Massively http://massively.joystiq.com Massively http://www.blogsmithmedia.com/http://massively.joystiq.com/media/feedlogo.gif Massively http://massively.joystiq.com en-us Copyright 2013 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[Chaos Theory: A guide to auxiliary weapons in The Secret World]]>http://massively.joystiq.com/2013/06/17/chaos-theory-a-guide-to-auxiliary-weapons-in-the-secret-world/http://massively.joystiq.com/2013/06/17/chaos-theory-a-guide-to-auxiliary-weapons-in-the-secret-world/http://massively.joystiq.com/2013/06/17/chaos-theory-a-guide-to-auxiliary-weapons-in-the-secret-world/#commentsFiled under: , , , , , , ,

Chaos Theory A guide to getting your auxiliary weapons
With Issue #7 A Dream to Kill inching closer and closer, my anticipation for the new auxiliary weapon coming to The Secret World is reaching near impossible heights. I'll admit it: As a pyro at heart, I am giddy with the thought of wrapping my hands around a permanent flamethrower! And I'm certainly not alone in that sentiment, either.

But an excitement for the new weapon doesn't diminish any of the current ones that are already in game; each auxiliary weapon -- the rocket launcher, the chainsaw, the quantum brace, and the whip -- is awesome in its own right with distinct skills and style. Is one right for you? Heck yeah! If you aren't taking advantage of an auxiliary weapon, you are depriving yourself of some extra oomph in your fights, not to mention an eighth active and passive skill on your hot bar.

How do you know which one is better for you? Honestly, you needn't choose just one; as with regular weapons, you can earn all four. But with a hefty price of 35 SP per weapon, payable all at once, it's impossible to get more than one at a time. So which do you choose first? And then how do you go about getting it? This guide will give a general overview of the four current auxiliary weapons and the paths to acquiring them.

Continue reading Chaos Theory: A guide to auxiliary weapons in The Secret World

MassivelyChaos Theory: A guide to auxiliary weapons in The Secret World originally appeared on Massively on Mon, 17 Jun 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsA-Dream-to-Killauxiliary-weaponsBig-Trouble-in-the-Big-Applebuy-to-playchainsawchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingDigging-Deeperdragonfactionfaction-pvpfantasyfeaturedfuncomguideguide-to-auxiliary-weaponshorrorilluminatiIssue-2Issue-2-Digging-DeeperIssue-4issue-4-Big-Trouble-in-the-Big-AppleIssue-5Issue-5-The-Vanishing-of-Tyler-FreebornIssue-6Issue-6-The-Last-Train-to-CairoIssue-7Issue-7-A-Dream-to-Killmythologyopinionquantum-bracerocket-launchersci-fantasysecret-worldsecret-world-chaos-theoryskill-basedspolierssubscriptionlesstemplarsThe-Last-Train-to-Cairothe-secret-worldthe-secret-world-chaos-theoryThe-Vanishing-of-Tyler-Freebornthree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonweaponswhipMon, 17 Jun 2013 18:00:00 EST<![CDATA[The Stream Team: Caveman edition, June 17 - 23, 2013]]>http://massively.joystiq.com/2013/06/17/the-stream-team-caveman-edition-june-17-23-2013/http://massively.joystiq.com/2013/06/17/the-stream-team-caveman-edition-june-17-23-2013/http://massively.joystiq.com/2013/06/17/the-stream-team-caveman-edition-june-17-23-2013/#commentsFiled under: , , ,

The Stream Team Caveman edition, June 17 23, 2013
With all the talk about bashing stuff lately, I can't help but envision a certain prehistoric child going around whacking everything with a club, "Bam! Bam! Bam!" Of course, who can blame the little tyke? There are definitely times in game that we've all wanted to swing a cudgel or two, be it a nerf design or a just-quitcher-whining bat.

Destructive tendencies can even be harbored in the gentle hearts of your favorite Stream Team hosts. A number of you can surely attest to that. Need proof? Just watch Massively TV and see for yourself. Warning: You may start to feel sympathy for those poor mobs...

Continue reading The Stream Team: Caveman edition, June 17 - 23, 2013

MassivelyThe Stream Team: Caveman edition, June 17 - 23, 2013 originally appeared on Massively on Mon, 17 Jun 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>activisionagonaionanetArcane-Sagaarenanetascensionaventurinebiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamesconquestconsoleconsolesdarkfalldarkfall-unholy-warsdfDotA-2eaelectronic-artseqeq-2eq-iieq1eq2eqiieveeve-onlineeverquesteverquest-2everquest-iif2pfactionfallen-earthfamilyfantasyfefeaturedfirefallfpsfrfree-realmsfree-to-playfuncomg1gamersfirstguild-wars-2gw2historicalhorrorinternet-spaceshipskid-friendlykidskids-mmokingsislekingsisle-entertainmentlivestreamlivestreaminglivestreamslucasartsmassively-metamassively-tvmetammo-shootermv-guidemv-tvmvguidemvtvmythologyncsoftopen-pvppiratepirate101piratesplaystation-3playstation3pollpost-apocpost-apocalypticps3pvpragnarok-online-2red-5red-5-studiosriftrift-literift-planes-of-telararvrsandboxsci-fantasysci-fisecret-worldshooterskill-basedsoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlessswtortanktankstelonthe-old-republicthe-secret-worldthe-stream-teamThe-Westthird-person-shooterthree-faction-pvpthree-way-pvptorTridektriontrion-worldstruly-freetswtwitchtwitch-tvunholy-warsvanguardvanguard-saga-of-heroesvgwarwarcraftwargaming.netwastelandsworld-of-tanksworld-of-warcraftwotwowMon, 17 Jun 2013 09:00:00 EST<![CDATA[Double XP and fashionable boots accompany The Secret World's Black Weekend event]]>http://massively.joystiq.com/2013/06/11/double-xp-and-fashionable-boots-accompany-the-secret-world-s-bla/http://massively.joystiq.com/2013/06/11/double-xp-and-fashionable-boots-accompany-the-secret-world-s-bla/http://massively.joystiq.com/2013/06/11/double-xp-and-fashionable-boots-accompany-the-secret-world-s-bla/#commentsFiled under: , , , , , ,

TSW: Black Weekend
Need a new pair of boots? If so, you'll probably want to take part in The Secret World's upcoming Black Weekend. The event, which begins on Friday, June 14th, at 9 a.m. EDT and concludes on Monday, June 17, at 9 a.m. EDT, brings a few special bonuses, including a rugged pair of Black Heavy Buckled Boots.

Log in during the Black Weekend event and you will be able to claim a free potion from the item store that doubles XP gains from monster kills for eight hours. One account may claim one new potion every 24 hours. Additionally, any activity that normally rewards Black Bullion will award one extra Black Bullion during the weekend, so get to farming that black gold.

There's one more bonus to current The Secret World players: For every player you recruit between now and the end of Black Weekend, you'll receive a free month of premium membership.

MassivelyDouble XP and fashionable boots accompany The Secret World's Black Weekend event originally appeared on Massively on Tue, 11 Jun 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>black-bullionblack-weekendbuy-to-playfactionfantasyfuncomhorrormythologysci-fantasysecret-worldskill-basedsubscriptionlessthe-secret-worldtswTue, 11 Jun 2013 15:00:00 EST<![CDATA[Chaos Theory: The Secret World is getting filthy]]>http://massively.joystiq.com/2013/06/10/chaos-theory-the-secret-world-is-getting-filthy/http://massively.joystiq.com/2013/06/10/chaos-theory-the-secret-world-is-getting-filthy/http://massively.joystiq.com/2013/06/10/chaos-theory-the-secret-world-is-getting-filthy/#commentsFiled under: , , , , , , ,

Chaos Theory The Secret World is getting filthy
So apparently some of you have operatives who have successfully infiltrated the Massively secret lair because someone has gotten a peek at my master plan... I mean, to-do list... and jumped ahead to this week's topic without me! I know we've talked before about how the real-world setting of The Secret World makes it ideal for blurring lines between game and reality, but I wasn't expecting this. Well, no matter. You cannot thwart the master plan; it has already begun. *maniacal laugh*

This stage of my brilliant scheme involves taking a closer look at another little nugget found in the May Game Director's Letter. On the surface we see that The Secret World will be getting even filthier at the conclusion of Issue #7 as the nefarious filth will actually break through the Tokyo gate and begin to infect Agartha itself. But more than that, we are witnessing the implementation of a long-term event that will continue to give new content as it progresses. Could this be the harbinger of dynamic events to come that will breathe more life into the world? We can certainly hope!

