Massively http://massively.joystiq.com Massively http://www.blogsmithmedia.com/http://massively.joystiq.com/media/feedlogo.gif Massively http://massively.joystiq.com en-us Copyright 2013 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[Hall conquers Everest, talks DayZ's ownership and loss]]>http://massively.joystiq.com/2013/05/24/hall-conquers-everest-talks-dayzs-ownership-and-loss/http://massively.joystiq.com/2013/05/24/hall-conquers-everest-talks-dayzs-ownership-and-loss/http://massively.joystiq.com/2013/05/24/hall-conquers-everest-talks-dayzs-ownership-and-loss/#commentsFiled under: , , , , , ,

Dean Hall on top of Mt. Everest
Dean Hall has officially made it to the top of the world. The DayZ creator watched the sun rise from the summit of Mt. Everest on May 21st, according to a tweet released earlier today.

Gamasutra recently asked Hall about his Arma zombie mod's phenomenal success, and he pointed to the design's ability to trigger psychological responses to both ownership and loss. "I think the big thing was that it was this finely-crafted mix of permadeath -- which gave you a sense of value, because you could lose something -- and ownership," Hall explained. "Because it's persistent, it means that it's going to be there tomorrow. I think those two things mixed together meant that you had these really valuable stories that came from it."

MassivelyHall conquers Everest, talks DayZ's ownership and loss originally appeared on Massively on Fri, 24 May 2013 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dayzdean-halldean-hall-everestdean-hall-interviewhorrorinterviewrocketsandboxFri, 24 May 2013 19:00:00 EST<![CDATA[Chaos Theory: Opinions, facts, and open flames]]>http://massively.joystiq.com/2013/05/20/chaos-theory-opinions-facts-and-open-flames/http://massively.joystiq.com/2013/05/20/chaos-theory-opinions-facts-and-open-flames/http://massively.joystiq.com/2013/05/20/chaos-theory-opinions-facts-and-open-flames/#commentsFiled under: , , , , , , ,

Chaos Theory Opinions, facts, and open flames
It's not often that my writings take a ranty slant, In fact, I don't believe I have ever expressed anything along those lines here in Chaos Theory -- although I have a time or two elsewhere. Blue moons come and go much more frequently than I don my Massively-standard-issue flame-retardant garb and venture forth. But right here, right now looks to be one of those times, and I'm already suiting up. So what about The Secret World has me riled up enough to flex my woefully underused ranting muscle?

Nothing.

Seriously, I can't call to mind a single thing in the game deserving of a rant. Sure, TSW isn't perfect; there are flaws and there are things that could use improving, things that are certainly worth discussing. But rant-inducing? Nope. Too bad the same can't be said for people.

It doesn't matter how many times I've witnessed it: It never ceases to amaze me when folks trumpet their own opinions as fact while insisting dissenting opinions can't possibly exist. It's like they board the crazy train where the lines between opinion and fact are swirled together like coffee and creamer, where reality and logic are tossed right out the window. So as a public service, I'm going to derail that train.

Continue reading Chaos Theory: Opinions, facts, and open flames

MassivelyChaos Theory: Opinions, facts, and open flames originally appeared on Massively on Mon, 20 May 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragonendgamefactionfaction-pvpfantasyfeaturedfuncomhorrorilluminatimythologyopinionopinion-vs-factopinionsrantrantssci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonwho-cares-about-endgameMon, 20 May 2013 15:00:00 EST<![CDATA[The Stream Team: Monocle Day edition, May 20 - 26, 2013]]>http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/#commentsFiled under: , , ,

The Stream Team Monocle day edition, May 20 26, 2013
Two weeks ago, y'all had the chance to select a new holiday to help add some cheer to the otherwise bland weeks in the middle of May. The choices teased and tantalized you, but you're a discriminating crowd. In a race fraught with nail-biting suspense, only one ultimately prevailed. And so it is with further ado we bring to you: Monocle Day!

This Tuesday, May 21st, has been selected to be the auspicious day of this most storied celebration. Why? Because 5/21 splits into 5 + 2 + 1, which of course = 8, and we all know that 8 is just two monocles stacked on top of each other! And as always, Massively TV is here to help you ring in the new holiday, with special shows throughout the entire week. Check out the full schedule of celebratory events hosted by The Stream Team after the break. Then let us know if you'll be wearing your own monocle in honor of the festivities.

Continue reading The Stream Team: Monocle Day edition, May 20 - 26, 2013

MassivelyThe Stream Team: Monocle Day edition, May 20 - 26, 2013 originally appeared on Massively on Mon, 20 May 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>Achaeaaction-mmoactivisionagonanetAnno-Onlinearenanetaventurinebiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamescity-of-steamconsoleconsolescrypticcryptic-studiosdarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodfdndDotA-2dragonDragonrealmsdragonsdragons-propheteaelectronic-artselswordeq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfrfree-realmsfree-to-playfuncomgoblinguild-warsgwhi-rezhi-rez-studioshistoricalhorrorhousinginfernuminfernum-productionsinternet-spaceshipskid-friendlykidskids-mmolivestreamlivestreaminglivestreamslucasartsmassively-metamassively-tvmechanistmechanist-gamesmetamobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftneverwinteropen-pvpperfect-worldperfect-world-entertainmentplaneplanesplaystation-3playstation3pollps3pvppwerunewakerrunewaker-entertainmentsandboxsci-fantasysci-fisecret-worldskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicsteampunkstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorthe-old-republicthe-secret-worldthe-stream-teamthreshold-rpgtortswtwitchtwitch-tvunholy-warswarwarcraftwargaming.netwarplanewarplanesworld-of-warcraftworld-of-warplaneswowwowpMon, 20 May 2013 09:00:00 EST<![CDATA[Chaos Theory: The Secret World shaken, not stirred]]>http://massively.joystiq.com/2013/05/13/chaos-theory-the-secret-world-shaken-not-stirred/http://massively.joystiq.com/2013/05/13/chaos-theory-the-secret-world-shaken-not-stirred/http://massively.joystiq.com/2013/05/13/chaos-theory-the-secret-world-shaken-not-stirred/#commentsFiled under: , , , , , , ,

Chaos Theory The Secret World shaken, not stirred
For all those who've been trying so hard to predict gloom and doom for The Secret World, I say Nyeh nyeh because the April producer's letter announcing Issue #7 pretty much flies in the face of all your it's-gonna-die whimperings. In fact, I can't believe we still hear them because TSW just keeps getting better and better. Where's the duct tape when you need it...

While it's true we don't have monthly updates anymore (and that's totally understandable, given the restructuring that devs certainly couldn't predict), Secret World fans are still getting frequent, and more importantly extremely fun, updates. Just look at The Vanishing of Tyler Freeborn and The Last Train to Cairo; both of these issues brought interesting new storylines and a decent helping of new features. Some even say these updates introduced the best content so far. With that track record, who can't help but be totally psyched for the upcoming Issue #7?

Continue reading Chaos Theory: The Secret World shaken, not stirred

MassivelyChaos Theory: The Secret World shaken, not stirred originally appeared on Massively on Mon, 13 May 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsauxiliary-weaponsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragonfactionfaction-pvpfantasyfeaturedfuncomhappy-little-flameshorrorilluminatiIssue-7James-Bondmythologynew-DLCnew-weaponopinionpyropyromaniacsci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonupdateMon, 13 May 2013 15:00:00 EST<![CDATA[The Stream Team: MLT edition, May 13 - 19, 2013]]>http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/#commentsFiled under: , , ,

The Stream Team May 13 19, 2013
Nothing beats an MLT, especially when the tomato is nice and ripe! Except maybe Massively TV. MMmm mmmm. Now there's something you can really sink your teeth into -- the wild and crazy antics of your favorite Stream Team hosts! And they've got a menu for all tastes this week, from space adventures to dragons to WWII planes. Of course, it all comes with a side of reruns and a dessert highlight to complete your meal.

So pull up a chair and grab yourself a helping or two... or 10. Hey, there's no limit here; enjoy as much as you like! While you're enjoying the spread, be sure to join in the after-dinner chat in Outtakes.

Continue reading The Stream Team: MLT edition, May 13 - 19, 2013

MassivelyThe Stream Team: MLT edition, May 13 - 19, 2013 originally appeared on Massively on Mon, 13 May 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmoactivisionage-of-conanage-of-conan-unchainedagonanetaocaoc-unchainedarenanetarkark-hunterarkfallaventurinebiowareblizzardblizzard-entertainmentbuy-to-playccpccp-gamescity-of-steamconanconsoleconsolescrypticcryptic-studiosdarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodefiancedfdnddota-2Dragonrealmseaelectronic-artselswordeq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfree-to-playfuncomgoblinguild-warsgwhi-rezhi-rez-studioshistoricalhorrorhyboriainternet-spaceshipslivestreamlivestreaminglivestreamslucasartsmabinogimassively-metamassively-tvmechmechanistmechanist-gamesmechsmechwarriormechwarrior-mmomechwarrior-onlinemetammo-shootermobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmwomythologyncsoftneverwinternexonnexon-americaopen-pvpperfect-worldperfect-world-entertainmentpiranhapiranha-gamesplaneplanesplaystation-3playstation3pollps3pvppwesandboxsci-fantasysci-fisecret-worldshooterskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicsteampunkstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorsyfythe-old-republicthe-secret-worldthe-stream-teamthird-person-shootertortpstransmedia-synergytriontrion-worldstswtvtwitchtwitch-tvunchainedunholy-warswarwarcraftwargaming.netwarplanewarplanesworld-of-warcraftworld-of-warplaneswowwowpxboxMon, 13 May 2013 09:00:00 EST<![CDATA[World of Darkness 'years away' from launch]]>http://massively.joystiq.com/2013/05/06/world-of-darkness-years-away-from-launch/http://massively.joystiq.com/2013/05/06/world-of-darkness-years-away-from-launch/http://massively.joystiq.com/2013/05/06/world-of-darkness-years-away-from-launch/#commentsFiled under: , , , , ,

World of Darkness still has years of development ahead of it
If you are hanging your hopes and dreams on World of Darkness coming along to rescue you from the humdrum of life and your precious mortality, well... be prepared to settle in for a good long wait. Executive Producer Chris McDonough said in an interview that the title is still in pre-production and that players shouldn't expect to see it for a few years yet. However, CCP did show a few technical videos to the press to assure folks that the game is still alive.

