00 EST<![CDATA[Silkroad Online's Mysterious Temple of Jupiter update to go live August 2nd]]>http://massively.joystiq.com/2011/07/28/silkroad-onlines-mysterious-temple-of-jupiter-update-to-go-live/http://massively.joystiq.com/2011/07/28/silkroad-onlines-mysterious-temple-of-jupiter-update-to-go-live/http://massively.joystiq.com/2011/07/28/silkroad-onlines-mysterious-temple-of-jupiter-update-to-go-live/#commentsFiled under: , , ,

If a temple didn't have mystery, would adventurers flock to it? We think not. Therefore, it's a good thing that Silkroad Online still has a few secrets up its sleeves as the dev team prepares to release the game's eighth major update on August 2nd.

Titled Mysterious Temple of Jupiter, this update will offer a slew of new ways for characters to grow and gain in power -- not to mention go all Scooby-Doo on Old Man Jupiter's stomping grounds. Once August 2nd hits, Silkroad players can punch up through ten more levels for a total of 120, tackle 60 additional quests, and learn various new skills from the Chinese and European arts. The aforementioned temple will be available for conquest and plunder, although players will need to be level 111 and up to enter.

Joymax CEO Nam-chul Kim says that this update is a direct result of community feedback: "For the latest expansion to Silkroad Online, we have listened closely to our community of players and are excited to offer new challenges and improvements."

Mysterious Temple of Jupiter follows the last update, Rise of the Thief-Hunter, which came out four months ago.

MassivelySilkroad Online's Mysterious Temple of Jupiter update to go live August 2nd originally appeared on Massively on Thu, 28 Jul 2011 11:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dungeonexpansioninstancejoymaxlevel-caplevel-cap-increasemysterious-temple-of-jupiterNam-chul-Kimpatchrise-of-the-thief-huntersilkroadsilkroad-onlineupdateThu, 28 Jul 2011 11:30:00 EST<![CDATA[New Secret World dev walkthrough delves into the Savage Coast]]>http://massively.joystiq.com/2011/07/08/new-secret-world-dev-walkthrough-delves-into-the-savage-coast/http://massively.joystiq.com/2011/07/08/new-secret-world-dev-walkthrough-delves-into-the-savage-coast/http://massively.joystiq.com/2011/07/08/new-secret-world-dev-walkthrough-delves-into-the-savage-coast/#commentsFiled under: , , , , , , , ,

All right now, all you occultists, paranormal investigators, and conspiracy theorists, it's your turn to squeal with delight. Funcom has treated the world to a spankin'-new dev walkthrough of The Secret World's Savage Coast instance. You may remember we got our first look at the Savage Coast at the beginning of the month. Now, we get to go in for a first-hand look at just what makes this coast so savage.

The walkthrough -- which is so expansive it has to be presented in three parts -- begins with our dev tour-guides Martin Bruusgaard (Lead Designer) and Joel Bylos (Lead Content Designer) jumping into the dungeon linked to the Solomon Island zone, which they note is the first that players will encounter as they play through The Secret World. After a short preview of the quest-receiving experience (which includes voice acting that's rather good, especially for a game still in development), it descends into a rollercoaster ride into the mouth of madness.

The developers take on the Draugh (undead Norse warriors out for vengeance) and their masters throughout the course of the dungeon, which culminates in a scene straight out of Lovecraft's best. We'd hate to spoil the whole thing for you (and it's so long we really don't have the space!), but believe us, it's well worth the watch for any TSW fan. So head on past the cut for the full walkthrough videos!

Continue reading New Secret World dev walkthrough delves into the Savage Coast

MassivelyNew Secret World dev walkthrough delves into the Savage Coast originally appeared on Massively on Fri, 08 Jul 2011 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>cthulhu-fhtagndev-tourdev-walkthroughdraughdungeonfuncominstancejoel-byloslovecraftlovecraftianmartin-bruusgaardsavage-coastsweet-merciful-god-what-is-thatthe-savage-coastthe-secret-worldtswvideovideoswalkthroughFri, 08 Jul 2011 16:30:00 EST<![CDATA[New TERA video takes players inside the Dark Cathedral]]>http://massively.joystiq.com/2011/07/07/new-tera-video-takes-players-inside-the-dark-cathedral/http://massively.joystiq.com/2011/07/07/new-tera-video-takes-players-inside-the-dark-cathedral/http://massively.joystiq.com/2011/07/07/new-tera-video-takes-players-inside-the-dark-cathedral/#commentsFiled under: , , , , ,

Our last look at TERA took us inside a day in the life of the wendigo Uchamba. Today, a new video from En Masse takes us inside the hallowed halls of the ominous Dark Cathedral instance. The short gameplay video features a group of adventurers taking on quite a few of the Cathedral's denizens, and its visuals are quite stunning to watch.