Continue reading Chaos Theory: The Secret World is getting filthy

MassivelyChaos Theory: The Secret World is getting filthy originally appeared on Massively on Mon, 10 Jun 2013 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsAgarthabuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragondynamic-eventseventfactionfaction-pvpfantasyfeaturedfilthfuncomhorrorilluminatiin-game-eventmythologyopinionsci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonworld-eventMon, 10 Jun 2013 16:00:00 EST<![CDATA[The Stream Team: Wedding singer edition, June 10 - 16, 2013]]>http://massively.joystiq.com/2013/06/10/the-stream-team-wedding-singer-edition-june-10-16-2013/http://massively.joystiq.com/2013/06/10/the-stream-team-wedding-singer-edition-june-10-16-2013/http://massively.joystiq.com/2013/06/10/the-stream-team-wedding-singer-edition-june-10-16-2013/#commentsFiled under: , , ,

The Stream Team Wedding singer edition, June 10 16, 2013
Have you ever been someplace, perhaps at an event, and spontaneously broken into song? And just maybe that wasn't quite an appropriate venue for a favorite heavy tune? Boy, the looks some people give you; I mean, what's really so wrong with injecting a little more groove into a wedding march anyways?

Well, luckily there are no such social taboos for spouting random song snippets on Massively TV! I know you understand that urge to just let loose a tune or two, right? It could be that you've belted out a concert-worthy rendition yourself when playing or watching your favorite games. We here at The Stream Team fully support that. We even contribute to the official organization: BOSS (Belting Out Spontaneous Songs). So why not join us where you know you won't be judged. Who knows, you might find a song to sing along with in this weeks streams.

Continue reading The Stream Team: Wedding singer edition, June 10 - 16, 2013

MassivelyThe Stream Team: Wedding singer edition, June 10 - 16, 2013 originally appeared on Massively on Mon, 10 Jun 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>activisionagonanetarenanetarkark-hunterarkfallaventurinebiowareblizzardblizzard-entertainmentbuy-to-playccpccp-gamesconquestdarkfalldarkfall-unholy-warsdefiancedfDotA-2eaelectronic-artselsword-onlineeqeq-2eq-iieq1eq2eqiieveeve-onlineeverquesteverquest-2everquest-iif2pfactionfantasyfeaturedfirefallfpsfree-to-playfuncomguild-wars-2gw2hi-rezhi-rez-studioshistoricalhorrorinternet-spaceshipslivestreamlivestreaminglivestreamslucasartsmassively-metamassively-tvmetammo-shootermobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftopen-pvpplaneplanespollpvpragnarok-online-2red-5red-5-studiosriftrift-literift-planes-of-telararvrsandboxsci-fantasysci-fisecret-worldshooterskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlessswtorsyfytanktankstelonthe-old-republicthe-secret-worldthe-stream-teamthird-person-shooterthree-faction-pvpthree-way-pvptortpstransmedia-synergytridektriontrion-worldstswtvtwitchtwitch-tvunholy-warsvanguardvanguard-saga-of-heroesvgwarwarcraftwargaming.netwarplanewarplanesworld-of-tanksworld-of-warcraftworld-of-warplaneswotwowwowpxboxMon, 10 Jun 2013 10:00:00 EST<![CDATA[The Game Archaeologist: Checking in with classic MMOs]]>http://massively.joystiq.com/2013/06/08/the-game-archaeologist-checking-in-with-classic-mmos/http://massively.joystiq.com/2013/06/08/the-game-archaeologist-checking-in-with-classic-mmos/http://massively.joystiq.com/2013/06/08/the-game-archaeologist-checking-in-with-classic-mmos/#commentsFiled under: , , , , , , , , , ,

The Game Archaeologist Checking in with classic MMOs
What's this, you say as you rub your eyes in disbelief. Is it... The Game Archaeologist, long since thought lost in his expedition to Atlantis (and the trials therein)? It is indeed, my friends. TGA has been a long-running passion of mine on Massively, but I needed a break for a while to recouperate and refocus. However, as of late I've felt the call of neglected classic MMOs and wanted to make sure that they were getting some column love here on the site.

So going forward, expect to see The Game Archaeologist pop out of his hidey hole once or twice a month to talk about our old favorites and perhaps pontificate more on the history of MMO development. Sound good? Did you miss me at all? You totally didn't, did you.

If you've been out of touch with classic MMOs, I've done the legwork this week to provide you with the 10 important and relevant news items that are sweeping through this aging yet still vibrant community. Read on, McDuff!

Continue reading The Game Archaeologist: Checking in with classic MMOs

MassivelyThe Game Archaeologist: Checking in with classic MMOs originally appeared on Massively on Sat, 08 Jun 2013 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>acac2anarchy-onlineaoasherons-callasherons-call-2biowarecamelotclassicclassic-mmoclassic-mmosclassicsdaocdark-age-of-cameloteaelectronic-artsf2pfantasyfeaturedfpsfree-to-playfuncomgame-archaelogistlord-britishmeridian-59mmofpsmyst-onlinemyst-online-uru-livemythicmythic-entertainmentmythologynostalgiaopinionplanetsidepsps1pvprvrsandboxsci-fisoesony-online-entertainmentthe-game-archaeologisttibiaturbineturbine-entertainmentultimaultima onlineultima-foreveruoSat, 08 Jun 2013 12:00:00 EST<![CDATA[Chaos Theory: Increasing The Secret World's replayability with Issue #8]]>http://massively.joystiq.com/2013/06/04/chaos-theory-increasing-the-secret-worlds-replayability-with/http://massively.joystiq.com/2013/06/04/chaos-theory-increasing-the-secret-worlds-replayability-with/http://massively.joystiq.com/2013/06/04/chaos-theory-increasing-the-secret-worlds-replayability-with/#commentsFiled under: , , , , , , , ,

Chaos Theory Increasing The Secret World's replayability with Issue #8
I've said it before, and I'll say it again: The Secret World just keeps getting better and better. While the horror-themed conspiracy game is obvious not perfect (heaven help the rest of the MMOverse if it were!), it is definitely traveling steadfastly along that long, dusty road of improvement. Every time Funcom delves deeper into the lives and plots of The Secret World's denizens by adding to the story, it gets better. Every time new experiences are offered through new missions or features, it gets better. Ditto every time more choice is added through new weapons or customization.

But for all the advancements and added content over the past year, there are a few issues that, when addressed, would get the game really trucking down that road and make for one heck of a ride. Luckily for fans, it just so happens that one of those very issues appears to be getting some attention come Issue #8: replayability. Behold the hope that is scenarios!