McDonough did have good news to share, however. World of Darkness has a 70-person crew that is currently building the framework for the title, and according to the producer, they are "making phenomenal progress." The team plans to host the entire game on a single server where active combat and politicking between vampires will be the crux of the content.

"We're making sure this is a next-generation MMO. It's very focused on movement and motion and capturing what it's like to be a vampire," he said. "People ask about our high level designs for World of Darkness, and we've called this a vampire simulator. What's it like to be a vampire. Not a superhero, but a super-powered individual. The way the characters move around the city feels very vampiric."

MassivelyWorld of Darkness 'years away' from launch originally appeared on Massively on Mon, 06 May 2013 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alphabetaccpccp-gamesChris-McDonoughfantasygothichorrormasqueradepre-productionsupernaturalvampirevampireswhite-wolfwodworld-of-darknessMon, 06 May 2013 17:00:00 EST<![CDATA[Chaos Theory: Player projects enhance The Secret World experience]]>http://massively.joystiq.com/2013/05/06/chaos-theory-player-projects-enhance-the-secret-world-experienc/http://massively.joystiq.com/2013/05/06/chaos-theory-player-projects-enhance-the-secret-world-experienc/http://massively.joystiq.com/2013/05/06/chaos-theory-player-projects-enhance-the-secret-world-experienc/#commentsFiled under: , , , , , , , ,

Chaos Theory Player projects enhance The Secret World experience
One of The Secret World's most unique elements makes it ripe for producing immersive experiences, even outside of the game. Set in the modern real world (as opposed to the fantasy or even sci-fi themes prevalent in our MMOverse), a game can more easily blur the line between logged in and logged out. Players can, and do, generate ways to be a part of the game while still out and about in the real world. Today, I'm going to shine a spotlight on two of these projects that use very different methods to continue immersion beyond actual gameplay.

In January, one TSW fan ran an Alternate-Reality Game (ARG) for fellow players. Using Twitter, the forums, email, and even in-game characters, this player orchestrated a full-on investigation for participants to work through. And just recently, a new site offering to immerse players more deeply into the game through imagery was beta-launched. Both projects further player involvement in the world of the game -- the stories, the conspiracies, the histories, and the surroundings -- beyond the actual game. Both received support from Funcom in their efforts to expand the fans' experiences. And both are definitely worth checking out, so I sat down with the creators to get the scoop on the why, the how, and the what's next.

Continue reading Chaos Theory: Player projects enhance The Secret World experience

MassivelyChaos Theory: Player projects enhance The Secret World experience originally appeared on Massively on Mon, 06 May 2013 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsalternate-reality-gameARGbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragonfactionfaction-pvpfantasyfeaturedfuncomhorroriimmersionilluminatiMorteiamythologyopinionpanoramic-viewsPGCplayer-generated-contentsci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonTSWPanoYarrukaMon, 06 May 2013 16:00:00 EST<![CDATA[One Shots: The dark night dashes]]>http://massively.joystiq.com/2013/05/05/one-shots-the-dark-night-dashes/http://massively.joystiq.com/2013/05/05/one-shots-the-dark-night-dashes/http://massively.joystiq.com/2013/05/05/one-shots-the-dark-night-dashes/#commentsFiled under: , , , , , , ,

One Shots The dark night rises
Just because you have passing familiarity with Superman and Batman doesn't mean you know jack about the real superheroes who do all of the dirty work while the headliners steal the signal light. For instance, have you met this guy? If you haven't, let reader Russell make your acquaintance.

"This is my Brawling Juggernaut in DC Universe Online, known by many as Orange Crush," Russell begins with aplomb. "Here he is in pursuit of justice, on the way to laying some Crush down on the villains of our great and beloved Gotham City!"

Will Orange Crush arrive in time? Tune in to the rest of this column after the break!

Continue reading One Shots: The dark night dashes

MassivelyOne Shots: The dark night dashes originally appeared on Massively on Sun, 05 May 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>biowareblueholebluehole-studiosbring-back-one-shotsbuy-to-playconsoleconsolesdc-universedc-universe-onlinedcuoeaelectronic-artsen-masseen-masse-entertainmentf2pfactionfantasyfree-to-playfuncomgalleriesgalleryhorrorlucasartsmythologyone-shotspics-or-it-didnt-happenplaystation-3playstation3ps3reader-screenshotsreader-submissionssci-fantasysci-fiscreenshotscreenshotssecret-worldskill-basedsoesony-online-entertainmentstar-warsstar-wars-the-old-republicsubscriptionlesssuperherosuperheroesswtorterathe-old-republicthe-secret-worldtortswuser-submissionsSun, 05 May 2013 10:00:00 EST<![CDATA[The Secret World celebrates with a bonus weekend]]>http://massively.joystiq.com/2013/05/02/the-secret-world-celebrates-with-a-bonus-weekend/http://massively.joystiq.com/2013/05/02/the-secret-world-celebrates-with-a-bonus-weekend/http://massively.joystiq.com/2013/05/02/the-secret-world-celebrates-with-a-bonus-weekend/#commentsFiled under: , , , , ,

The Secret World celebrates with a bonus weekend
Celebrates what, you might ask? Funcom certainly doesn't need a reason to celebrate as the studio is dubbing this upcoming weekend as a golden weekend in The Secret World, full of prizes and rewards.

First off, for every Ability Point earned this weekend, you get a free bonus point which is stackable with item store Timed Ability Point boosts. You can also earn a free month of membership for every new player you recruit who purchases the game in the next 30 days. And to top it all off, you get 30% extra bonus points every time you purchase Funcom points.

The Secret World's Golden Weekend event runs from this Friday, May 3, at 9am EDT through Sunday, May 5.

MassivelyThe Secret World celebrates with a bonus weekend originally appeared on Massively on Thu, 02 May 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>buy-to-playfactionfantasyfuncomgolden-weekendhorrormythologysci-fantasysecret-worldskill-basedsubscriptionlessthe-secret-worldtswThu, 02 May 2013 18:00:00 EST<![CDATA[The Secret World's Issue #7 goes 007]]>http://massively.joystiq.com/2013/04/30/the-secret-worlds-issue-7-goes-007/http://massively.joystiq.com/2013/04/30/the-secret-worlds-issue-7-goes-007/http://massively.joystiq.com/2013/04/30/the-secret-worlds-issue-7-goes-007/#commentsFiled under: , , , , , , ,

The Secret World's Issue #7 goes 007
April's Game Director letter for The Secret World is hot off the presses, and in it Joel Bylos shared some juicy morsels about the next issue in store for the horror and conspiracy-laced game. He revealed that whereas Issue #6 was spiced with an Indiana Jones flavor, Issue #7 will be sprinkled with a distinct 007 zest. Yes, Bond. James Bond.

Set in Transylvania, Issue #7 directs players to investigate the presence of the werewolves in the area, which ultimately leads them to an Orochi facility secreted away below a glacier in the Carpathian Fangs. Along the way, players get to experience adventures as a secret agent, complete with daring chases (a snowmobile one at that!), dare-devil jumps from exploding bridges, and close shaves with laser beams near sensitive areas. There's also a new auxiliary weapon to brandish -- the flamethrower.

But the new goodies don't stop there. Bylos introduced a new feature that allows for custom streaming of radio stations or playlists directly into the client as well as a some PvP changes including tweaks to the matchmaking system. He concluded with some teasers about Black Ops and Issue #8. For all the details, check out the full letter.

MassivelyThe Secret World's Issue #7 goes 007 originally appeared on Massively on Tue, 30 Apr 2013 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>auxiliary-weaponsbuy-to-playfactionfantasyflamethrowerfuncomhorrorIssue-7James-Bondmythologynew-weaponOrochisci-fantasysecret-worldskill-basedsubscriptionlessthe-secret-worldTransylvaniatswupdateTue, 30 Apr 2013 13:00:00 EST<![CDATA[Chaos Theory: Testing my Secret World DPS makeover]]>http://massively.joystiq.com/2013/04/29/chaos-theory-testing-my-secret-world-dps-makeover/http://massively.joystiq.com/2013/04/29/chaos-theory-testing-my-secret-world-dps-makeover/http://massively.joystiq.com/2013/04/29/chaos-theory-testing-my-secret-world-dps-makeover/#commentsFiled under: , , , , , , , , ,

Chaos Theory Testing my Secret World DPS makeover
It's no secret that The Secret World is just a wee bit different than the majority of MMORPGs out there. Hallelujah for that, right? And one notable area it differs from the rest is how it treats gear and classes. As such, players can't necessarily bring habits and know-how from other titles and translate that into immediate success in TSW. It's no wonder that even good players can sometimes feel stumped or at a loss when navigating through builds. For that very reason, Chaos Theory brought you the first episode of What Not to Wear, a live makeover that focused on sharing hints and tips that non-theorycrafters (like yours truly) could use as a base for forging their own path.

It was a simple makeover really -- just minor changes in my focus and equipment using gear I already had in my bag and abilities I already had access to. Did it help? Did my effectiveness as a damage-dealer increase? The outcome was rather surprising.