It also gives players a look at TERA's "real action combat," which requires players to actively dodge and block in response to enemy attacks. If hot chicks, handsome men, and adorable panda creatures beating the ever-loving crap out of huge monsters sounds like your idea of a good time, head on past the cut for the full video.

Continue reading New TERA video takes players inside the Dark Cathedral

MassivelyNew TERA video takes players inside the Dark Cathedral originally appeared on Massively on Thu, 07 Jul 2011 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bamblueholebluehole-studiodark-cathedraldungeonen-masseen-masse-entertainmentfanserviceinstanceteratrailertrailersvideovideosThu, 07 Jul 2011 17:30:00 EST<![CDATA[Massively Exclusive: Battle of the Immortals reveals two new instances]]>http://massively.joystiq.com/2011/06/28/massively-exclusive-battle-of-the-immortals-reveals-two-new-ins/http://massively.joystiq.com/2011/06/28/massively-exclusive-battle-of-the-immortals-reveals-two-new-ins/http://massively.joystiq.com/2011/06/28/massively-exclusive-battle-of-the-immortals-reveals-two-new-ins/#commentsFiled under: , , ,

Sharpen your swords and fletch your arrows, because when the Titan update hits in Battle of the Immortals, it'll be time to dive into two of the fiercest dungeons known to mankind.

While we've looked at some of the lore behind the Titan update last week, now it's time to get into the nitty-gritty details of what this patch will bring. Perfect World has created two new maps for players to explore -- and exploit -- in their efforts to become big, rich and powerful: Black Dragon Lair and Giants Kingdom.

The update will also include the much-awaited Generation III pets, which can be bred with two Generation II pets of both genders. Generation IIIs feature faster attack speeds and higher damage output, so it's safe to say they'll be highly desired by players.

Battle of the Immortals' Titan update is scheduled for a July release, but in the meanwhile you can read up on the new dungeons in an exclusive dev blog after the jump!

Continue reading Massively Exclusive: Battle of the Immortals reveals two new instances

MassivelyMassively Exclusive: Battle of the Immortals reveals two new instances originally appeared on Massively on Tue, 28 Jun 2011 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>battle-of-the-immortalsblack-dragon-lairdungeondungeonsfeaturedgeneration-iigeneration-iiigeneration-iii-petsgiants-kingdomgunkinstanceinstanceskronosmapmapsmoserperfect-worldperfect-world-entertainmentpetpetspwerobotrobotsthird-generation-petstitantitan-updateTue, 28 Jun 2011 12:00:00 EST<![CDATA[Witness Ra's al Ghul's revenge in the new DCUO trailer]]>http://massively.joystiq.com/2011/06/02/witness-ras-al-ghuls-revenge-in-the-new-dcuo-trailer/http://massively.joystiq.com/2011/06/02/witness-ras-al-ghuls-revenge-in-the-new-dcuo-trailer/http://massively.joystiq.com/2011/06/02/witness-ras-al-ghuls-revenge-in-the-new-dcuo-trailer/#commentsFiled under: , , , ,

In you haven't heard, Ra's Al Ghul, a nemesis of the Caped Crusader, has dug his talons into DC Universe Online, and it's up to you to stop him from killing millions of innocent people by joining other heroes in this 4-man alert and defeat Ra's and his lethal minions deep in his mountain stronghold. Jens Andersen, the creative director for DCUO, shares the latest visuals in a walkthrough video released by IGN and presents a guided tour of the inner sanctum of Ra's al Ghul's League of Assassins. Each member of the league has his or her own mystic power you must overcome before you face off against Ra's al Ghul himself.

This 4-man alert is just part of the new additions to DC Universe Online in Update 3. Get the whole scoop from Krystalle Voecks, who recently sat down with the developers to discuss the patch, then check out the video after the break.

Continue reading Witness Ra's al Ghul's revenge in the new DCUO trailer

MassivelyWitness Ra's al Ghul's revenge in the new DCUO trailer originally appeared on Massively on Thu, 02 Jun 2011 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>4-man-alertalertdc-comicsdc-universe-onlineDCUOdungeoninstancejens-andersenras-al-ghulSOESonySony-Online-Entertainmenttrailerupdate-3videoWarner-BrosThu, 02 Jun 2011 18:30:00 EST<![CDATA[The Daily Grind: What excuse do you use to get out of dungeon runs?]]>http://massively.joystiq.com/2011/03/28/the-daily-grind-what-excuse-do-you-use-to-get-out-of-dungeon-ru/http://massively.joystiq.com/2011/03/28/the-daily-grind-what-excuse-do-you-use-to-get-out-of-dungeon-ru/http://massively.joystiq.com/2011/03/28/the-daily-grind-what-excuse-do-you-use-to-get-out-of-dungeon-ru/#commentsFiled under: , , ,

It happens to the best and most well-intentioned of us. There we are, deep in the thick of instanced battle, and we need to go. We have to go. For whatever reason, this dungeon run isn't working out and it's time to bail.