Continue reading Chaos Theory: Increasing The Secret World's replayability with Issue #8

MassivelyChaos Theory: Increasing The Secret World's replayability with Issue #8 originally appeared on Massively on Tue, 04 Jun 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragondynamic-contentdynamic-elementsfactionfaction-pvpfantasyfeaturedfuncomhorrorilluminatiIssue-7Issue-7-A-Dream-to-KillIssue-8mythologyopinionreplayabilityscenariossci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonTue, 04 Jun 2013 18:00:00 EST<![CDATA[The Secret World Game Director's letter dishes more details on Issues 7 & 8]]>http://massively.joystiq.com/2013/05/31/the-secret-world-game-directors-letter-dishes-more-details-on-i/http://massively.joystiq.com/2013/05/31/the-secret-world-game-directors-letter-dishes-more-details-on-i/http://massively.joystiq.com/2013/05/31/the-secret-world-game-directors-letter-dishes-more-details-on-i/#commentsFiled under: , , , , , ,

TSW Game Director's letter dishes more details on Issues #7 & 8 We already knew that Issue #7 would bring The Secret World a spy-like experience. And now, thanks to the Game Director's letter for May, we also have the title, snazzy cover art, and a glimpse at the climactic ending. We even get an expected time-frame for release; while an exact date is not given, it appears that it will hit the end of June, according to the cover art, and Director Joel Bylos himself states it will coincide with TSW's first anniversary.

Issue #7: A Dream to Kill ends with filth infiltrating Agartha itself through the newly discovered Tokyo entrance, and players will continue to fight this threat with group and solo content until Tokyo can finally be entered.

Bylos also reveals information about Issue #8, including the Virtual Training Scenarios and the Augment System. To prove readiness to enter Tokyo to the Council of Venice, players will have to complete training scenarios that will have random elements thrown in, making each experience different. The Augment system is a new advancement system that will allow players to improve their existing abilities by providing customization in the roles of damage, support, healing, and survivability.

MassivelyThe Secret World Game Director's letter dishes more details on Issues 7 & 8 originally appeared on Massively on Fri, 31 May 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>A-Dream-to-Killbuy-to-playfactionfantasyfuncomGame-Directors-letterhorrorIssue-7Issue-7-A-Dream-to-Killissue-8Joel-Bylosmythologysci-fantasysecret-worldskill-basedsubscriptionlessthe-secret-worldTokyotswFri, 31 May 2013 10:00:00 EST<![CDATA[Age of Conan's May Director's Letter details new content and tech]]>http://massively.joystiq.com/2013/05/30/aoc-directors-letter/http://massively.joystiq.com/2013/05/30/aoc-directors-letter/http://massively.joystiq.com/2013/05/30/aoc-directors-letter/#commentsFiled under: , , ,

Screenshot -- Age of Conan
Crush enemies, see them driven before you, lamentations of their women, yadda yadda. You know the drill. The Age of Conan Game Director's Letter for this month has hit the interwebs, and the topics of discussion are the recent 5th Anniversary event (and the new event system that it utilized), the impending transition to single-server technology, and a number of updates heading to the game soon. The first phase of Age of Conan's switch to single-server tech (which involved moving all of the servers to the same physical location) has been completed, and the AoC team is now "preparing to move towards the new phase," which means merging all same-ruleset servers.

Meanwhile, in Hyboria proper, Age of Conan recently held an in-game event to celebrate its fifth anniversary, and this included the introduction of some snazzy new event tech. In a nutshell, the previous system required that the game be patched in order to both begin and end an event, but with the new system, the devs can run and adjust events on the fly. On top of that, AoC players can expect a smattering of new content over the summer, beginning with the new Coils of Ubah Khan dungeon. Later additions will include new Unchained Dungeons, the Palace of Cetriss, and a shiny new tradeskill system. To get all the delicious information straight from the barbarian's mouth (ew), just click on through the link below.

MassivelyAge of Conan's May Director's Letter details new content and tech originally appeared on Massively on Thu, 30 May 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>age-of-conanage-of-conan-unchainedaocaoc-unchainedconandirectors-lettereventeventsf2pfantasyfree-to-playfuncomhyboriasingle-server-techsingle-server-technologytechtechnologyunchainedThu, 30 May 2013 18:00:00 EST<![CDATA[The Daily Grind: When's the last time you logged out in frustration?]]>http://massively.joystiq.com/2013/05/29/the-daily-grind-whens-the-last-time-you-logged-out-in-frustrat/http://massively.joystiq.com/2013/05/29/the-daily-grind-whens-the-last-time-you-logged-out-in-frustrat/http://massively.joystiq.com/2013/05/29/the-daily-grind-whens-the-last-time-you-logged-out-in-frustrat/#commentsFiled under: , , ,

The Daily Grind When's the last time you logged out in frustration
The other night I had to take a break from The Secret World, because it was either that or ram my head through the monitor. A particularly tricksy mission boss had been kicking my butt up and down the alley until all of my armor was broken and my soul was reduced to a whimpering, pathetic noise. It got so bad that my character, upon resurrection, would face me, fall to her knees, and beg that I not send her back into that meat grinder once more.

I'm sure I'll get it next time, but I just had to take a break to cool down and regroup. That happens sometimes, you know?

So what about you? When is the last time you logged out in frustration and why? Was it just a hard quest, a difficult mechanic, or progress that was wiped out in the blink of an eye?

Every morning, the Massively bloggers probe the minds of their readers with deep, thought-provoking questions about that most serious of topics: massively online gaming. We crave your opinions, so grab your caffeinated beverage of choice and chime in on today's Daily Grind!

MassivelyThe Daily Grind: When's the last time you logged out in frustration? originally appeared on Massively on Wed, 29 May 2013 08:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>buy-to-playdaily-grindfactionfantasyfrustratedfrustrationfuncomhorrorlogged-outmythologyopinionsci-fantasysecret-worldskill-basedsubscriptionlesstdgthe-daily-grindthe-secret-worldtswWed, 29 May 2013 08:00:00 EST<![CDATA[Funcom Q1 sales and restructuring keep studio moving forward]]>http://massively.joystiq.com/2013/05/28/funcom-q1-sales-and-restructuring-keep-studio-moving-forward/http://massively.joystiq.com/2013/05/28/funcom-q1-sales-and-restructuring-keep-studio-moving-forward/http://massively.joystiq.com/2013/05/28/funcom-q1-sales-and-restructuring-keep-studio-moving-forward/#commentsFiled under: , , , , , , , , , ,

Funcom restructuring, good Q1 sales keep studio afloat
If it's not the best news ever, at least we've got some good news from Funcom today. The studio posted its first quarter financial report, showing that it had solid sales and "significant" operating expense savings because of the recent restructuring of its organization.

Funcom made over $6.3 million of revenue in the first quarter, mostly thanks to sales and subscriptions of The Secret World and Age of Conan. The studio said that it saved almost $1.2 million of operating expenses in the same period thanks to the restructuring. Also, The Secret World made more money in Q1 2013 than Q4 2012 thanks to its new business model.

In terms of game news, Funcom is pushing forward with its LEGO Minifigures MMO, the new Anarchy Online graphic engine, a summer release for Issue #7 of The Secret World, and development of several smaller titles. Both LEGO and Funcom will be working to "establish closer integration between the physical product and the game." Finally, thanks to recent decisions by the studio, both Anarchy Online and The Secret World are boasting larger numbers of players than in the previous quarter.

MassivelyFuncom Q1 sales and restructuring keep studio moving forward originally appeared on Massively on Tue, 28 May 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>age-of-conanage-of-conan-unchainedanarchy-onlineaoaocaoc-unchainedbuy-to-playclassic-mmoconanf2pfactionfantasyfinancial-reportfree-to-playfuncomhorrorhyborialegolego-minifigure-mmolego-mmominifigure-mmomythologyq1-2013sci-fantasysci-fisecret-worldskill-basedsubscriptionlessthe-secret-worldtswunchainedTue, 28 May 2013 15:00:00 EST<![CDATA[Chaos Theory: Throwing TSW's next themed party]]>http://massively.joystiq.com/2013/05/27/chaos-theory-throwing-tsws-next-themed-party/http://massively.joystiq.com/2013/05/27/chaos-theory-throwing-tsws-next-themed-party/http://massively.joystiq.com/2013/05/27/chaos-theory-throwing-tsws-next-themed-party/#commentsFiled under: , , , , , ,

Chaos Theory Throwing TSW's next themed party
I spy with my little eye... a trend! With last month's announcement of The Secret World's next update, I noticed a certain motif. It appears that beyond just adding new content, the conspiracy game is getting in on the party planning business, throwing themed bashes for players to enjoy. And the players themselves get to arrive as iconic guests of honor! While not making you the exact person, the two most recent DLCs effectively give you the chance to participate in adventures with the persona of a beloved and/or well-known character: Indiana Jones headlined Issue #6, and James Bond will be the star of Issue #7. That leads me to wonder: What -- or who -- will we meet next?