Continue reading Chaos Theory: Testing my Secret World DPS makeover

MassivelyChaos Theory: Testing my Secret World DPS makeover originally appeared on Massively on Mon, 29 Apr 2013 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingDPS-guideDPS-makeoverdragonfactionfaction-pvpfantasyfeaturedfuncomhintshorrorilluminatilivestreammythologyopinionpassive-abilitiessci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstips-and-trickstrailertrailerstswtsw-chaos-theorytsw-dragonvideovideoswhat-not-to-wearMon, 29 Apr 2013 20:00:00 EST<![CDATA[The Stream Team: Fuzzy slippers edition, April 29 - May 5, 2013]]>http://massively.joystiq.com/2013/04/29/the-stream-team-fuzzy-slippers-edition-april-29-may-5-2013/http://massively.joystiq.com/2013/04/29/the-stream-team-fuzzy-slippers-edition-april-29-may-5-2013/http://massively.joystiq.com/2013/04/29/the-stream-team-fuzzy-slippers-edition-april-29-may-5-2013/#commentsFiled under: , ,

The Stream Team Fuzzy slippers edition, April 29 May 5, 2013
Comfort food is a pretty universally understood concept. And most folks can also easily envision the security of a blanket a la Linus in the Peanuts cartoons. But what do gamers turn to for stability and comfort during stressful times? I mean, we all know that sometimes games get pretty intense. If you don't believe me, just watch Massively TV! Death and glory, victory and defeat: The Stream Team experiences it all.

Some folks have specific food or drinks on hand for their gaming sessions. I know one gamer with a bobble-head. Me? I've got my fuzzy slippers! Yes, really. When I wear them, glorious victories are all the sweeter and harrowing defeats lose their sting. And I swear they bring me luck. Gaming is just better in fuzzy slippers. If you haven't tried it, I totally encourage you to. Uncertain? Try it, you might like it! Grab a pair and give them a test run while watching this week's shows. Or if you have your own can't-do-without gaming accessory, let us know what it is in the Outtakes.

Continue reading The Stream Team: Fuzzy slippers edition, April 29 - May 5, 2013

MassivelyThe Stream Team: Fuzzy slippers edition, April 29 - May 5, 2013 originally appeared on Massively on Mon, 29 Apr 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmoactivisionall-points-bulletinall-points-bulletin-reloadedanetapbapb-reloadedapbrarenanetbiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playclone-warsclone-wars-adventurescrimecrypticcryptic-studioscwadnddragondragonsdragons-propheteaelectronic-artseq-2eq-iieq2eqiieverquest-2everquest-iif2pfactionfamilyfantasyfeaturedfpsfree-to-playfuncomg1gamersfirstguild-warsguild-wars-2gwgw2Heroes-and-GeneralsHeroes-and-Generalshi-rezhi-rez-studioshistoricalhorrorhousinginfernuminfernum-productionskid-friendlykidskids-mmokingsislekingsisle-entertainmentlivestreamlivestreaminglivestreamslobbylucasartsmassively-metamassively-tvmetaminigamemmo-shootermmofpsmobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftneverwinterperfect-worldperfect-world-entertainmentplaneplanesplanetsideplanetside-2pollps2pvppwerunewakerrunewaker-entertainmentsandboxsci-fantasysci-fisecret-worldshooterskill-basedSmitesoesonysony-online-entertainmentstar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlessswtorThe-Lost-Titansthe-old-republicthe-secret-worldthe-stream-teamtorTorchlight-2torchlight-iitswtwitchtwitch-tvwarWar-Thunderwarcraftwargaming.netWarMage-Battlegroundswarplanewarplaneswizard101world-of-warcraftworld-of-warplaneswowwowpMon, 29 Apr 2013 09:00:00 EST<![CDATA[Some Assembly Required: Community as content]]>http://massively.joystiq.com/2013/04/26/some-assembly-required-community-as-content/http://massively.joystiq.com/2013/04/26/some-assembly-required-community-as-content/http://massively.joystiq.com/2013/04/26/some-assembly-required-community-as-content/#commentsFiled under: , , , , ,

Some Assembly Required Community as content
Not too long ago, I had the opportunity to cover an occasion during which an in-game community came together and created a new player-run annual event. Born as an anniversary follow-up to a service event for the young terminally ill player Ribbitribbit, the new tradition focused on celebrating that very community that pulled together to create him a dream playground within EverQuest II. If the game lacked a sense of community in the game before that original project, it certainly didn't after.

After tugging at my heartstrings for a while, that experience made me reflect on how much our communities are really a cornerstone of player-generated content. How often have you attended or participated in an event or run a mission created by someone other than yourself? And yet, when discussing important tools and elements needed to support player-generated content, we often overlook the necessity of a vibrant community. It's like trying to bake a cake without adding the flour. Or how about this analogy: You can give folks a giant tool box full of a shiny implements and tell them to build a house, but not much will happen without the actual wood and materials! So to foster PGC, games need to foster building communities.

Continue reading Some Assembly Required: Community as content

MassivelySome Assembly Required: Community as content originally appeared on Massively on Fri, 26 Apr 2013 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>aionascensionbuy-to-playcommunitycommunity-buildingcommunity-building-toolseaelectronic-artsendless-trialeq-2eq-iieq2eqiieveeve-fanfesteve-fanfest-2013eve-onlineeve-online-fanfesteve-online-fanfest-2013eventevent-coverageeverquest-2everquest-iif2pfactionfanfestfantasyfeaturedfree-to-playfuncomgame-mechanicshorroricelandin-game-calendarlineagelineage-2lineage-iimassively-event-coveragemythicmythic-entertainmentmythologyncsoftopinionpgcplayer-contentplayer-generated-contentpvprekyjavikrvrsandboxsarsci-fantasysecret-worldskill-basedsoesome-assembly-requiredsonysony-online-entertainmentsubscriptionlessthe-secret-worldtruly-freetswwarwarhammerwarhammer-onlineFri, 26 Apr 2013 16:00:00 EST<![CDATA[The Secret World has a lot of clothing options]]>http://massively.joystiq.com/2013/04/23/the-secret-world-has-a-lot-of-clothing-options/http://massively.joystiq.com/2013/04/23/the-secret-world-has-a-lot-of-clothing-options/http://massively.joystiq.com/2013/04/23/the-secret-world-has-a-lot-of-clothing-options/#commentsFiled under: , , , , , , , ,

tsw dev guide on costumes see team email
If you've played The Secret World for more than five minutes, you're probably aware of the fact that it has some of the most extensive outfit options of any MMORPG on the market. If you're not aware of that fact, well, you're the target audience of Funcom's latest dev blog.

It's all about avatar customization, and it details how TSW's stats are kept separate from clothing items in order to satisfy your inner min-maxer and fashion maven simultaneously. Since the game is set in the modern world, you'll find many authentic styles available to earn in-game or purchase through the cash shop. If you're a fan of the otherworldly, don't fret. There are plenty of sci-fi, steampunk, horror, fantasy, and medieval get-ups as well.

MassivelyThe Secret World has a lot of clothing options originally appeared on Massively on Tue, 23 Apr 2013 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>buy-to-playfactionfantasyfuncomhorrormythologysci-fantasysecret-worldsecret-world-clothingsecret-world-customizationskill-basedsubscriptionlessthe-secret-worldtswtsw-clothingtsw-customizationTue, 23 Apr 2013 13:00:00 EST<![CDATA[Chaos Theory: Perfecting your build in The Secret World]]>http://massively.joystiq.com/2013/04/22/chaos-theory-perfecting-your-build-in-the-secret-world/http://massively.joystiq.com/2013/04/22/chaos-theory-perfecting-your-build-in-the-secret-world/http://massively.joystiq.com/2013/04/22/chaos-theory-perfecting-your-build-in-the-secret-world/#commentsFiled under: , , , , , , ,

Chaos Theory Perfecting your build in The Secret World
After discussing last week that build creation was on the minds of many a Secret World fan, I promised to provide some hints and tips on how to better maximize your performance in game. It truly is a topic relevant to all players, even those who aren't focused on or interested in endgame. After all, even folks (like yours truly) who are in it mainly for the awesome story may find their ability to continue with said story hampered at some point by an insufficient build.

With a limit of only seven active (eight if you have an auxiliary weapon) and seven passive skills available to use at any time, creating a build in The Secret World is not quite like most other MMOs, so you can't just automatically throw on gear of a higher level and call it good. Sure, you can eventually pound your way through many things, but you can save yourself some time and frustration by understanding a bit about how the gear works together with your skills. That's where today's Chaos Theory comes in.

What better way to inform and entertain you than to open myself up for some theorycrafting by someone who has a better knack for it? Using my little Illuminati as our guinea pig, I've bared her gear for all to see and learn what can be done to improve. With that, I welcome you to the first episode of "What Not to Wear in TSW"!

Continue reading Chaos Theory: Perfecting your build in The Secret World

MassivelyChaos Theory: Perfecting your build in The Secret World originally appeared on Massively on Mon, 22 Apr 2013 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbuildsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingDPS-builddragonfactionfaction-pvpfantasyfeaturedfuncomguideguide-to-DPS-buildshorrorilluminatimythologyopinionsci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorytheorycraftingthree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonMon, 22 Apr 2013 19:00:00 EST<![CDATA[One Shots: Yo ho ho!]]>http://massively.joystiq.com/2013/04/21/one-shots-yo-ho-ho/http://massively.joystiq.com/2013/04/21/one-shots-yo-ho-ho/http://massively.joystiq.com/2013/04/21/one-shots-yo-ho-ho/#commentsFiled under: , , , , , , ,

One Shots Yo ho ho!
There's probably no gulf as wide as the one between historical pirates and the pop culture versions that we venerate. As a guy who had a pirate-themed 30th birthday party, I can't say that I'm against our off-kilter brand of scallywags. Neither is reader Phinneas, who sent in our featured screenshot from Pirate101.

"These shots are of the main starting area with my fearsome pirate looking to the horizon for adventures ahead," he writes.

Best of luck to ye, laddie! May the wind be at your back, your enemies in Davey Jones' locker, and a bottle of ginger ale in your belly! Yet pirates are only the beginning of today's adventure through One Shots...