Maybe the group is frustrating you 10 ways from Sunday. Maybe you've wiped so many times that it's a foregone conclusion that a victory is never going to happen. Maybe a teammate is irking you and you've broken two fingers from throttling your monitor in frustration. Maybe you're just exhausted and ready for some shuteye.

Whatever the situation, what is your go-to excuse to extricate yourself from a dungeon run or raid? Do you tell the honest truth or go for the easy lie? Do you have a ready-made excuse lined up, such as the infamous "Oops electrical storm crashed my computer!"? It's OK -- we've all been there.

Every morning, the Massively bloggers probe the minds of their readers with deep, thought-provoking questions about that most serious of topics: massively online gaming. We crave your opinions, so grab your caffeinated beverage of choice and chime in on today's Daily Grind!

MassivelyThe Daily Grind: What excuse do you use to get out of dungeon runs? originally appeared on Massively on Mon, 28 Mar 2011 08:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>and-your-baby-is-so-not-awake-so-dont-try-thatdungeondungeon-runsexcuseexcusesinstanceinstance-runsleaversopiniontdgthe-daily-grindMon, 28 Mar 2011 08:00:00 EST<![CDATA[PAX East 2011: Hands-on with SWTOR's Taral V]]>http://massively.joystiq.com/2011/03/16/pax-east-2011-hands-on-with-swtors-taral-v/http://massively.joystiq.com/2011/03/16/pax-east-2011-hands-on-with-swtors-taral-v/http://massively.joystiq.com/2011/03/16/pax-east-2011-hands-on-with-swtors-taral-v/#commentsFiled under: , , , , , , , , , , , ,

Star Wars: The Old Republic was an obvious hit at PAX East. Fans stood in line for hours just to get a chance to touch one of the most anticipated games of this year and to catch a glimpse of Taral V, the first publicly shown Flashpoint. The excitement to be one of the first to get hands on SWTOR group content was palpable. Our contributing editors Larry Everett and Eliot Lefebvre scored that opportunity to play the game last Saturday. Read on as our intrepid reporters showcase their experiences in the Star Wars universe. Draw your blaster and ignite your lightsaber as we head to a galaxy far, far away...

Larry Everett: There are many things that can distract you from actually playing Star Wars: The Old Republic. Who wouldn't be distracted by the incredible layered scenery? I'd think the spot-on animations would make you want to attack more, although it is possible that you could attack the wrong target. Perhaps it was the vivid facial expressions that would cause someone to not make a dialogue choice. These have to be the reasons behind the fact that the Jedi Knight on our team completely failed to do his job in one of the most incredibly polished games and easy-to-slide-into games I have have ever played.

Continue reading PAX East 2011: Hands-on with SWTOR's Taral V

MassivelyPAX East 2011: Hands-on with SWTOR's Taral V originally appeared on Massively on Wed, 16 Mar 2011 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>BioWaredungeonEAElectronic-ArtsfeaturedFlashpointhands-oninstancejedi-knightlearn-to-tankLucasArtspaxpax-2011pax-eastpax-east-2011smugglerStar-Warsstar-wars-the-old-republicswtorswtor-hands-onthe-old-republictorWed, 16 Mar 2011 15:30:00 EST<![CDATA[Alter-Ego: A quick and dirty guide to Area 51]]>http://massively.joystiq.com/2011/02/12/alter-ego-a-quick-and-dirty-guide-to-area-51/http://massively.joystiq.com/2011/02/12/alter-ego-a-quick-and-dirty-guide-to-area-51/http://massively.joystiq.com/2011/02/12/alter-ego-a-quick-and-dirty-guide-to-area-51/#commentsFiled under: , , , ,

When it comes to taking your first steps in DC Universe Online, the sheer amount of different types of missions and objectives can be a bit daunting. "What is this Alert thing sitting in my quest log?" you might say. "What does it do? It is PvP? PvE? What's the point of doing an Alert?" Well, to help demystify some of DC Universe Online's content for you, I wanted to offer up a basic overview to the very first in-game Alert: Area 51. However, knowing that some of you have already run this instance, I also wanted to make it useful for those who may have popped in but not spent a great deal of time in the zone. That's why this post not only contains a first-timer's overview of this Alert but also gives more advanced players a handy guide to all the Investigations, Player Briefings and Collections -- as well as a couple of other things I found in the Area 51 zone that might have been missed otherwise.

Ready to dig in and help beat Brainiac back from trying to take over? Curious about what kind of extra goodies can be gained? Join me after the break as I take some of the mystery out of the notorious Area 51!