We've already offered some suggestions for new locales for future TSW updates, so why not toss out a few ideas on the next major icons to represent? I know you all have some favorite role you'd love to slip into, so come add your suggestions to these possibilities.

Continue reading Chaos Theory: Throwing TSW's next themed party

MassivelyChaos Theory: Throwing TSW's next themed party originally appeared on Massively on Mon, 27 May 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsBladebuffybuffy-the-vampire-slayerbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingDLC-ideasdragonfactionfaction-pvpfantasyfeaturedfuncomhorrorilluminatiinspector-gadgetissue-1issue-1-unleashedIssue-6Issue-6-The-Last-Train-to-CairoIssue-7jackie-ChanJediJohn-McLanemythologyopinionRockysci-fantasysecret-worldsecret-world-chaos-theorysherlock-holmesSithskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonUnleashedwho-to-playMon, 27 May 2013 18:00:00 EST<![CDATA[The Stream Team: Day off edition, May 27 - June 2, 2013]]>http://massively.joystiq.com/2013/05/27/the-stream-team-day-off-edition-may-27-june-2-2013/http://massively.joystiq.com/2013/05/27/the-stream-team-day-off-edition-may-27-june-2-2013/http://massively.joystiq.com/2013/05/27/the-stream-team-day-off-edition-may-27-june-2-2013/#commentsFiled under: , ,

The Stream Team Day off edition, May 27 June 2, 2013
Oh, glorious day! With the exception of those chaps (and chapettes) working in emergency services and the like, many folks all over the U.S. get the chance this week to experience that all-too-rare phenomenon: the Extra Day Off. And all I can say is Hallelujah!

Extra days off are free time to sit back and do nothing without a care in the world... oh, whom are we kidding? They are often filled with all those chores and tasks you just don't have time to get to during the work week and are too exhausted to deal with during the weekend. And in the case of holidays with special meaning, perhaps your thoughts and activities are turned toward some type of special observance.

Whether your day is filled with frolicking and festivities, food and family, some combination thereof, or even none of the above, Massively TV will be right here when you have a spare moment. With plenty of live shows and lively reruns, The Stream Team will help you make the most of your day off, not to mention help you get through the rest of the week as well!

Continue reading The Stream Team: Day off edition, May 27 - June 2, 2013

MassivelyThe Stream Team: Day off edition, May 27 - June 2, 2013 originally appeared on Massively on Mon, 27 May 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>achaeaactivisionagonaionanetAnno-Onlineaq-worldsarenanetarkark-hunterarkfallascensionaventurinebiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playconsoleconsolesdarkfalldarkfall-unholy-warsdefiancedfDotA-2dragondragonsdragons-propheteaelectronic-artseq-2eq-iieq2eqiieverquest-2everquest-iif2pfactionfantasyfeaturedfpsfrfree-realmsfree-to-playfuncomguild-warsguild-wars-2gwgw2hi-rezhi-rez-studioshorrorhousinginfernuminfernum-productionskid-friendlykidskids-mmolivestreamlivestreaminglivestreamslucasartsmassively-metamassively-tvmetammo-shootermmofpsmobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftopen-pvpplanetsideplanetside-2playstation-3playstation3pollps2ps3pvprunewakerrunewaker-entertainmentsandboxsci-fantasysci-fisecret-worldshooterskill-basedSmitesoesonysony-online-entertainmentstar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlessswtorsyfythe-old-republicthe-secret-worldthe-stream-teamthird-person-shooterthreshold-rpgtortpstransmedia-synergytriontrion-worldstruly-freetswtvtwitchtwitch-tvunholy-warswarcraftworld-of-warcraftwowxboxMon, 27 May 2013 10:00:00 EST<![CDATA[One Shots: Home sweet home]]>http://massively.joystiq.com/2013/05/26/one-shots-home-sweet-home/http://massively.joystiq.com/2013/05/26/one-shots-home-sweet-home/http://massively.joystiq.com/2013/05/26/one-shots-home-sweet-home/#commentsFiled under: , , , , , ,

One Shots Home sweet home
It's easy to forget that in all of these game worlds that we're adventuring through, some people allegedly live and work in these lands! Even in the very, very scary places! Reader Xexanos found this run-down house in a dark corner of The Secret World and found himself entranced by the mystery of it.

"I stumbled upon this place during my exploration of the Shadowy Forest (the name really tells you everything)," he said. "I wonder what the history behind this is."

I had just found that last week myself and was wondering that too. If any lore experts want to fill us in, please do so, otherwise head past the jump and check out all of the other great reader screenshots we have in store for you this week!

Continue reading One Shots: Home sweet home

MassivelyOne Shots: Home sweet home originally appeared on Massively on Sun, 26 May 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>activisionblizzardblizzard-entertainmentbring-back-one-shotsbuy-to-playconquestfactionfantasyfuncomgalleriesgalleryhorrormortal-onlinemythologyone-shotsopen-pvppics-or-it-didnt-happenpvpreader-screenshotsreader-submissionsriftrift-literift-planes-of-telararvrsandboxsci-fantasyscreenshotscreenshotssecret-worldskill-basedstar-vaultstarvaultsubscriptionlessthe-secret-worldthree-faction-pvpthree-way-pvptriontrion-worldstswuser-submissionswarcraftworld-of-warcraftwowSun, 26 May 2013 10:00:00 EST<![CDATA[Age of Conan announces 5th anniversary event, new membership perks]]>http://massively.joystiq.com/2013/05/22/age-of-conan-announces-5th-anniversary-event-new-membership-per/http://massively.joystiq.com/2013/05/22/age-of-conan-announces-5th-anniversary-event-new-membership-per/http://massively.joystiq.com/2013/05/22/age-of-conan-announces-5th-anniversary-event-new-membership-per/#commentsFiled under: , , , , ,

Age of Conan announces 5th anniversary event new membership perks
Just because it's a tough and gritty world in Age of Conan doesn't mean folks don't know how to celebrate. In fact, Funcom has announced fitting festivities for the fifth anniversary of this fierce fantasy world. Each day for five days starting Thursday, May 23rd, a new epic boss will begin roaming the lands of Hyboria, and each day that a boss remains unconquered it will increase its level of brutality. On the flip side, the chance for epic rewards for defeating one also increases by the day. All players, regardless, of level can join in the fight to take these monsters down, and everyone will have a chance at the rewards.

As anniversary gifts, all players will receive a one-week pass to Khitai as well as other items that can be claimed from the item shop. Members will receive a double item store discount throughout the five-day event as well as a special gift.

Starting tomorrow, membership will include account-wide double xp items, 200 bonus points per month, and a bonus AA point for every level (granted retroactively). Interested in becoming a member? Funcom is also offering a special deal through May 30th granting 50% more time with multi-month subscriptions.

MassivelyAge of Conan announces 5th anniversary event, new membership perks originally appeared on Massively on Wed, 22 May 2013 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>age-of-conanage-of-conan-unchainedanniversary-eventanniversary-eventsanniversary-giftsanniversayaocaoc-unchainedconanf2pfantasyfree-to-playfuncomhyboriamembership-dealsunchainedWed, 22 May 2013 12:00:00 EST<![CDATA[Chaos Theory: Opinions, facts, and open flames]]>http://massively.joystiq.com/2013/05/20/chaos-theory-opinions-facts-and-open-flames/http://massively.joystiq.com/2013/05/20/chaos-theory-opinions-facts-and-open-flames/http://massively.joystiq.com/2013/05/20/chaos-theory-opinions-facts-and-open-flames/#commentsFiled under: , , , , , , ,

Chaos Theory Opinions, facts, and open flames
It's not often that my writings take a ranty slant, In fact, I don't believe I have ever expressed anything along those lines here in Chaos Theory -- although I have a time or two elsewhere. Blue moons come and go much more frequently than I don my Massively-standard-issue flame-retardant garb and venture forth. But right here, right now looks to be one of those times, and I'm already suiting up. So what about The Secret World has me riled up enough to flex my woefully underused ranting muscle?