Continue reading One Shots: Yo ho ho!

MassivelyOne Shots: Yo ho ho! originally appeared on Massively on Sun, 21 Apr 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>anetarenanetbiowarebring-back-one-shotsbuy-to-playeaelectronic-artsf2pfactionfamilyfantasyfree-to-playfuncomgalleriesgalleryguild-wars-2gw2horrorkid-friendlykids-mmokingsislekingsisle-entertainmentlucasartsmythologyncsoftone-shotspics-or-it-didnt-happenpiratepirate101piratesreader-screenshotsreader-submissionssci-fantasysci-fiscreenshotscreenshotssecret-worldskill-basedstar-warsstar-wars-the-old-republicsubscriptionlessswtorthe-old-republicthe-secret-worldtortswuser-submissionsSun, 21 Apr 2013 10:00:00 EST<![CDATA[Make your EVE Fanfest plans with the official program]]>http://massively.joystiq.com/2013/04/18/make-your-eve-fanfest-plans-with-the-official-program/http://massively.joystiq.com/2013/04/18/make-your-eve-fanfest-plans-with-the-official-program/http://massively.joystiq.com/2013/04/18/make-your-eve-fanfest-plans-with-the-official-program/#commentsFiled under: , , , , , ,

Make your EVE Fanfest plans with the official program
EVE Fanfest is next week and the faithful are preparing to descend upon Reykjavik, Iceland, for the three-day convention. If you're one of the travelers who are heading there or are just looking to follow along on livestream, CCP has released the full program with the event's schedule.

Fanfest will have three keynotes about the past, present, and future of CCP's titles, respectively. There will also be several panels, including one discussing EVE Online's inclusion in the New York Museum of Modern Art.

EVE Online also released a new dev blog talking about the team's war on unauthorized client modification and violations of the EULA. Apparently CCP has taken additional steps to beef up detection and prevention, and the team wanted to be clear with players as to what is and is not allowed.

MassivelyMake your EVE Fanfest plans with the official program originally appeared on Massively on Thu, 18 Apr 2013 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesconsoleconventiondustdust-514eveeve-fanfesteve-fanfest-2013eve-onlineeventfanfestfanfest-2013fantasyfpsgothichorrorinternet-spaceshipslivestreammmofpsplaystationplaystation-3ps3real-world-eventsandboxschedulesci-fishooterspreadsheets-onlinesupernaturalvampirevampireswhite-wolfwodworld-of-darknessThu, 18 Apr 2013 15:30:00 EST<![CDATA[Chaos Theory: The Secret World community roundup]]>http://massively.joystiq.com/2013/04/15/chaos-theory-the-secret-world-community-roundup/http://massively.joystiq.com/2013/04/15/chaos-theory-the-secret-world-community-roundup/http://massively.joystiq.com/2013/04/15/chaos-theory-the-secret-world-community-roundup/#commentsFiled under: , , , , , ,

Chaos Theory The Secret World community roundup
You've heard me express my thoughts quite a bit over the last couple of months about everything from what I want to see in The Secret World (like housing and an encore to special events) to my experiences with different aspects of the game (such as sabotage missions and Issue #6). Now it's time to share yours! Yes, folks, this week follows in a time-honored tradition of community roundups, where we dive into the topics that are in the forefront of the community's collective mind.

Of course, we can't touch on everything here (that's what official forums are for), but we can explore a smattering of the topics raised. So what are TSW players chattering about lately? Among the ongoing conversations are discussions about veteran rewards, clothing, PvP tournaments, and builds.

Continue reading Chaos Theory: The Secret World community roundup

MassivelyChaos Theory: The Secret World community roundup originally appeared on Massively on Mon, 15 Apr 2013 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbuy-to-playchaos-theoryclothingcommunity-roundupconspiracyconspiracy-thriillerdark-days-are-comingdragonfactionfaction-pvpfantasyfeaturedfuncomhorrorilluminatimythologyopinionPvPsci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorytheory-craftingthree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonveteran-rewardsMon, 15 Apr 2013 19:00:00 EST<![CDATA[New raid included in today's Secret World patch]]>http://massively.joystiq.com/2013/04/15/new-raid-included-in-todays-secret-world-patch/http://massively.joystiq.com/2013/04/15/new-raid-included-in-todays-secret-world-patch/http://massively.joystiq.com/2013/04/15/new-raid-included-in-todays-secret-world-patch/#commentsFiled under: , , , , , ,

New raid included in The Secret World's patch
Amid the general bug squashing and polishing released in today's patch, The Secret World has tucked away a tasty little morsel of content: an all new lair raid encounter. A weak point between realities has been discovered out in the Kingsmouth wreckage, and groups of 10 adventurers can enter the extra-dimensional prison, The Island of Stillborn Stars, to face Eidolon of the Outer Dark.

Bits of housekeeping also included in the patch were fixes to several exploits in lairs, dungeons, and PvP as well as assorted bugs (say goodbye to area spam when anyone nearby uses a reconstructor and black screens after using the Helevator). Players will also find a brand new item for sale at the Envoy of Ca' d'Oro. For a full listing of all the changes, check out the official patch notes.

[Source: Funcom press release]

MassivelyNew raid included in today's Secret World patch originally appeared on Massively on Mon, 15 Apr 2013 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bug-fixesbuy-to-playfactionfantasyfuncomhorrorlairlairsmythologynew-raidpatchsci-fantasysecret-worldskill-basedsubscriptionlessthe-secret-worldtswMon, 15 Apr 2013 14:00:00 EST<![CDATA[Hall takes a break from DayZ, pursues dream of climbing Everest]]>http://massively.joystiq.com/2013/04/15/hall-takes-a-break-from-dayz-pursues-dream-of-climbing-everest/http://massively.joystiq.com/2013/04/15/hall-takes-a-break-from-dayz-pursues-dream-of-climbing-everest/http://massively.joystiq.com/2013/04/15/hall-takes-a-break-from-dayz-pursues-dream-of-climbing-everest/#commentsFiled under: , , , , , ,

Dean Hall at Mount Everest
If you're anxiously waiting for Dean "Rocket" Hall's standalone version of his ultra-popular Arma 2 mod DayZ, you'll have to wait a little bit longer.

Hall is currently climbing Mount Everest as part of a two-month vacation from his development duties on Bohemia Interactive's zombie-themed post-apocalyptic sandbox. "Although the timing is poor for my sabbatical, it is not something planned on a whim and involves non-refundable costs of up to $100k," Hall writes on the DayZ website.

"This is going to take as long as it needs to," he continues. "We want to release our initial alpha under the architecture it needs to avoid hacking and security issues -- this is the only remaining task stopping us from releasing the alpha."

MassivelyHall takes a break from DayZ, pursues dream of climbing Everest originally appeared on Massively on Mon, 15 Apr 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bohemiabohemia-interactiveday-zdayzdean-hallhall-climbs-everesthorrormount-everestpost-apocalypticrocketsandboxzombiesMon, 15 Apr 2013 11:00:00 EST<![CDATA[The Stream Team: Stepping on tax edition, April 15 - 21, 2013]]>http://massively.joystiq.com/2013/04/15/the-stream-team-stepping-on-tax-edition-april-15-21-2013/http://massively.joystiq.com/2013/04/15/the-stream-team-stepping-on-tax-edition-april-15-21-2013/http://massively.joystiq.com/2013/04/15/the-stream-team-stepping-on-tax-edition-april-15-21-2013/#commentsFiled under: , , , ,

The Stream Team Stepping on tax edition, April 15 21, 2013
'Tis the season! Just... not that season. This isn't one we really want; it's not a season of joyousness and brotherly kindness. No, this one's more akin to scattering LEGOs and thumbtacks all across the floor then dashing barefoot from wall to wall just to hit your head against them over and over. We understand the pain. Truly, we do. And The Stream Team is here for you.

They say nothing's certain in life except death and taxes, but we disagree! We'd totally add Massively TV to that list. Have we ever left you in your times of need? No! And we know you need us now more than ever. We're here to help you, with a full line-up of shows to help ease the pain and take your mind off the traumas that cannot be avoided. So take a load off and check out this week's schedule, catch a few reruns, see the highlight of the week, and take part in our two polls. Then remember, at least this only happens once a year!

Continue reading The Stream Team: Stepping on tax edition, April 15 - 21, 2013

MassivelyThe Stream Team: Stepping on tax edition, April 15 - 21, 2013 originally appeared on Massively on Mon, 15 Apr 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>activisionage-of-wulinage-of-wushuagotaionanetarenanetarkark-hunterarkfallartplayascensionasiabigpointbiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gameschampionschampions-onlinechampschinachinesechinese-mmococonsoleconsolescrypticcryptic-studiosdefianceeaelectronic-artseq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfamilyfantasyfeaturedfrfree-realmsfree-to-playfuncomgame of thronesgame-of-thrones-ascentgame-of-thrones-mmogame-of-thrones-seven-kingdomsgeorge-martingeorge-rr-martingotgot7kgpotatoguild-warsguild-wars-2gvggwgw2hbohi-rezhi-rez-studioshistoricalhorrorinternet-spaceshipskid-friendlykidnappingkidskids-mmokingsislekingsisle-entertainmentlivestreamlivestreaminglivestreamslucasartsmartial-artsmassively-metamassively-tvmetamight-and-magicmight-and-magic-duel-of-championsming-dynastymmo-shootermobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftperfect-worldperfect-world-entertainmentplaneplanesplaystation-3playstation3pollps3pvppwesandboxsci-fantasysci-fisecret-worldseven-kingdomsshooterskill-basedSmitesnail-gamessnail-games-usasoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorsyfytanktankstelonthe-aurora-worldthe-old-republicthe-secret-worldthe-stream-teamthird-person-shootertortpstransmedia-synergytriontrion-worldstruly-freetswtvtwitchtwitch-tvvanguardvanguard-saga-of-heroesvgvillagers-and-heroeswarwarcraftwargaming.netwarplanewarplaneswesteroswizard101world-of-tanksworld-of-warcraftworld-of-warplaneswotwowwowpwushuwuxiaxboxMon, 15 Apr 2013 09:00:00 EST<![CDATA[EVE Evolved: Massively's plans for EVE Fanfest 2013]]>http://massively.joystiq.com/2013/04/14/eve-evolved-massivelys-plans-for-eve-fanfest-2013/http://massively.joystiq.com/2013/04/14/eve-evolved-massivelys-plans-for-eve-fanfest-2013/http://massively.joystiq.com/2013/04/14/eve-evolved-massivelys-plans-for-eve-fanfest-2013/#commentsFiled under: , , , , , , , , , , , , , , , , ,

EVE Evolved title image
There's just over a week to go until EVE Online's massive tenth anniversary Fanfest, and you'll be pleased to hear that Massively will be there this year to cover the action! CCP is aiming to make this the biggest Fanfest yet, promising huge reveals and announcements about EVE's summer Odyssey expansion and beyond. We can also expect to hear some big news about upcoming console MMOFPS DUST 514, and fans of Vampire: The Masquerade will undoubtedly get to see some of the year's progress toward making the World of Darkness MMO a reality.