Continue reading Alter-Ego: A quick and dirty guide to Area 51

MassivelyAlter-Ego: A quick and dirty guide to Area 51 originally appeared on Massively on Sat, 12 Feb 2011 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alertarea-51bluebrainiaccadmuscadmus-research-findingscollectioncollectionsdc-universe-onlinedcuoglobal-briefingglobal-investigationsgreengroup-contentguideinstanceinvestigationinvestigationsinvestivationlevel-10normalplayer-briefingplayer-briefssoesony-online-entertainmentwalkthroughwelcome-to-groom-lakeyellowSat, 12 Feb 2011 12:00:00 EST<![CDATA[SWTOR dev builds mini-movies in Flashpoints]]>http://massively.joystiq.com/2011/02/04/swtor-dev-builds-mini-movies-in-flashpoints/http://massively.joystiq.com/2011/02/04/swtor-dev-builds-mini-movies-in-flashpoints/http://massively.joystiq.com/2011/02/04/swtor-dev-builds-mini-movies-in-flashpoints/#commentsFiled under: , , , ,

We all know BioWare is acclaimed for the presentation of its games. Single-player games like Knights of the Old Republic, Mass Effect, and DragonAge have a way of capturing a player and immersing him in the world. How many of you have ever wondered what it would be like to invite your friends along for a ride on a BioWare game, too? This could be the key reason BioWare decided to make Flashpoints in Star Wars: The Old Republic.

Jesse Sky is a world designer at BioWare Austin. In the most resent developers blog for SWTOR, he details what it takes to build a Flashpoint. He explains that it's not all about getting to the next boss fight: "Fighting through legions of enemies is part of what makes the cooperative gameplay feel heroic, but we find it helps if your enemies do more than just stand around waiting to be attacked." According to Sky, many players have run dungeons that have them wondering why they are there, with no sense of purpose. "We want you to feel like you are the heroes in a Star Wars action sequence, but we also want to give you opportunities to roleplay with your friends." Sky indicates again that SWTOR's emphasis is not only making a great game but also making a great story.

Be sure to read the whole developers blog on the official Star Wars: The Old Republic website.

MassivelySWTOR dev builds mini-movies in Flashpoints originally appeared on Massively on Fri, 04 Feb 2011 11:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>BioWareBioWare-has-got-storydeveloper-blogdeveloper-diarydungeondungeonseaElectronic-ArtsflashpointflashpointsinstanceinstancesJesse-SkyLucasArtsStar-Warsstar-wars-the-old-republicswtorthe-old-republictorworld-designFri, 04 Feb 2011 11:30:00 EST<![CDATA[Frogster announces Runes of Magic Boss Rush video contest]]>http://massively.joystiq.com/2011/02/03/frogster-announces-runes-of-magic-boss-rush-video-contest/http://massively.joystiq.com/2011/02/03/frogster-announces-runes-of-magic-boss-rush-video-contest/http://massively.joystiq.com/2011/02/03/frogster-announces-runes-of-magic-boss-rush-video-contest/#commentsFiled under: , , , , , ,

Fantasy MMO Runes of Magic has been in the news a lot lately, and it hasn't all been positive. Last month, self-proclaimed hacker Cpt.Z3r0 claimed to be in possession of the login details to 3.5 million Runes of Magic game accounts. It's not all bad news, though, as today Frogster announced a great new video contest for RoM players. In honour of San Francisco's upcoming Game Developers Conference at the end of the month, Frogster is giving players the chance to have their video creations featured on the massive widescreen TV in the Frogster booth.

To enter the Boss Rush video contest, all you have to do is make a video of you and your friends taking down one of RoM's many instance or world bosses. Upload your video to YouTube and then send a link to the video to the email address provided to be entered into the contest. The best videos will be put to a general vote by the RoM community, who will pick their single favourite entry to win a huge additional prize. The guild members featured in the video that receives the most votes will be given a Grand Golden Repair Hammer in-game, and the guild leader will get a real-life golden hammer signed by Frogster's US GM team.

Although any video can be entered, there are a few things you can do to massively improve your chances of success. Uploading your video in a resolution of at least 720p, using a 16:9 aspect ratio and keeping a constant frame-rate of 25 will make your video look more professional. It's also advised that you pick a boss with interesting mechanics, as only the most entertaining videos to watch will be selected. Lastly, Frogster insist that you don't add any extra audio or music that you don't own the rights to. Entries must be in by February 28th for a chance to win.

MassivelyFrogster announces Runes of Magic Boss Rush video contest originally appeared on Massively on Thu, 03 Feb 2011 21:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bossboss-rushcompetitioncontestfilmfrogstergdcgdc-2011instancepveromrunes-of-magicrunewalkervideoThu, 03 Feb 2011 21:00:00 EST<![CDATA[The Road to Mordor: The final ding]]>http://massively.joystiq.com/2011/01/28/the-road-to-mordor-the-final-ding/http://massively.joystiq.com/2011/01/28/the-road-to-mordor-the-final-ding/http://massively.joystiq.com/2011/01/28/the-road-to-mordor-the-final-ding/#commentsFiled under: , , ,

It happened far sooner than I'd hoped. I tried to put it off, to ignore the creeping bar, to spend my days in frivolous activities instead of fighting evil -- but to no avail. It was a simple quest turn-in somewhere deep in Mirkwood, and with only two elves to witness the event, a stream of white light erupted from my head.