Nothing.

Seriously, I can't call to mind a single thing in the game deserving of a rant. Sure, TSW isn't perfect; there are flaws and there are things that could use improving, things that are certainly worth discussing. But rant-inducing? Nope. Too bad the same can't be said for people.

It doesn't matter how many times I've witnessed it: It never ceases to amaze me when folks trumpet their own opinions as fact while insisting dissenting opinions can't possibly exist. It's like they board the crazy train where the lines between opinion and fact are swirled together like coffee and creamer, where reality and logic are tossed right out the window. So as a public service, I'm going to derail that train.

Continue reading Chaos Theory: Opinions, facts, and open flames

MassivelyChaos Theory: Opinions, facts, and open flames originally appeared on Massively on Mon, 20 May 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragonendgamefactionfaction-pvpfantasyfeaturedfuncomhorrorilluminatimythologyopinionopinion-vs-factopinionsrantrantssci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonwho-cares-about-endgameMon, 20 May 2013 15:00:00 EST<![CDATA[The Stream Team: Monocle Day edition, May 20 - 26, 2013]]>http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/#commentsFiled under: , , ,

The Stream Team Monocle day edition, May 20 26, 2013
Two weeks ago, y'all had the chance to select a new holiday to help add some cheer to the otherwise bland weeks in the middle of May. The choices teased and tantalized you, but you're a discriminating crowd. In a race fraught with nail-biting suspense, only one ultimately prevailed. And so it is with further ado we bring to you: Monocle Day!

This Tuesday, May 21st, has been selected to be the auspicious day of this most storied celebration. Why? Because 5/21 splits into 5 + 2 + 1, which of course = 8, and we all know that 8 is just two monocles stacked on top of each other! And as always, Massively TV is here to help you ring in the new holiday, with special shows throughout the entire week. Check out the full schedule of celebratory events hosted by The Stream Team after the break. Then let us know if you'll be wearing your own monocle in honor of the festivities.

Continue reading The Stream Team: Monocle Day edition, May 20 - 26, 2013

MassivelyThe Stream Team: Monocle Day edition, May 20 - 26, 2013 originally appeared on Massively on Mon, 20 May 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>Achaeaaction-mmoactivisionagonanetAnno-Onlinearenanetaventurinebiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamescity-of-steamconsoleconsolescrypticcryptic-studiosdarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodfdndDotA-2dragonDragonrealmsdragonsdragons-propheteaelectronic-artselswordeq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfrfree-realmsfree-to-playfuncomgoblinguild-warsgwhi-rezhi-rez-studioshistoricalhorrorhousinginfernuminfernum-productionsinternet-spaceshipskid-friendlykidskids-mmolivestreamlivestreaminglivestreamslucasartsmassively-metamassively-tvmechanistmechanist-gamesmetamobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftneverwinteropen-pvpperfect-worldperfect-world-entertainmentplaneplanesplaystation-3playstation3pollps3pvppwerunewakerrunewaker-entertainmentsandboxsci-fantasysci-fisecret-worldskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicsteampunkstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorthe-old-republicthe-secret-worldthe-stream-teamthreshold-rpgtortswtwitchtwitch-tvunholy-warswarwarcraftwargaming.netwarplanewarplanesworld-of-warcraftworld-of-warplaneswowwowpMon, 20 May 2013 09:00:00 EST<![CDATA[Chaos Theory: The Secret World shaken, not stirred]]>http://massively.joystiq.com/2013/05/13/chaos-theory-the-secret-world-shaken-not-stirred/http://massively.joystiq.com/2013/05/13/chaos-theory-the-secret-world-shaken-not-stirred/http://massively.joystiq.com/2013/05/13/chaos-theory-the-secret-world-shaken-not-stirred/#commentsFiled under: , , , , , , ,

Chaos Theory The Secret World shaken, not stirred
For all those who've been trying so hard to predict gloom and doom for The Secret World, I say Nyeh nyeh because the April producer's letter announcing Issue #7 pretty much flies in the face of all your it's-gonna-die whimperings. In fact, I can't believe we still hear them because TSW just keeps getting better and better. Where's the duct tape when you need it...

While it's true we don't have monthly updates anymore (and that's totally understandable, given the restructuring that devs certainly couldn't predict), Secret World fans are still getting frequent, and more importantly extremely fun, updates. Just look at The Vanishing of Tyler Freeborn and The Last Train to Cairo; both of these issues brought interesting new storylines and a decent helping of new features. Some even say these updates introduced the best content so far. With that track record, who can't help but be totally psyched for the upcoming Issue #7?

Continue reading Chaos Theory: The Secret World shaken, not stirred

MassivelyChaos Theory: The Secret World shaken, not stirred originally appeared on Massively on Mon, 13 May 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsauxiliary-weaponsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragonfactionfaction-pvpfantasyfeaturedfuncomhappy-little-flameshorrorilluminatiIssue-7James-Bondmythologynew-DLCnew-weaponopinionpyropyromaniacsci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonupdateMon, 13 May 2013 15:00:00 EST<![CDATA[The Stream Team: MLT edition, May 13 - 19, 2013]]>http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/#commentsFiled under: , , ,

The Stream Team May 13 19, 2013
Nothing beats an MLT, especially when the tomato is nice and ripe! Except maybe Massively TV. MMmm mmmm. Now there's something you can really sink your teeth into -- the wild and crazy antics of your favorite Stream Team hosts! And they've got a menu for all tastes this week, from space adventures to dragons to WWII planes. Of course, it all comes with a side of reruns and a dessert highlight to complete your meal.

So pull up a chair and grab yourself a helping or two... or 10. Hey, there's no limit here; enjoy as much as you like! While you're enjoying the spread, be sure to join in the after-dinner chat in Outtakes.

Continue reading The Stream Team: MLT edition, May 13 - 19, 2013

MassivelyThe Stream Team: MLT edition, May 13 - 19, 2013 originally appeared on Massively on Mon, 13 May 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmoactivisionage-of-conanage-of-conan-unchainedagonanetaocaoc-unchainedarenanetarkark-hunterarkfallaventurinebiowareblizzardblizzard-entertainmentbuy-to-playccpccp-gamescity-of-steamconanconsoleconsolescrypticcryptic-studiosdarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodefiancedfdnddota-2Dragonrealmseaelectronic-artselswordeq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfree-to-playfuncomgoblinguild-warsgwhi-rezhi-rez-studioshistoricalhorrorhyboriainternet-spaceshipslivestreamlivestreaminglivestreamslucasartsmabinogimassively-metamassively-tvmechmechanistmechanist-gamesmechsmechwarriormechwarrior-mmomechwarrior-onlinemetammo-shootermobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmwomythologyncsoftneverwinternexonnexon-americaopen-pvpperfect-worldperfect-world-entertainmentpiranhapiranha-gamesplaneplanesplaystation-3playstation3pollps3pvppwesandboxsci-fantasysci-fisecret-worldshooterskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicsteampunkstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorsyfythe-old-republicthe-secret-worldthe-stream-teamthird-person-shootertortpstransmedia-synergytriontrion-worldstswtvtwitchtwitch-tvunchainedunholy-warswarwarcraftwargaming.netwarplanewarplanesworld-of-warcraftworld-of-warplaneswowwowpxboxMon, 13 May 2013 09:00:00 EST<![CDATA[Second Wind: Age of Conan]]>http://massively.joystiq.com/2013/05/10/second-wind-age-of-conan/http://massively.joystiq.com/2013/05/10/second-wind-age-of-conan/http://massively.joystiq.com/2013/05/10/second-wind-age-of-conan/#commentsFiled under: , , , , , , , , , , , ,

Age of Conan screenshot
I remember playing Age of Conan when it first came out; it seems like an eternity ago. So many titles have been released and failed since then that it's easy to get it all mixed up, and it doesn't help when many of those titles are sub-par or just plain boring and forgettable. Age of Conan sort of messed with my head with its insistent instancing and odd combat mechanics. I just couldn't wrap my head around what the game was trying to do.