Tickets to this year's Fanfest sold out in record time, so many players who really wanted to be there for EVE's tenth anniversary celebration weren't able to secure a spot. CCP is running its usual livestream of the main talks for those not in attendance, but only certain parts of the event are being streamed. Here at Massively, we plan to give you an inside look at Fanfest with ongoing news coverage from April 25th to April 27th and in-depth opinion pieces on what each announcement means for players.

In this week's short and sweet EVE Evolved, I lay out Massively's plans for in-depth coverage of EVE Fanfest 2013 and ask what you'd like to see reported on.

Continue reading EVE Evolved: Massively's plans for EVE Fanfest 2013

MassivelyEVE Evolved: Massively's plans for EVE Fanfest 2013 originally appeared on Massively on Sun, 14 Apr 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>10-year-anniversary10-year-oldccpccp-gamesconsoledustdust-514eveeve-evolvedeve-fanfesteve-fanfest-2013eve-onlineeventevent-coverageeventsexpansionfanfestfanfest-2013fantasyfeaturedfpsgothichorroricelandlivestreammassivelymassively-event-coveragemmofpsnewsodysseyopinionplaystationplaystation-3ps3reykjaviksandboxsci-fishooterspeculationsupernaturalten-year-anniversaryten-yearstwittervampirevampire-the-masqueradevampiresvideowhite-wolfwodworld-of-darknessSun, 14 Apr 2013 18:00:00 EST<![CDATA[State of Decay coming to Xbox Live in June]]>http://massively.joystiq.com/2013/04/13/state-of-decay-coming-to-xbox-live-in-june/http://massively.joystiq.com/2013/04/13/state-of-decay-coming-to-xbox-live-in-june/http://massively.joystiq.com/2013/04/13/state-of-decay-coming-to-xbox-live-in-june/#commentsFiled under: , , , , , ,

State of Decay - Zombie with Wayfarers
Undead Labs' zombie actioner State of Decay is coming to Xbox Live this June according to a brief update posted by Undead community guru Sanya Weathers. And when we say brief, we do mean brief, as the sum total of the update is "June. Officially."

Fortunately the firm also released a new teaser that shows off a heaping helping of bloody, brain-bashing gameplay. You'll find it after the cut.

Continue reading State of Decay coming to Xbox Live in June

MassivelyState of Decay coming to Xbox Live in June originally appeared on Massively on Sat, 13 Apr 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>horrorsanya-weathersstate-of-decaystate-of-decay-releaseundeadundead-labsxboxxbox-livezombieSat, 13 Apr 2013 18:00:00 EST<![CDATA[Chaos Theory: Exploring The Secret World's endgame]]>http://massively.joystiq.com/2013/04/08/chaos-theory-exploring-endgame/http://massively.joystiq.com/2013/04/08/chaos-theory-exploring-endgame/http://massively.joystiq.com/2013/04/08/chaos-theory-exploring-endgame/#commentsFiled under: , , , , , , ,

Chaos Theory Exploring endgame
Throughout my tenure as the Chaos Theory author, I've ruminated on a number of Secret World subjects that personally interest, intrigue, or otherwise affect me. I've covered ARGs, different issue updates, sabotage quests, the conversion to buy-to-play, ambiance, and more. I've even expounded on things I'd like to see in game, like housing and vehicles. But one thing I haven't covered with much detail are areas that don't have much personal relevance to me... yet.

While it makes sense to talk most about my personal experiences, The Secret World offers so much more than what I have delved into. There really are different strokes for different folks, all wrapped up within the one world. So this week we are exploring an area that captures the attention of others if not mine: endgame.

Continue reading Chaos Theory: Exploring The Secret World's endgame

MassivelyChaos Theory: Exploring The Secret World's endgame originally appeared on Massively on Mon, 08 Apr 2013 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragonendgamefactionfaction-pvpfantasyfeaturedfuncomhorrorilluminatimythologynightmare-modenightmare-mode-dungeonsopinionsci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorytheorycraftingthree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonMon, 08 Apr 2013 12:00:00 EST<![CDATA[The Stream Team: Bleepity bleep edition, April 8 - 14, 2013]]>http://massively.joystiq.com/2013/04/08/the-stream-team-bleepity-bleep-edition-april-8-14-2013/http://massively.joystiq.com/2013/04/08/the-stream-team-bleepity-bleep-edition-april-8-14-2013/http://massively.joystiq.com/2013/04/08/the-stream-team-bleepity-bleep-edition-april-8-14-2013/#commentsFiled under: , , ,

The Stream Team Bleepity bleep edition, April 8 14, 2013

It's definitely not a new thing. Throughout the ages, when intense frustration strikes, a colorful epithet can slip past the lips of even the most soft-spoken. Heck, at particularly annoying times, a full string of them has been known fly forth from the most unexpected sources. And we all know that there are plenty of frustration-inducing situations in gaming. So it's not hard to equate swearing with gaming, right?

Of course, we at Massively TV advocate a responsible use of language during our adventures. While there could be a time or a place for the universally known curses, we prefer bursts of creative language skills. And if there's one thing The Stream Team has, it's an abundance of creativity! We've learned it is possible to express frustration while avoiding the censors because censors are mean and carry big, painful sticks! Ouch.

Need proof? Pop into any of the shows scheduled this week or the reruns from last; watch how deftly (or not) our intrepid streamers react to curse-creating incidents. Hope as they might, nothing can go smoothly all the time... or for the very unlucky, at all! A perfect demonstration of this is highlighted in our newest section, a place devoted to showcasing a stream of the week. Catch MJ's colorful repurposing of the English language first-hand in Highlight Reels, then offer your most creative expression in the Outtakes.

Continue reading The Stream Team: Bleepity bleep edition, April 8 - 14, 2013

MassivelyThe Stream Team: Bleepity bleep edition, April 8 - 14, 2013 originally appeared on Massively on Mon, 08 Apr 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2la-mystical-landactionaction-mmoactivisionage-of-wulinage-of-wushuaionanetarenanetarkark-hunterarkfallascensionasiabiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gameschampionschampions-onlinechampschinachinesechinese-mmococonquestconsoleconsolescrypticcryptic-studiosdc-universedc-universe-onlinedcuodefianceDinostormdotadota-2e-sporteaelectronic-artseq-2eq-iieq2eqiiesporteveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfrfree-realmsfree-to-playfuncomgpotatoguild-warsguild-wars-2gvggwgw2heroes-of-newerthhi-rezhi-rez-studioshistoricalhonhorrorinternet-spaceshipskid-friendlykidnappingkidskids-mmolindenlinden-lablivestreamlivestreaminglivestreamslucasartsmartial-artsmassively-metamassively-tvmetaming-dynastymmo-shootermobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftperfect-worldperfect-world-entertainmentplaystation-3playstation3pollps3pvppweraiderzreal-liferiftrift-literift-planes-of-telararvrs2s2-gamessandboxScarlet-Bladesci-fantasysci-fisecond-lifesecret-worldshooterskill-basedslSmitesnail-gamessnail-games-usasoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorsyfytanktanksthe-old-republicthe-secret-worldthe-stream-teamthird-person-shooterthree-faction-pvpthree-way-pvptortpstransmedia-synergytriontrion-worldstruly-freetswtvtwitchtwitch-tvVillagers-andheroesvirtual-worldvirtual-worldswarwarcraftwargaming.networld-of-tanksworld-of-warcraftwotwowwushuwuxiaxboxMon, 08 Apr 2013 09:00:00 EST<![CDATA[Survarium alpha signups now live]]>http://massively.joystiq.com/2013/04/05/survarium-alpha-signups-now-live/http://massively.joystiq.com/2013/04/05/survarium-alpha-signups-now-live/http://massively.joystiq.com/2013/04/05/survarium-alpha-signups-now-live/#commentsFiled under: , , , , , , ,

Survarium alpha signups now live
Vostok Games has announced the opening of alpha test registration for its S.T.A.L.K.E.R.-esque Survarium MMO shooter.

"Soon the first of you will be able to witness the world of 'green apocalypse' and try out the boots of various faction fighters," the company says. "The server tranquility will burst with first gunshots; man will face man in PvP combat, while the will of one fighter will clash with the will of another!"

There will also be a lot of bugs, and Vostok cautions funseekers about the nature of early game testing. "Remember that alpha testing of Survarium is hard work rather than entertainment," the firm's website reads.

Still interested? Sign up at the links below.