I was level 65.

For me, it's always been extremely disconcerting to hit endgame in any MMO, which is probably why Lord of the Rings Online marks only the fourth game of my MMO career in which this has happened. I like the feeling of leveling up, gaining experience, going on a mostly solo journey through the lands. But once I ding that final level, the XP gains go away and the questions arise.

What do I do now? Should I become concerned with raiding? I wasn't before! Is there a purpose to keep on questing at this point without XP? Am I going to avoid fighting mobs unless I absolutely have to do so? What is there to do? Will I get bored? Who replaced my wallet with a ketchup packet before I sat down?

Join me after the jump as I take you through these questions and more on my journey to discover a life after the final ding.

Continue reading The Road to Mordor: The final ding

MassivelyThe Road to Mordor: The final ding originally appeared on Massively on Fri, 28 Jan 2011 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bree-landcaptaincatch-22deedsdungeonenedwaithettenmoorsexperienceForochelgladdeninstanceitem-experienceixplandrovallegendary-itemslevel-65level-caplilord-of-the-rings-onlinelothlorienlotromirkwoodmonster-playplayer-vs-monster-playerpvmpraidrise-of-isengardrivendellsandboxsarumantheme-parkturbineturbine-entertainmentvirtuesxpFri, 28 Jan 2011 13:00:00 EST<![CDATA[Gardening gone bad: RIFT's Runic Descent revealed]]>http://massively.joystiq.com/2011/01/04/gardening-gone-bad-rifts-runic-descent-revealed/http://massively.joystiq.com/2011/01/04/gardening-gone-bad-rifts-runic-descent-revealed/http://massively.joystiq.com/2011/01/04/gardening-gone-bad-rifts-runic-descent-revealed/#commentsFiled under: , , ,

As RIFT beta testers are sharpening their knives and stringing their bows in anticipation of this weekend's PvP beta event, Trion Worlds continues to reveal the true scope of Telara. The team is proud to present the latest RIFT dungeon: Runic Descent.

Runic Descent challenges teams of five players to band together and cull the bad weeds of a twisted garden that sits beside the ancient Dwarven city of Hammerknell. In so doing, the players will aid the Dwarves' attempt to reclaim their heritage while uprooting world-corrupting magic. And if there's madcap looting in the process? Nobody will complain.

As it has with all of RIFT's other dungeon and zone reveals, Trion isn't skimping on the backstory either. Hit the jump for the tale of Runic Descent, as well as a few brand-new screenshots of the instance.

Continue reading Gardening gone bad: RIFT's Runic Descent revealed

MassivelyGardening gone bad: RIFT's Runic Descent revealed originally appeared on Massively on Tue, 04 Jan 2011 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>beta-eventclosed-betaDeathtouchdungeondwarfdwarvesfaerieshammerknellinstanceloremoonshadepreviewpvepvpregulosriftrift-planes-of-telararunic-descenttelaraTue, 04 Jan 2011 09:00:00 EST<![CDATA[LotRO's Siege of Mirkwood discounted to become the one price to sell them all]]>http://massively.joystiq.com/2010/12/27/lotros-siege-of-mirkwood-discounted-to-become-the-one-price-to/http://massively.joystiq.com/2010/12/27/lotros-siege-of-mirkwood-discounted-to-become-the-one-price-to/http://massively.joystiq.com/2010/12/27/lotros-siege-of-mirkwood-discounted-to-become-the-one-price-to/#commentsFiled under: , , , ,

While many of us have spent a great amount of time and money shopping for other people this holiday season, it's sometimes easy to overlook yourself in all of the hustle and bustle. Treat yourself to something nice this week -- you deserve it! May we suggest a gaming Snuggie for those long nights of raiding, or perhaps 50% off of Lord of the Rings Online: Siege of Mirkwood?

As part of the Turbine Tuesdays sales, the LotRO store will be selling the game's second expansion for half off the regular price this Tuesday, December 28th. Siege of Mirkwood is priced at 995 Turbine Points in the NA store (which is around $10), but on the 28th the cost will be halved to 498 ($5).

The Siege of Mirkwood expansion unlocks over 150 quests, zone deeds, five instances and plenty of content for high-level players. Currently, free players may access the zone and experience the epic storyline, but the rest of the content is walled off unless this quest pack is purchased.