Is it a hardcore PvP-centric MMO? Many would say so. Is it a grand, single-player adventure? In some ways. Is it an immersive romp through the long-lived lore of Conan the Barbarian? I guess so. It's a bit of all of these but does none of them perfectly. I decided to jump back into the game because the last time I played it was when it switched over to its odd freemium model that is all-too-common in Western MMOs these days.

Continue reading Second Wind: Age of Conan

MassivelySecond Wind: Age of Conan originally appeared on Massively on Fri, 10 May 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>age-of-conanage-of-conan-unchainedaocaoc-unchainedbeau-hindmanconanf2pfantasyfeaturedfree-to-playfreemiumftpfuncomhyboriapost-launchre-reviewreviewroundtablesecond-impressionssecond-looksecond-windtranscriptunchainedupdated-impressionsFri, 10 May 2013 09:00:00 EST<![CDATA[Chaos Theory: Player projects enhance The Secret World experience]]>http://massively.joystiq.com/2013/05/06/chaos-theory-player-projects-enhance-the-secret-world-experienc/http://massively.joystiq.com/2013/05/06/chaos-theory-player-projects-enhance-the-secret-world-experienc/http://massively.joystiq.com/2013/05/06/chaos-theory-player-projects-enhance-the-secret-world-experienc/#commentsFiled under: , , , , , , , ,

Chaos Theory Player projects enhance The Secret World experience
One of The Secret World's most unique elements makes it ripe for producing immersive experiences, even outside of the game. Set in the modern real world (as opposed to the fantasy or even sci-fi themes prevalent in our MMOverse), a game can more easily blur the line between logged in and logged out. Players can, and do, generate ways to be a part of the game while still out and about in the real world. Today, I'm going to shine a spotlight on two of these projects that use very different methods to continue immersion beyond actual gameplay.

In January, one TSW fan ran an Alternate-Reality Game (ARG) for fellow players. Using Twitter, the forums, email, and even in-game characters, this player orchestrated a full-on investigation for participants to work through. And just recently, a new site offering to immerse players more deeply into the game through imagery was beta-launched. Both projects further player involvement in the world of the game -- the stories, the conspiracies, the histories, and the surroundings -- beyond the actual game. Both received support from Funcom in their efforts to expand the fans' experiences. And both are definitely worth checking out, so I sat down with the creators to get the scoop on the why, the how, and the what's next.

Continue reading Chaos Theory: Player projects enhance The Secret World experience

MassivelyChaos Theory: Player projects enhance The Secret World experience originally appeared on Massively on Mon, 06 May 2013 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsalternate-reality-gameARGbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragonfactionfaction-pvpfantasyfeaturedfuncomhorroriimmersionilluminatiMorteiamythologyopinionpanoramic-viewsPGCplayer-generated-contentsci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonTSWPanoYarrukaMon, 06 May 2013 16:00:00 EST<![CDATA[The Stream Team: Seis de Mayo edition, May 6 - 12, 2013]]>http://massively.joystiq.com/2013/05/06/the-stream-team-seis-de-mayo-edition-may-6-12-2013/http://massively.joystiq.com/2013/05/06/the-stream-team-seis-de-mayo-edition-may-6-12-2013/http://massively.joystiq.com/2013/05/06/the-stream-team-seis-de-mayo-edition-may-6-12-2013/#commentsFiled under: , , ,

The Stream Team Seis de Mayo edition, May 6 12, 2013
You have to agree, May is one month that's full of holidays. The first week alone contains May Day, (unofficial) Star Wars Day, and Cinco de Mayo. But the party doesn't stop there! Following quickly on the heels of these is perhaps one you are less familiar with: Seis de Mayo.

Not unlike its cousin the day before, Seis de Mayo is a day of celebration; however, this celebration centers on freedom from boredom via visual entertainment. No, really! And to commemorate the day, we're releasing an all-new Massively TV schedule, giving you the means to celebrate the whole week through with The Stream Team. If you can't celebrate live, just tune into a rerun and party whenever.

Well, even if you don't believe us, you can still commemorate the occasion with us. Just check out the past the cut for a heaping helping of daily festivities.

Continue reading The Stream Team: Seis de Mayo edition, May 6 - 12, 2013

MassivelyThe Stream Team: Seis de Mayo edition, May 6 - 12, 2013 originally appeared on Massively on Mon, 06 May 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmoactivisionage-of-conanage-of-conan-unchainedagonaionanetaocaoc-unchainedarenanetarkark-hunterarkfallascensionaventurinebiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamesclone-warsclone-wars-adventuresconanconsoleconsolescrypticcryptic-studioscwadarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodefiancedfdnddota-2dragondragonsdragons-propheteaelectronic-artseq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfamilyfantasyfeaturedfpsfree-to-playfuncomguild-warsguild-wars-2gwgw2heroes-and-generalshi-rezhi-rez-studioshousinghyboriainfernuminfernum-productionsinternet-spaceshipskid-friendlykidskids-mmokingsislekingsisle-entertainmentlivestreamlivestreaminglivestreamslobbylucasartsmabinogimassively-metamassively-tvmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemetaminigamemmo-shootermmofpsmobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmwoncsoftneverwinternexonnexon-americaopen-pvpperfect-worldperfect-world-entertainmentpiranhapiranha-gamesplanetsideplanetside-2playstation-3playstation3pollps2ps3pvppwerunewakerrunewaker-entertainmentsandboxsci-fantasysci-fishooterSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsuperherosuperheroesswtorsyfythe-old-republicthe-stream-teamthird-person-shootertorTorchlight-2torchlight-iitpstransmedia-synergytriontrion-worldstruly-freetvtwitchtwitch-tvunchainedunholy-warswarcraftwarmage-battlegroundswizard101world-of-warcraftwowxboxMon, 06 May 2013 09:00:00 EST<![CDATA[One Shots: The dark night dashes]]>http://massively.joystiq.com/2013/05/05/one-shots-the-dark-night-dashes/http://massively.joystiq.com/2013/05/05/one-shots-the-dark-night-dashes/http://massively.joystiq.com/2013/05/05/one-shots-the-dark-night-dashes/#commentsFiled under: , , , , , , ,

One Shots The dark night rises
Just because you have passing familiarity with Superman and Batman doesn't mean you know jack about the real superheroes who do all of the dirty work while the headliners steal the signal light. For instance, have you met this guy? If you haven't, let reader Russell make your acquaintance.

"This is my Brawling Juggernaut in DC Universe Online, known by many as Orange Crush," Russell begins with aplomb. "Here he is in pursuit of justice, on the way to laying some Crush down on the villains of our great and beloved Gotham City!"

Will Orange Crush arrive in time? Tune in to the rest of this column after the break!