MassivelySurvarium alpha signups now live originally appeared on Massively on Fri, 05 Apr 2013 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>horrormmo-shooterpost-apocalypticsci-fishooterSurvariumsurvarium-alphasurvarium-betavostokvostok-gamesFri, 05 Apr 2013 12:00:00 EST<![CDATA[Chaos Theory: The wonderful world of sabotage in TSW]]>http://massively.joystiq.com/2013/04/01/chaos-theory-the-wonderful-world-of-sabotage-in-tsw/http://massively.joystiq.com/2013/04/01/chaos-theory-the-wonderful-world-of-sabotage-in-tsw/http://massively.joystiq.com/2013/04/01/chaos-theory-the-wonderful-world-of-sabotage-in-tsw/#commentsFiled under: , , , , ,

Chaos Theory
It's certainly no secret that I love The Secret World's investigation missions. I have mentioned it a time to two (times 20 or so) at different points in articles and livestreams alike. And that's not even counting how many times I regale my friends and family with my investigative exploits. Getting to use skills of the mind more than the fingers is not a regular occurrence in MMORPGs, but it darn well should be! It is a refreshing alternative to pew-pew all the time.

However, investigations aren't the only unique breed of missions I love in TSW. The game has a second kind that involves something other than just going out and showing off your prowess with a weapon. In fact, significant portions of these missions actually eschew the use of weapons entirely, and engaging in combat is a pretty big no-no when completing certain objectives. Welcome to sabotage missions.

Continue reading Chaos Theory: The wonderful world of sabotage in TSW

MassivelyChaos Theory: The wonderful world of sabotage in TSW originally appeared on Massively on Mon, 01 Apr 2013 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsalternative-playstylesATCbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragonfactionfaction-pvpfantasyfeaturedfuncomhorrorilluminatimythologyopinionOrachi-GroupOrochiOrochi-Groupsabotage-missionssci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonMon, 01 Apr 2013 19:00:00 EST<![CDATA[The Stream Team: Fools vs. floppy ears edition, April 1 - 7, 2013]]>http://massively.joystiq.com/2013/04/01/the-stream-team-fools-vs-floppy-ears-edition-april-1-7-201/http://massively.joystiq.com/2013/04/01/the-stream-team-fools-vs-floppy-ears-edition-april-1-7-201/http://massively.joystiq.com/2013/04/01/the-stream-team-fools-vs-floppy-ears-edition-april-1-7-201/#commentsFiled under: , , ,

The Stream Team Fools vs floppy ears edition, April 1 7, 2013
Though infrequent, it does happen: Once in a while two holidays go toe to toe on the calendar. This year, it just so happens that April Fools' Day rides in on the tail of the Easter Bunny. So what do you do when these very different holidays bump up against each other? You do what any self-respecting Stream Team fan does: You watch more Massively TV! Of course, that's pretty much the answer to everything, isn't it?

Some day these two holidays might actually overlap. If that were the case, who do you think would come out on top in a brawl over celebration rights -- that floppy-eared frolicking rabbit known for leaving chocolate or the fool (with or without a bell-tipped hat) who delights in pranking and tricking? After watching Rise of the Guardians, I think my money is on the bunny. Worst case scenario is they team up together and we end up with trick chocolate.

While contemplating this match-up, join us for a week of intense livestreams with your favorite hosts, playing such classics as Fruit Ninja and Fruity Loops Studio.

Continue reading The Stream Team: Fools vs. floppy ears edition, April 1 - 7, 2013

MassivelyThe Stream Team: Fools vs. floppy ears edition, April 1 - 7, 2013 originally appeared on Massively on Mon, 01 Apr 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2lactionaction-mmoactivisionallodsallods-onlineanetApril-Foolsarcane-legendsarenanetastrum-nivalbiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamesconquestconsoleconsolesdc-universedc-universe-onlinedcuodotadota-2e-sporteaEasterelectronic-artseq-2eq-iieq2eqiiesporteveeve-onlineeverquest-2everquest-iif2pfactionfamilyfantasyfeaturedfrfree-realmsfree-to-playFruity-Loops-Studiofuncomgala-netgpotatoguild-warsguild-wars-2gwgw2heroes-of-newerthhi-rezhi-rez-studioshistoricalhonhorrorinternet-spaceshipskid-friendlykidskids-mmokingsislekingsisle-entertainmentlindenlinden-lablivestreamlivestreaminglivestreamslucasartsmail-ru-gamesmail.ru-gamesmailru-gamesmassively-metamassively-tvmetamobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftnew-englandparadoxparadox-interactiveperfect-worldperfect-world-entertainmentpermadeathplaystation-3playstation3pollps3pvppweraiderzreal-liferiftrift-literift-planes-of-telararvrs2s2-gamessalemsandboxscarlet-bladesci-fantasysci-fisecond-lifesecret-worldsegaskill-basedslSmitesoesonysony-online-entertainmentspiral-knightsspreadsheets-onlinestar-warsstar-wars-the-old-republicsteamstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorthe-old-republicthe-secret-worldthe-stream-teamthree-faction-pvpthree-ringsthree-rings-designthree-way-pvptortriontrion-worldstswtwitchtwitch-tvvirtual-worldvirtual-worldswarcraftwizard101world-of-warcraftwowMon, 01 Apr 2013 09:00:00 EST<![CDATA[Rumor: War Z forums compromised, user game accounts might be affected]]>http://massively.joystiq.com/2013/03/29/rumor-war-z-forums-compromised-user-game-accounts-might-be-aff/http://massively.joystiq.com/2013/03/29/rumor-war-z-forums-compromised-user-game-accounts-might-be-aff/http://massively.joystiq.com/2013/03/29/rumor-war-z-forums-compromised-user-game-accounts-might-be-aff/#commentsFiled under: , , , ,

War Z forums compromised, user game accounts might be affected
Hooboy, it's been a while since we've had a proper War Z clusterfunk, hasn't it? Unfortunately for the zombie shooter's playerbase, the latest brouhaha involves some potential account security issues.

What we know for sure is that a Hammerpoint forum admin account was compromised, and the company says that "many posts were unable to be restored as a result." There are also rumors that producer Sergey Titov's admin account was affected and that those responsible are now in possession of War Z user info including account and email data.

We've contacted Hammerpoint for clarification and will update this post if we receive a response.

[Thanks Nephi and everyone who tipped us!]

MassivelyRumor: War Z forums compromised, user game accounts might be affected originally appeared on Massively on Fri, 29 Mar 2013 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>hackhorrorrumorrumorssergey-titovthe-war-zwar-zwar-z-compromisedwar-z-forum-hackwar-z-hackedzombiesFri, 29 Mar 2013 13:00:00 EST<![CDATA[Chaos Theory: Continuing the Issue #6 journey in The Secret World]]>http://massively.joystiq.com/2013/03/25/chaos-theory-continuing-the-issue-6-journey-in-the-secret-wor/http://massively.joystiq.com/2013/03/25/chaos-theory-continuing-the-issue-6-journey-in-the-secret-wor/http://massively.joystiq.com/2013/03/25/chaos-theory-continuing-the-issue-6-journey-in-the-secret-wor/#commentsFiled under: , , , , , , , , ,

Chaos Theory Continuing the Issue #6 journey in The Secret World
In sharing my thoughts with you last week about The Secret World's newest update, I admitted that I hadn't yet experienced all of it. Even with a head start, there were too few days available to really dig into Issue #6. So unless I wanted to blow through everything like a runaway train without savoring it, there was no way I could pontificate on all aspects of the update at that time.

That was then; this is now. This time around I've had full week to dive in and experience the different aspects of The Last Train to Cairo. Along with finishing up the story (which culminated in boarding the very train the update is named for), I started clawing my way up the PvP ranking ladder, secured my very own whip, and snagged a few veteran rewards. Of course, there is still more to be done; it will be a while before I am up for the challenge of the new raid boss, even with my snazzy new whip. And let's not forget banking up some recruitment bonus points by roping even more friends into The Secret World. Even so, that leaves plenty for us to talk about in today's Chaos Theory.

Continue reading Chaos Theory: Continuing the Issue #6 journey in The Secret World

MassivelyChaos Theory: Continuing the Issue #6 journey in The Secret World originally appeared on Massively on Mon, 25 Mar 2013 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdance-like-Nassirdark-days-are-comingdragonfactionfaction-pvpfantasyfeaturedfuncomhintshorrorilluminatiissue-6Issue-6-The-Last-Train-to-Cairojumping-puzzlesmythologyNassiropinionPvPPvP-rankingsreviewsci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsThe-Last-Train-to-Cairothe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonupdateveteran-rewardsMon, 25 Mar 2013 17:00:00 EST<![CDATA[The Stream Team: GDC edition, March 25 - 31, 2013]]>http://massively.joystiq.com/2013/03/25/the-stream-team-gdc-edition-march-25-31-2013/http://massively.joystiq.com/2013/03/25/the-stream-team-gdc-edition-march-25-31-2013/http://massively.joystiq.com/2013/03/25/the-stream-team-gdc-edition-march-25-31-2013/#commentsFiled under: , , ,

The Stream Team GDC edition, March 25 31, 2013
This week a sizable chunk of the gaming industry descends on downtown San Francisco for the annual Game Developers Convention. And yes, Massively will be there cornering every dev that gets in our sights, convincing them all to answer as many of our burning questions as possible before someone finds and rescues them!

I was even thinking how neat it would be to add these little tête-à-têtes to the Massively TV line up. Alas, I was thwarted; something about "evidence." Ah well, there are still plenty of live shows scheduled and a plethora of reruns to fill out your week while waiting on the GDC news.

If you have any burning questions about your favorite games, add them to the comments below and we'll see how many we can get answers for. And don't miss our two bonus polls at the end.