MassivelyLotRO's Siege of Mirkwood discounted to become the one price to sell them all originally appeared on Massively on Mon, 27 Dec 2010 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>cash-shopchristmasdeeddungeonf2pfree-to-playholidayholiday-saleinstanceitem-storelord-of-the-rings-onlinelotrolotro-storepromotionsalesiege-of-mirkwoodsnuggietpturbineturbine-pointsturbine-tuesdaysMon, 27 Dec 2010 09:00:00 EST<![CDATA[Arithion from The Rift Podcast visits Trion, investigates the endgame]]>http://massively.joystiq.com/2010/12/17/arithion-from-the-rift-podcast-visits-trion-investigates-the-en/http://massively.joystiq.com/2010/12/17/arithion-from-the-rift-podcast-visits-trion-investigates-the-en/http://massively.joystiq.com/2010/12/17/arithion-from-the-rift-podcast-visits-trion-investigates-the-en/#commentsFiled under: , , , , ,

This week, Arithion from the RIFT Podcast temporarily traded in her microphone for a camera and traveled to Trion Worlds to get a firsthand look at RIFT. While we've heard a lot about features like the dynamic invasions and the soul system, Ari was determined to investigate one area of the game that we haven't heard much about -- the endgame. She writes:

"A game needs to have Endgame content in order to appeal to me - and with so many recent games failing to deliver precisely that, I was resigned to the fact that RIFT would probably do the same and I'd end up with a game to pass the time for a couple of months before subjecting me to the boredom of nothing to play until the next thing comes out. I was wrong."

Happily, she reports that RIFT has some exciting endgame content, including two raid instances and many raid rifts, which she describes as "magnificent, difficult, (and) damn impressive." Head to The RIFT to read more about her visit and details on RIFT's raid content.

MassivelyArithion from The Rift Podcast visits Trion, investigates the endgame originally appeared on Massively on Fri, 17 Dec 2010 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>arithiondungeondungeonsendgameinstanceinstancespodcastraid-riftsraidingriftrift-planes-of-telararift-podcasttriontrion-worldsFri, 17 Dec 2010 09:00:00 EST<![CDATA[Rift reveals new King's Breach instance]]>http://massively.joystiq.com/2010/11/30/rift-reveals-new-kings-breach-instance/http://massively.joystiq.com/2010/11/30/rift-reveals-new-kings-breach-instance/http://massively.joystiq.com/2010/11/30/rift-reveals-new-kings-breach-instance/#commentsFiled under: , , , , , , ,

With the Rift beta mere days away, Trion Worlds is amping up the information flow for its forthcoming fantasy opus. Today brings us a reveal of the new King's Breach instance, a battleground where creatures from the Life rift and the Death rift are locked in deadly combat.

Rift is a high fantasy world where portals scar the surface of the planet Telara, bringing new characters, treasure, and events as the game world changes dynamically. Check out the new King's Breach gallery below, and teleport past the cut for a lengthy lore summary of the new instance.

Gallery: RIFT: Location Reveals

Continue reading Rift reveals new King's Breach instance

MassivelyRift reveals new King's Breach instance originally appeared on Massively on Tue, 30 Nov 2010 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>death-riftgalleryinstancekings-breachlife-riftloreriftrift-planes-of-telararift-portals-of-telarascreenshotstriontrion-world-networktrion-worldsTue, 30 Nov 2010 11:00:00 EST<![CDATA[Lost Pages of Taborea: Spam heal is the enemy of strategy]]>http://massively.joystiq.com/2010/11/08/lost-pages-of-taborea-spam-heal-is-the-enemy-of-strategy/http://massively.joystiq.com/2010/11/08/lost-pages-of-taborea-spam-heal-is-the-enemy-of-strategy/http://massively.joystiq.com/2010/11/08/lost-pages-of-taborea-spam-heal-is-the-enemy-of-strategy/#commentsFiled under: , , , ,

Last week, I spoke a bit about whether Runes of Magic was too easy or not. In that article I harken back to the mana strike that players held to remove part of a patch that added a percentage-to-cost modifier on all spells for all classes. This week I wanted to flit around the same subjects, but from the viewpoint of healing and strategy.

I want my readers to be well-versed in RoM 101. Just like I set out to do with my community guide for new and old players, I want to educate players today on the fine art of button-mashing. Let's start by covering what spam healing -- or spamming any skill -- is, and why it's not always fun. I'll put this into the context of dungeon-running, cover some fun strategy that results from not being able to spam heal, and give my opinion on how well (or not-so-well) all this works in RoM.