Continue reading One Shots: The dark night dashes

MassivelyOne Shots: The dark night dashes originally appeared on Massively on Sun, 05 May 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>biowareblueholebluehole-studiosbring-back-one-shotsbuy-to-playconsoleconsolesdc-universedc-universe-onlinedcuoeaelectronic-artsen-masseen-masse-entertainmentf2pfactionfantasyfree-to-playfuncomgalleriesgalleryhorrorlucasartsmythologyone-shotspics-or-it-didnt-happenplaystation-3playstation3ps3reader-screenshotsreader-submissionssci-fantasysci-fiscreenshotscreenshotssecret-worldskill-basedsoesony-online-entertainmentstar-warsstar-wars-the-old-republicsubscriptionlesssuperherosuperheroesswtorterathe-old-republicthe-secret-worldtortswuser-submissionsSun, 05 May 2013 10:00:00 EST<![CDATA[The Secret World celebrates with a bonus weekend]]>http://massively.joystiq.com/2013/05/02/the-secret-world-celebrates-with-a-bonus-weekend/http://massively.joystiq.com/2013/05/02/the-secret-world-celebrates-with-a-bonus-weekend/http://massively.joystiq.com/2013/05/02/the-secret-world-celebrates-with-a-bonus-weekend/#commentsFiled under: , , , , ,

The Secret World celebrates with a bonus weekend
Celebrates what, you might ask? Funcom certainly doesn't need a reason to celebrate as the studio is dubbing this upcoming weekend as a golden weekend in The Secret World, full of prizes and rewards.

First off, for every Ability Point earned this weekend, you get a free bonus point which is stackable with item store Timed Ability Point boosts. You can also earn a free month of membership for every new player you recruit who purchases the game in the next 30 days. And to top it all off, you get 30% extra bonus points every time you purchase Funcom points.

The Secret World's Golden Weekend event runs from this Friday, May 3, at 9am EDT through Sunday, May 5.

MassivelyThe Secret World celebrates with a bonus weekend originally appeared on Massively on Thu, 02 May 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>buy-to-playfactionfantasyfuncomgolden-weekendhorrormythologysci-fantasysecret-worldskill-basedsubscriptionlessthe-secret-worldtswThu, 02 May 2013 18:00:00 EST<![CDATA[Age of Conan game director talks about server tech, tradeskills, and more]]>http://massively.joystiq.com/2013/04/30/age-of-conan-game-director-talks-about-server-tech-tradeskills/http://massively.joystiq.com/2013/04/30/age-of-conan-game-director-talks-about-server-tech-tradeskills/http://massively.joystiq.com/2013/04/30/age-of-conan-game-director-talks-about-server-tech-tradeskills/#commentsFiled under: , , , , ,

Age of Conan game director talks about server tech, tradeskills, and more
Joel Bylos, the game director for Age of Conan, has put out this month's game director letter. In it, he addresses his team's plan for addressing "most of the concerns and requests" that players have.

Through a three-phase process, Age of Conan will come closer to having the same server functionality as The Secret World. Servers will be moved to the same physical place, then servers with the same ruleset will be merged, and then cross-server queues and functionality will be implemented. The tradeskill system is getting a massive revamp. Key changes there include the near removal of quests from tradeskill progression. Dragon's Spine and Unchained content is starting to get scheduled, bit by bit, for release.

You can read the full dev letter on the official site.

MassivelyAge of Conan game director talks about server tech, tradeskills, and more originally appeared on Massively on Tue, 30 Apr 2013 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>age-of-conanage-of-conan-unchainedaocaoc-unchainedconanf2pfantasyfree-to-playfuncomhyboriajoel-bylosthe-secret-worldunchainedTue, 30 Apr 2013 17:30:00 EST<![CDATA[The Secret World's Issue #7 goes 007]]>http://massively.joystiq.com/2013/04/30/the-secret-worlds-issue-7-goes-007/http://massively.joystiq.com/2013/04/30/the-secret-worlds-issue-7-goes-007/http://massively.joystiq.com/2013/04/30/the-secret-worlds-issue-7-goes-007/#commentsFiled under: , , , , , , ,

The Secret World's Issue #7 goes 007
April's Game Director letter for The Secret World is hot off the presses, and in it Joel Bylos shared some juicy morsels about the next issue in store for the horror and conspiracy-laced game. He revealed that whereas Issue #6 was spiced with an Indiana Jones flavor, Issue #7 will be sprinkled with a distinct 007 zest. Yes, Bond. James Bond.

Set in Transylvania, Issue #7 directs players to investigate the presence of the werewolves in the area, which ultimately leads them to an Orochi facility secreted away below a glacier in the Carpathian Fangs. Along the way, players get to experience adventures as a secret agent, complete with daring chases (a snowmobile one at that!), dare-devil jumps from exploding bridges, and close shaves with laser beams near sensitive areas. There's also a new auxiliary weapon to brandish -- the flamethrower.

But the new goodies don't stop there. Bylos introduced a new feature that allows for custom streaming of radio stations or playlists directly into the client as well as a some PvP changes including tweaks to the matchmaking system. He concluded with some teasers about Black Ops and Issue #8. For all the details, check out the full letter.

MassivelyThe Secret World's Issue #7 goes 007 originally appeared on Massively on Tue, 30 Apr 2013 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>auxiliary-weaponsbuy-to-playfactionfantasyflamethrowerfuncomhorrorIssue-7James-Bondmythologynew-weaponOrochisci-fantasysecret-worldskill-basedsubscriptionlessthe-secret-worldTransylvaniatswupdateTue, 30 Apr 2013 13:00:00 EST<![CDATA[Chaos Theory: Testing my Secret World DPS makeover]]>http://massively.joystiq.com/2013/04/29/chaos-theory-testing-my-secret-world-dps-makeover/http://massively.joystiq.com/2013/04/29/chaos-theory-testing-my-secret-world-dps-makeover/http://massively.joystiq.com/2013/04/29/chaos-theory-testing-my-secret-world-dps-makeover/#commentsFiled under: , , , , , , , , ,

Chaos Theory Testing my Secret World DPS makeover
It's no secret that The Secret World is just a wee bit different than the majority of MMORPGs out there. Hallelujah for that, right? And one notable area it differs from the rest is how it treats gear and classes. As such, players can't necessarily bring habits and know-how from other titles and translate that into immediate success in TSW. It's no wonder that even good players can sometimes feel stumped or at a loss when navigating through builds. For that very reason, Chaos Theory brought you the first episode of What Not to Wear, a live makeover that focused on sharing hints and tips that non-theorycrafters (like yours truly) could use as a base for forging their own path.

It was a simple makeover really -- just minor changes in my focus and equipment using gear I already had in my bag and abilities I already had access to. Did it help? Did my effectiveness as a damage-dealer increase? The outcome was rather surprising.

Continue reading Chaos Theory: Testing my Secret World DPS makeover

MassivelyChaos Theory: Testing my Secret World DPS makeover originally appeared on Massively on Mon, 29 Apr 2013 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingDPS-guideDPS-makeoverdragonfactionfaction-pvpfantasyfeaturedfuncomhintshorrorilluminatilivestreammythologyopinionpassive-abilitiessci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstips-and-trickstrailertrailerstswtsw-chaos-theorytsw-dragonvideovideoswhat-not-to-wearMon, 29 Apr 2013 20:00:00 EST<![CDATA[The Stream Team: Fuzzy slippers edition, April 29 - May 5, 2013]]>http://massively.joystiq.com/2013/04/29/the-stream-team-fuzzy-slippers-edition-april-29-may-5-2013/http://massively.joystiq.com/2013/04/29/the-stream-team-fuzzy-slippers-edition-april-29-may-5-2013/http://massively.joystiq.com/2013/04/29/the-stream-team-fuzzy-slippers-edition-april-29-may-5-2013/#commentsFiled under: , ,

The Stream Team Fuzzy slippers edition, April 29 May 5, 2013
Comfort food is a pretty universally understood concept. And most folks can also easily envision the security of a blanket a la Linus in the Peanuts cartoons. But what do gamers turn to for stability and comfort during stressful times? I mean, we all know that sometimes games get pretty intense. If you don't believe me, just watch Massively TV! Death and glory, victory and defeat: The Stream Team experiences it all.

Some folks have specific food or drinks on hand for their gaming sessions. I know one gamer with a bobble-head. Me? I've got my fuzzy slippers! Yes, really. When I wear them, glorious victories are all the sweeter and harrowing defeats lose their sting. And I swear they bring me luck. Gaming is just better in fuzzy slippers. If you haven't tried it, I totally encourage you to. Uncertain? Try it, you might like it! Grab a pair and give them a test run while watching this week's shows. Or if you have your own can't-do-without gaming accessory, let us know what it is in the Outtakes.