Continue reading The Stream Team: GDC edition, March 25 - 31, 2013

MassivelyThe Stream Team: GDC edition, March 25 - 31, 2013 originally appeared on Massively on Mon, 25 Mar 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>activisionaionallodsallods-onlineanetarcane-legendsarenanetarkark-hunterarkfallascensionastrum-nivalbiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamesconquestconsoleconsolesdc-universedc-universe-onlinedcuodefiancedotadota-2e-sporteaelectronic-artseq-2eq-iieq2eqiiesporteveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfpsfree-to-playfuncomgala-netgpotatoguild-warsguild-wars-2gwgw2heart-of-the-swarmheroes-of-newerthhi-rezhi-rez-studioshistoricalhonhorrorinternet-spaceshipslivestreamlivestreaminglivestreamslucasartsmail-ru-gamesmail.ru-gamesmailru-gamesmassively-metamassively-tvmetammofpsmobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftnew-englandparadoxparadox-interactivepermadeathplaystation-3playstation3pollps3pvpriftrift-literift-planes-of-telararvrs2s2-gamessalemsandboxsci-fantasysci-fisecret-worldsegaskill-basedSmitesoesonysony-online-entertainmentspiral-knightsspreadsheets-onlinestar-warsstar-wars-the-old-republicstarcraft-2starcraft-2-heart-of-the-swarmstarcraft-iistarcraft-ii-heart-of-the-swarmsteamstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorsyfytelonthe-old-republicthe-secret-worldthe-stream-teamthree-faction-pvpthree-ringsthree-rings-designthree-way-pvptortransmedia-synergytriontrion-worldstruly-freetswtvtwitchtwitch-tvvanguardvanguard-saga-of-heroesvgwarcraftworld-of-warcraftwowxboxMon, 25 Mar 2013 09:00:00 EST<![CDATA[Get a glimpse of The Secret World's work-in-progress Tokyo playfield]]>http://massively.joystiq.com/2013/03/23/get-a-glimpse-of-the-secret-worlds-work-in-progress-tokyo-playf/http://massively.joystiq.com/2013/03/23/get-a-glimpse-of-the-secret-worlds-work-in-progress-tokyo-playf/http://massively.joystiq.com/2013/03/23/get-a-glimpse-of-the-secret-worlds-work-in-progress-tokyo-playf/#commentsFiled under: , , , , ,

Orochi Group HQ
Want a sneak peek at The Secret World's upcoming Tokyo playfield? You only have to sit through a 13-hour train ride to get it! OK, not really, but that's what one enterprising fan did in order to see if Issue #6's Last Train to Cairo would eventually reach its destination. If you haven't played through the new content yet, there's a climatic train sequence that involves a series of boss fights, and since players can be defeated, fall off the train, or otherwise fail to complete their objectives, the train keeps going (and going... and going).

One fan decided to stay on the train for 13 hours to see what would happen, and while she didn't make it to Cairo, she was rewarded with a visit from Funcom game director Joel Bylos near the end of her marathon livestream. Bylos subsequently ported her to the work-in-progress Tokyo zone for an impromptu tour.

Tokyo plays a significant role in TSW's overarching narrative. Players first visit it during the game's subway tutorial sequence, and the shadowy Orochi Group bases its headquarters there. While the preview shows off a rough version of the zone, complete with missing textures and very few NPCs, it also shows off a ginormous playfield and gives TSW fans reason to be excited for upcoming content updates. The Tokyo sequence starts around the 13:47:00 mark of the livestream linked below.

[Thanks Elania!]

MassivelyGet a glimpse of The Secret World's work-in-progress Tokyo playfield originally appeared on Massively on Sat, 23 Mar 2013 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>buy-to-playfactionfantasyfuncomhorrorjoel-byloslast-train-to-cairomythologysci-fantasysecret-worldsecret-world-tokyoskill-basedsubscriptionlessthe-secret-worldthe-secret-world-tokyotokyotswtsw-issue-6tsw-tokyotsw-tokyo-livestreamSat, 23 Mar 2013 17:30:00 EST<![CDATA[Chaos Theory: Hoppin' TSW's train to Cairo]]>http://massively.joystiq.com/2013/03/18/chaos-theory-hoppin-tsws-train-to-cairo/http://massively.joystiq.com/2013/03/18/chaos-theory-hoppin-tsws-train-to-cairo/http://massively.joystiq.com/2013/03/18/chaos-theory-hoppin-tsws-train-to-cairo/#commentsFiled under: , , , , , ,

Chaos Theory Hoppin' that train to Cairo in TSW
It doesn't matter one iota what I had planned to talk about today, regardless of how phenomenal it may have been. The fact that The Last Train to Cairo has pulled into the station means I'm hopping on it! Yes, The Secret World's latest update hit this week with barely a day's warning and (thanks to my lifetime membership), I've been sinking my teeth into it since last Thursday.

However, in the interest of full disclosure, I have to say that I have not boarded the actual train part of the adventure. I had no interest in blowing through the new content in just a couple of days; I prefer to savor the new goodies. But I have delved pretty deeply into it and have a experienced a fair share of Issue #6. So how's the ride so far? Keep reading for a test drive, then come watch as Creative Director Joel Bylos joins me for a livestream tour on Thursday, March 21st at 11:00 a.m. EDT on Massively TV.

Continue reading Chaos Theory: Hoppin' TSW's train to Cairo

MassivelyChaos Theory: Hoppin' TSW's train to Cairo originally appeared on Massively on Mon, 18 Mar 2013 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbugsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragonfactionfaction-pvpfantasyfeaturedfuncomhand-to-handhand-to-hand-combathintshorrorilluminatiIssue-6Issue-6-The-Last-Train-to-Cairomythologynew-contentopinionpatchsabotage-missionssci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsThe-Last-Train-to-Cairothe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonupdatesMon, 18 Mar 2013 14:00:00 EST<![CDATA[Nab a discounted Secret World download with 1200 bonus points on Amazon]]>http://massively.joystiq.com/2013/03/14/nab-a-discounted-secret-world-download-with-1200-bonus-points-on/http://massively.joystiq.com/2013/03/14/nab-a-discounted-secret-world-download-with-1200-bonus-points-on/http://massively.joystiq.com/2013/03/14/nab-a-discounted-secret-world-download-with-1200-bonus-points-on/#commentsFiled under: , , , , ,

Nab a discounted dowload of TSW with 1200 bonus points on Amazon
If you've been waiting for a chance to grab The Secret World and delve into the realm of Templars, Illuminati, and Dragons, now's a good time to go for it. Amazon.com is currently offering the digital download of the conspiracy-laden game for $19.99, a $10 savings off the original price.

However, the deal gets even sweeter -- the purchase includes 1200 bonus points (the same amount members receive each month). These points can be used to obtain the new Issue #6 The Last Train to Cairo DLC that becomes available to non-subscribers on Sunday, March 17th. The DLC costs 1200 bonus points for non-members, 1080 for members, and 960 for grandmasters (lifetime subscribers). Members and grandmasters can purchase and access Issue #6 now.

MassivelyNab a discounted Secret World download with 1200 bonus points on Amazon originally appeared on Massively on Thu, 14 Mar 2013 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>AmazonAmazon.combonus-pointsbuy-to-playfactionfantasyfuncomhorrorissue-6Issue-6-The-Last-Train-to-Cairomythologysalesci-fantasysecret-worldskill-basedspecial-dealsubscriptionlessThe-Last-Train-to-Cairothe-secret-worldtswThu, 14 Mar 2013 14:00:00 EST<![CDATA[The Secret World's Issue #6 launches tomorrow [Updated]]]>http://massively.joystiq.com/2013/03/13/the-secret-worlds-issue-6-launches-tomorrow/http://massively.joystiq.com/2013/03/13/the-secret-worlds-issue-6-launches-tomorrow/http://massively.joystiq.com/2013/03/13/the-secret-worlds-issue-6-launches-tomorrow/#commentsFiled under: , , , , , , ,

The Secret World's Issue #6 launches tomorrow
Folks who don't prowl around on the likes of Twitter may have missed out on a juicy little tidbit -- namely, that The Secret World's next update is coming tomorrow, March 14th. At 8:00 a.m. EDT, servers will go down for a scheduled three-hour maintenance, at which time Issue #6 The Last Train to Cairo will be patched in. Once the content is live, players will be able to add a whip to their weapon collection, dive into the new PvP ranking system, and revel in all the other assorted goodies coming their way.

Previous announcements have noted that paid subscribers will get to access the content before others can purchase the DLC in the store, putting the launch for free players on Saturday the 16th Sunday the 17th.

[Update: Funcom announced members will have a three day headstart instead of two; the launcher notes non-subscribers will be able to buy the DLC at 10:00 a.m EDT on the 17th]

MassivelyThe Secret World's Issue #6 launches tomorrow [Updated] originally appeared on Massively on Wed, 13 Mar 2013 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>buy-to-playfactionfantasyfuncomhorrorissue-6Issue-6-The-Last-Train-to-Cairomythologynew-weaponpatchPvP-ranking-systemsci-fantasysecret-worldskill-basedsubscriptionlessThe-Last-Train-to-Cairothe-secret-worldtswupdatewhipWed, 13 Mar 2013 15:30:00 EST<![CDATA[Latest dev blog delves into the depths of The Secret World endgame]]>http://massively.joystiq.com/2013/03/13/latest-dev-blog-delves-into-the-depths-of-the-secret-world-endga/http://massively.joystiq.com/2013/03/13/latest-dev-blog-delves-into-the-depths-of-the-secret-world-endga/http://massively.joystiq.com/2013/03/13/latest-dev-blog-delves-into-the-depths-of-the-secret-world-endga/#commentsFiled under: , , , , , , ,

Latest dev blog delves into the depths of The Secret World
If your Secret World adventures have thus far only entailed playing through the main story line, according to the latest dev blog you are missing out! The post plumbs the depths of TSW's character development and progression system (the endgame, if you will), detailing what lies in store for players after they turn that last page in the story.