Continue reading Lost Pages of Taborea: Spam heal is the enemy of strategy

MassivelyLost Pages of Taborea: Spam heal is the enemy of strategy originally appeared on Massively on Mon, 08 Nov 2010 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>boss-fightsbossesbutton-mashingdungeondungeonsfeaturedfrogsterfrogster-americafrogster-interactivehealinghealsinstanceinstancesmanamana-poolmana-regenpriestpriest-spellspriest-strateyromrunes-of-magicrunewakerrunewaker-entertainmentskill-spammingspamspam-healspammingstrategyMon, 08 Nov 2010 15:00:00 EST<![CDATA[Wings Over Atreia: Destination guide -- Taloc's Hollow]]>http://massively.joystiq.com/2010/11/08/wings-over-atreia-destination-guide-talocs-hollow/http://massively.joystiq.com/2010/11/08/wings-over-atreia-destination-guide-talocs-hollow/http://massively.joystiq.com/2010/11/08/wings-over-atreia-destination-guide-talocs-hollow/#commentsFiled under: , , ,

Are you weary of group dynamic bickering, spittle-laced rants, or plowing through repeatable quests until your head is spinning and your hands have a death-grip on your weapon? Are the crowds around Atreia just getting to you? Why not spend some quality time alone... when you needn't answer to anyone else? That's right folks! Leave your friends, your legion-mates, and all reminders of real life behind and come visit beautiful Taloc's Hollow!

Thinking of just kicking your heels up in Pandaemonium or Sanctum? Lounging around in an inner tube on dry land hardly a getaway makes, so hurry on down to the lush lands of Taloc's Forest (Inggison) or Krug Basin (Gelkmoros) for a little R&R -- rewards and, well, rewards. What does Taloc's have to offer? For the discerning level 51-55 adventurer, Taloc's offers the unique opportunity to gather treasure and soak up experience, all without having to share any of it with your compatriots. Need a random five-minute break to grab that leftover pizza? No problem! Find an awesome piece of fabled jewelry? Nope, you don't have to roll -- it's all yours.

Choose Taloc's Hollow as your next Aion destination spot today! Ready for adventure? Cruise on past the cut for a guided tour, along with some helpful hints, special tips, and time-saving deals for your trip.

Continue reading Wings Over Atreia: Destination guide -- Taloc's Hollow

MassivelyWings Over Atreia: Destination guide -- Taloc's Hollow originally appeared on Massively on Mon, 08 Nov 2010 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>aionaion-gamefeaturedguideinstanceinstanceslootnc-softnc-soft-aionncsoftncsoft-aionpvequestQuestsrepeatable-contentRepeatable-Questrepeatable-questssolosolo-instancestaloctalocs-hollowWings-Over-AtreiaXPMon, 08 Nov 2010 11:00:00 EST<![CDATA[The Anvil of Crom: Traveling the Silk Road]]>http://massively.joystiq.com/2010/08/29/the-anvil-of-crom-traveling-the-silk-road/http://massively.joystiq.com/2010/08/29/the-anvil-of-crom-traveling-the-silk-road/http://massively.joystiq.com/2010/08/29/the-anvil-of-crom-traveling-the-silk-road/#commentsFiled under: , , ,

Last week we spoke briefly with Funcom executive producer and game director Craig "Silirrion" Morrison regarding Age of Conan's random encounter mechanic, which will invoke a series of one-off solo instances designed to add a bit of flavor to the journey to Hyboria's Far East. We also checked out five of the 11 available instances: four sea-faring adventures and one rare-spawn quest-giving encounter.

This week, we'll step through the remaining five adventures, all of them land-locked, in addition to taking a quick look at the second rare spawn. Voyage past the cut for more.

Continue reading The Anvil of Crom: Traveling the Silk Road

MassivelyThe Anvil of Crom: Traveling the Silk Road originally appeared on Massively on Sun, 29 Aug 2010 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>age-of-conanage-of-conan-random-encountersanvil-of-cromanvil-of-crom-guidesaoccraig-morrisonfar-eastfeaturedfuncomguidesinstanceinstanceskhitaikhitai-random-encountersopinionsilirrionsilk-roadsilk-road-instancesolosoloingthe-anvil-of-cromSun, 29 Aug 2010 12:00:00 EST<![CDATA[Massively's hands-on with Rift: Planes of Telara's dynamic content]]>http://massively.joystiq.com/2010/08/18/massivelys-hands-on-with-rift-planes-of-telaras-dynamic-conte/http://massively.joystiq.com/2010/08/18/massivelys-hands-on-with-rift-planes-of-telaras-dynamic-conte/http://massively.joystiq.com/2010/08/18/massivelys-hands-on-with-rift-planes-of-telaras-dynamic-conte/#commentsFiled under: , , , , , , , , , , , , ,

Just a few weeks ago, I was invited to attend Trion Worlds' Gamer's Day in San Francisco to get some hands-on time with a couple of the company's upcoming titles, including Rift: Planes of Telara. If Rift seems to have come out of nowhere, that might be due both to the acquisition of EverQuest II veteran Scott Hartsman to head the project as executive producer, and to a clever name change meant to reflect the team's shift in development focus.

In fact, that shift in development focus is precisely what I was at Trion's studio to test -- I got to check out the Rifts themselves in all their glory, in the context of the greater dynamic content system that the developers are so excited about. Massively's writers have been able to play and report on character creation and the starting areas of Rift several times over the last year or so, including earlier this summer at E3. But until today's embargo lift (coinciding with the reveal at Gamescom), no one had quite seen the fabled planar invasions and takeovers in action.

Now we have.

Continue reading Massively's hands-on with Rift: Planes of Telara's dynamic content

MassivelyMassively's hands-on with Rift: Planes of Telara's dynamic content originally appeared on Massively on Wed, 18 Aug 2010 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>achievementAchievementsaddonsalphaalpha-testbattlegroundsbuildscallingCapture-the-flagcharacter-creationcharge-barclericclunkcollectionCollectionscraftingdefiantDemodynamic-contentEarth-Elementalelementalistepic-mountfeaturedfootholdfootholdsgallerygloamwoodgraphicsgroupgroupinggroupsguardianhealershealinghell-levelsheroes-of-telaraholy-city-of-sanctuminstanceinstancesinterfaceinvasionjumpingjust-say-no-to-hell-levelslootmapmapsminimapmodsp2ppay-to-playpetsphilosophyplaneplanesplanes-of-telarapublic-questspvpquestingrealm-of-the-faerespecresurrectionriftrift-planes-of-telarariftsscott-hartsmanscreenshotsshadowlandssoul-walkSteamPunkstrategerystrategysubscriptionswimmingtalent-treestalentstavril-plazatelaratrailertriontrion-worldsUIvideowarfrontwarfrontsWed, 18 Aug 2010 09:00:00 EST<![CDATA[Aika previews Ashes of Betrayal and announces launch date]]>http://massively.joystiq.com/2010/05/26/aika-previews-ashes-of-betrayal-and-announces-launch-date/http://massively.joystiq.com/2010/05/26/aika-previews-ashes-of-betrayal-and-announces-launch-date/http://massively.joystiq.com/2010/05/26/aika-previews-ashes-of-betrayal-and-announces-launch-date/#commentsFiled under: , , , , , ,

The turnaround on Aika's upcoming expansion has been more than acceptable. The announcement of Ashes of Betrayal came very recently, and already we have a target date of June 17th for release. But if that weren't enough, the development team has been hard at work with the new region of Darkrane Forest, creating both new lore and new art for the region.

Home to the half-bird, half-human Kynari, the forest was peaceful until the recent coup performed by the Kynari Darkrane, killing High Castor Isaiah and throwing the region into turmoil. Players will take on the sizable task of restoring order with the help of Isaiah's son Hakks, as well as uncovering the dark forces behind Darkrane's rise to power, including a new instanced dungeon.

There will also be new equipment and skill improvements, starting at level 51. We have screenshots of the new armor available to the Conqueror and Templar, the highest tier of growth for the Warrior and Paladin classes, as well as some of the enemies you'll face in the forest and a map of the region. Take a look at our gallery, and get ready for Aika's expansion due in less than a month.

Gallery: Aika Expansion Preview

MassivelyAika previews Ashes of Betrayal and announces launch date originally appeared on Massively on Wed, 26 May 2010 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>aikaaika-onlineashes-of-betrayalbackstorybetrayalexpansionf2pfree-to-playgpotatoinstanceinstanced-dungeonlevel-caplevelslorespecializationupdatesWed, 26 May 2010 09:00:00 EST<![CDATA[EverQuest II goes down The Hole]]>http://massively.joystiq.com/2010/01/11/everquest-ii-goes-down-the-hole/http://massively.joystiq.com/2010/01/11/everquest-ii-goes-down-the-hole/http://massively.joystiq.com/2010/01/11/everquest-ii-goes-down-the-hole/#commentsFiled under: , , , , , ,

Ahhh, The Hole. Fond memories of losing our corpses in this zone, there are. Well, the infamous dungeon with the name of an adult movie is back and better than ever in EverQuest II, as the former city of Paineel will be re-introduced in the new Sentinel's Fate expansion pack.

The ancient city of Paineel is coming with a brand new swath of content, featuring over 30 bosses and 80 quests in the contested open world version of the city, as well as 3 new instanced areas for groups level 85+ to conquer.

The EverQuest II main site has just posted their interviews with Timetraveller and Gninja, two of the developers who worked hard on putting together the contested and instanced versions of The Hole. The interview covers their perspectives and thoughts in breathing new life into this old EverQuest area, and how the new fallen city will lure in the many adventurers of EverQuest II.

MassivelyEverQuest II goes down The Hole originally appeared on Massively on Mon, 11 Jan 2010 16:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>contested-dungeondungeoneq2eqiieverquest-2everquest-iieverquest-ii-sentinels-fateinstanceinstanced-dungeonoduspaineelsentinels-fatesoesony-online-entertainmentthe-holeMon, 11 Jan 2010 16:00:00 EST