With such a variety of situations and so many different builds to tackle them with, mastering TSW is a very lengthy process. Part of that process entails honing skills and collecting gear by moving to successively harder dungeons. Beyond just acquiring gear, players must also augment their arsenal with crafted kickbacks, stimulants, and pure anima potions. Then there is obtaining glyphs and knowing which one to use when for the best effect. And don't forget about getting ahold of powerful signets that can be added to weapons and talismans.

Of course, with the game's flexibility, there's no one "right way" to do things, so there are plenty of ways to experiment. Want some hints to use on this path to mastery? Check out all the details in the full post.

MassivelyLatest dev blog delves into the depths of The Secret World endgame originally appeared on Massively on Wed, 13 Mar 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>buy-to-playdev-blogdungeonsend-gamefactionfantasyfuncomhorrormythologysci-fantasysecret-worldskill-basedsubscriptionlessthe-secret-worldtswWed, 13 Mar 2013 11:00:00 EST<![CDATA[Chaos Theory: Where in The Secret World is Carmen Sandiego?]]>http://massively.joystiq.com/2013/03/11/chaos-theory-where-in-the-secret-world-is-carmen-sandiego/http://massively.joystiq.com/2013/03/11/chaos-theory-where-in-the-secret-world-is-carmen-sandiego/http://massively.joystiq.com/2013/03/11/chaos-theory-where-in-the-secret-world-is-carmen-sandiego/#commentsFiled under: , , , , ,

Chaos Theory Where in The Secret World is Carmen Sandiego
OK, so I openly admit that the title's reference probably predates the majority of you (unless you've happened upon the Facebook puzzle game, which apparently there is one!), but sometimes oldies are goodies. Or they just have catchy theme songs you can't get out of your head no matter how many decades you try...

So what does the older game featuring the notorious Carmen Sandiego have to do with The Secret World? For starters, it involves solving clues to complete the objective, just as investigations missions do in the newer game. Basically, both involve using your head to continue in the story. And both also use various locales around the world as the backdrop for the adventures. It's this last one specifically that my mind has been mulling over for a bit, especially in light of recent changes.

You see, even with the roadmap sketched out for the release of the next six updates (including Tokyo, woo!), some folks are worried about TSW's smaller centralized team. There is concern that there won't be enough resources to devote to the game and that it will languish. This is so where I come in. Instead of seeing the negative, I see opportunity: Iin order to free up more developer time and energy to focus on the nuts and bolts of creating the game, I'll provide the team with new ideas for future issues. This week, let's see where in the world we'll go.

Continue reading Chaos Theory: Where in The Secret World is Carmen Sandiego?

MassivelyChaos Theory: Where in The Secret World is Carmen Sandiego? originally appeared on Massively on Mon, 11 Mar 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragonfactionfaction-pvpfantasyfeaturedfuncomhorrorilluminatimythologynew-ideasnew-zonesopinionsci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonzone-ideasMon, 11 Mar 2013 10:00:00 EST<![CDATA[The Stream Team: Pot o' gold edition, March 11 - 17, 2013]]>http://massively.joystiq.com/2013/03/11/the-stream-team-pot-o-gold-edition-march-11-17-2013/http://massively.joystiq.com/2013/03/11/the-stream-team-pot-o-gold-edition-march-11-17-2013/http://massively.joystiq.com/2013/03/11/the-stream-team-pot-o-gold-edition-march-11-17-2013/#commentsFiled under: , , , ,

The Stream Team Pot o' gold edition, March 11 17, 2013
It's a magical time: Throughout this week there will be sightings of leprechauns, lucky shamrocks will sprout up everywhere, and folks will be chasing rainbows hoping to find a special treasure. It's also the time I can say "blarney" without everyone looking at me askance! Yup, Saint Paddy's is right around the corner, the day that capstones a week when untold masses find their inner-Irish self. Those brave enough to admit they've adopted the traditions of this time can stand up and be counted in the poll at the end.

Need more to do while awaiting Sunday's revelry and pinch-a-thon? Why not watch a smorgasbord of tomfoolery on Massively TV. You can join your favorite Stream Team hosts in chat or even in game and be a part the trouble they get themselves into! Just check the schedule for the when and the where. You can also catch previous shows at your own convenience and laugh at the crazy antics displayed (and trust us, they are plenty crazy). It's all waiting for you after the break!

Continue reading The Stream Team: Pot o' gold edition, March 11 - 17, 2013

MassivelyThe Stream Team: Pot o' gold edition, March 11 - 17, 2013 originally appeared on Massively on Mon, 11 Mar 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>a-mystical-landaction-mmoactivisionaionanetarenanetascensionbiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamesconquestconsoleconsolescrypticcryptic-studiosdc-universedc-universe-onlinedcuodiablodnddotae-sporteaelectronic-artseq-2eq-iieq2eqiiesporteveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfrfree-realmsfree-to-playfuncomgrinding-geargrinding-gear-gamesguild-wars-2gw2heart-of-the-swarmheroes-of-newerthhi-rezhi-rez-studioshistoricalhonhorrorinternet-spaceshipskartugakid-friendlykidskids-mmoleap-daylight-of-novalivestreamlivestreaminglivestreamslucasartsmassively-metamassively-tvmetamobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftneverwinterpath-of-exileperfect-worldperfect-world-entertainmentplaystation-3playstation3poepollps3pvppweriftrift-literift-planes-of-telararoguelikervrs2s2-gamessandboxsci-fantasysci-fisecret-worldskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstarcraft-2starcraft-2-heart-of-the-swarmstarcraft-iistreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtortanktankstelonthe-old-republicthe-secret-worldthe-stream-teamthree-faction-pvpthree-way-pvptortriontrion-worldstruly-freetswtwitchtwitch-tvvanguardvanguard-saga-of-heroesvgwarwarcraftwargaming.netwarstory-europe-in-flamesworld-of-tanksworld-of-warcraftwotwowMon, 11 Mar 2013 09:00:00 EST<![CDATA[One Shots: Dancing with my homies]]>http://massively.joystiq.com/2013/03/10/one-shots-dancing-with-my-homies/http://massively.joystiq.com/2013/03/10/one-shots-dancing-with-my-homies/http://massively.joystiq.com/2013/03/10/one-shots-dancing-with-my-homies/#commentsFiled under: , , , , , , ,

One Shots Dancing with my homies
First of all, thank you guys so much for responding to our One Shots rallying cry and absolutely flooding us with screenshots! My cup overfloweth, and that's a delightful change of pace for this column. Even though we're quite literally set for months now, please keep sending in your favorite old or new screencaps!

To kick us off this week is Jerry, who's showing off how Anarchy Online can party down with the best of them: "This is Yardsale, a level 220 Trader, dancing with his trader pets in Borealis."

At first glance, I almost thought we were in the Matrix. But even with polygons so sharp that you can cut yourself on them, this title definitely has a style all its own. Hit the jump to see this and other wonders of the screenshotted world.

Continue reading One Shots: Dancing with my homies

MassivelyOne Shots: Dancing with my homies originally appeared on Massively on Sun, 10 Mar 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>anarchy-onlineaobring-back-one-shotsbuy-to-playcity-of-heroescity-of-villainsclassic-mmocohcovcoxf2pfactionfantasyfree-to-playfreedomfrogsterfrogster-americafrogster-interactivefuncomgalleriesgallerygameforgegameforge-berlinhorrormythologyncsoftone-shotsparagonparagon-studiospics-or-it-didnt-happenreader-screenshotsreader-submissionsromrunes-of-magicrunewakerrunewaker-entertainmentsci-fantasysci-fiscreenshotscreenshotssecret-worldskill-basedsubscriptionlesssuperherosuperheroestaboreathe-secret-worldtswuser-submissionsSun, 10 Mar 2013 10:00:00 EST<![CDATA[Funcom's Joel Bylos on the centralized TSW, AoC, and AO team]]>http://massively.joystiq.com/2013/03/07/funcoms-joel-bylos-on-the-centralized-tsw-aoc-and-ao-team/http://massively.joystiq.com/2013/03/07/funcoms-joel-bylos-on-the-centralized-tsw-aoc-and-ao-team/http://massively.joystiq.com/2013/03/07/funcoms-joel-bylos-on-the-centralized-tsw-aoc-and-ao-team/#commentsFiled under: , , , , , , , , , , , , ,

Massively Exclusive Bylos expounds on the centralized team for AO, AoC, and TSW
By now, most MMO gamers are pretty familiar with the fact that Funcom underwent restructuring. But what does that mean; what exactly did it entail? The term "restructuring" in itself signifies changes but does nothing to actually enlighten folks on what the changes are. Other than the fact that Joel Bylos was named creative director for all three of Funcom's titles -- Age of Conan, Anarchy Online, and The Secret World -- and that the team will be in one centralized in location, we know little of the details.

How many developers survived the restructuring and relocated to remain on the team? Is this move foreshadowing one or more games slipping into maintenance mode? How will the coveted dev attention be divvied up? What does the future hold? Devoid of facts, players are left left wondering about how these changes will impact their favorite games.

While chatting with Joel Bylos in an exclusive interview, I was able to ask some of these very questions.

Continue reading Funcom's Joel Bylos on the centralized TSW, AoC, and AO team

MassivelyFuncom's Joel Bylos on the centralized TSW, AoC, and AO team originally appeared on Massively on Thu, 07 Mar 2013 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>age-of-conanage-of-conan-unchainedanarchy-onlineaoaocaoc-unchainedbuy-to-playcentralized-temaclassic-mmoconanf2pfactionfantasyfeaturedfree-to-playfuncomhorrorhyboriainterviewinterviewsJoel-Bylosmassively-exclusiveMassively-exclusive-interviewmassively-exclusive-interviewsmythologyrestructuringsci-fantasysci-fisecret-worldskill-basedsubscriptionlessthe-secret-worldtswunchainedThu, 07 Mar 2013 17:30:00 EST