Continue reading The Stream Team: Fuzzy slippers edition, April 29 - May 5, 2013

MassivelyThe Stream Team: Fuzzy slippers edition, April 29 - May 5, 2013 originally appeared on Massively on Mon, 29 Apr 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmoactivisionall-points-bulletinall-points-bulletin-reloadedanetapbapb-reloadedapbrarenanetbiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playclone-warsclone-wars-adventurescrimecrypticcryptic-studioscwadnddragondragonsdragons-propheteaelectronic-artseq-2eq-iieq2eqiieverquest-2everquest-iif2pfactionfamilyfantasyfeaturedfpsfree-to-playfuncomg1gamersfirstguild-warsguild-wars-2gwgw2Heroes-and-GeneralsHeroes-and-Generalshi-rezhi-rez-studioshistoricalhorrorhousinginfernuminfernum-productionskid-friendlykidskids-mmokingsislekingsisle-entertainmentlivestreamlivestreaminglivestreamslobbylucasartsmassively-metamassively-tvmetaminigamemmo-shootermmofpsmobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftneverwinterperfect-worldperfect-world-entertainmentplaneplanesplanetsideplanetside-2pollps2pvppwerunewakerrunewaker-entertainmentsandboxsci-fantasysci-fisecret-worldshooterskill-basedSmitesoesonysony-online-entertainmentstar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlessswtorThe-Lost-Titansthe-old-republicthe-secret-worldthe-stream-teamtorTorchlight-2torchlight-iitswtwitchtwitch-tvwarWar-Thunderwarcraftwargaming.netWarMage-Battlegroundswarplanewarplaneswizard101world-of-warcraftworld-of-warplaneswowwowpMon, 29 Apr 2013 09:00:00 EST<![CDATA[Some Assembly Required: Community as content]]>http://massively.joystiq.com/2013/04/26/some-assembly-required-community-as-content/http://massively.joystiq.com/2013/04/26/some-assembly-required-community-as-content/http://massively.joystiq.com/2013/04/26/some-assembly-required-community-as-content/#commentsFiled under: , , , , ,

Some Assembly Required Community as content
Not too long ago, I had the opportunity to cover an occasion during which an in-game community came together and created a new player-run annual event. Born as an anniversary follow-up to a service event for the young terminally ill player Ribbitribbit, the new tradition focused on celebrating that very community that pulled together to create him a dream playground within EverQuest II. If the game lacked a sense of community in the game before that original project, it certainly didn't after.

After tugging at my heartstrings for a while, that experience made me reflect on how much our communities are really a cornerstone of player-generated content. How often have you attended or participated in an event or run a mission created by someone other than yourself? And yet, when discussing important tools and elements needed to support player-generated content, we often overlook the necessity of a vibrant community. It's like trying to bake a cake without adding the flour. Or how about this analogy: You can give folks a giant tool box full of a shiny implements and tell them to build a house, but not much will happen without the actual wood and materials! So to foster PGC, games need to foster building communities.

Continue reading Some Assembly Required: Community as content

MassivelySome Assembly Required: Community as content originally appeared on Massively on Fri, 26 Apr 2013 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>aionascensionbuy-to-playcommunitycommunity-buildingcommunity-building-toolseaelectronic-artsendless-trialeq-2eq-iieq2eqiieveeve-fanfesteve-fanfest-2013eve-onlineeve-online-fanfesteve-online-fanfest-2013eventevent-coverageeverquest-2everquest-iif2pfactionfanfestfantasyfeaturedfree-to-playfuncomgame-mechanicshorroricelandin-game-calendarlineagelineage-2lineage-iimassively-event-coveragemythicmythic-entertainmentmythologyncsoftopinionpgcplayer-contentplayer-generated-contentpvprekyjavikrvrsandboxsarsci-fantasysecret-worldskill-basedsoesome-assembly-requiredsonysony-online-entertainmentsubscriptionlessthe-secret-worldtruly-freetswwarwarhammerwarhammer-onlineFri, 26 Apr 2013 16:00:00 EST<![CDATA[Choose My Adventure: Extreme DIY makeover edition]]>http://massively.joystiq.com/2013/04/24/choose-my-adventure-extreme-diy-makeover-edition/http://massively.joystiq.com/2013/04/24/choose-my-adventure-extreme-diy-makeover-edition/http://massively.joystiq.com/2013/04/24/choose-my-adventure-extreme-diy-makeover-edition/#commentsFiled under: , , ,

Choose My Adventure Extreme DIY makeover edition
Life may be like a box of chocolates, but gaming is like a Do-It-Yourself project. It may not be as mouth-watering an analogy, but it is certainly fitting: MMOs are a giant construction zone where players build their own experiences in a virtual world using tools from the game and their own imagination.

Each project is a unique undertaking, bearing the personal touches of the builder, whether the builder is an individual or a group like a guild. Some players prefer to build a single residence and settle in, while others enjoy moving from project to project, exploring new territory and testing new tools. Me? I tend toward the former; I'm the kind who tinkers around in one place over a long period of time. But all that's about to change. Again.

That's right, folks; it's my turn to break ground on yet another Choose My Adventure! For the next six weeks I am leaving the comfy confines of my familiar surroundings and allowing you to direct my next MMO project. Yes, my dear Massively friends, you will be the foreman of this endeavor, determining every step of the construction, from where I'll build my newest experience to what tools I'll get to use.

Continue reading Choose My Adventure: Extreme DIY makeover edition

MassivelyChoose My Adventure: Extreme DIY makeover edition originally appeared on Massively on Wed, 24 Apr 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmoage-of-conanage-of-conan-unchainedage-of-wulinage-of-wushuagonallodsallods-onlineaocaoc-unchainedarkark-hunterarkfallasiaastrum-nivalaventurinebrowserbrowser-basedchinachinesechinese-mmochoose-my-adventurechoose-my-adventure-mj-guthrieclone-warsclone-wars-adventurescmaconanconsoleconsolescrypticcryptic-studioscwadarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodefiancedfdndf2pfamilyfantasyfeaturedfree-to-playfuncomgala-netgpotatogvghands-onhistoricalhyboriakid-friendlykidnappingkidskids-mmokingsislekingsisle-entertainmentlobbylord-of-the-ringslord-of-the-rings-onlinelotromail-ru-gamesmail.ru-gamesmailru-gamesmartial-artsming-dynastyminigamemmo-shooterneverwinteropen-pvpopinionperfect-worldperfect-world-entertainmentpiratepirate101piratesplaneplanesplaystation-3playstation3pollpollsps3pvppwereaders-choicesandboxsci-fantasysci-fishootersnail-gamessnail-games-usasoesony-online-entertainmentstar-warssuperherosuperheroessyfythird-person-shootertpstransmedia-synergytriontrion-worldsturbineturbine-entertainmenttvunchainedunholy-warsVendetta-Onlinevotevotingwarwargaming.netwarplanewarplanesworld-of-warplaneswowpwushuwuxiaxboxWed, 24 Apr 2013 11:00:00 EST<![CDATA[Jukebox Heroes: Battle music!]]>http://massively.joystiq.com/2013/04/23/jukebox-heroes-battle-music/http://massively.joystiq.com/2013/04/23/jukebox-heroes-battle-music/http://massively.joystiq.com/2013/04/23/jukebox-heroes-battle-music/#commentsFiled under: , , , , , , , ,

Jukebox Heroes Battle music!
It's time once again to take a week off from looking at specific MMO soundtracks and open ourselves up to a theme instead. The topic? Battle music. Yeah, it can be some of the most obnoxious music in the game, especially after hearing it for the 3,000th time, but every once in a while I hear a piece that has some merit to it. These are the ones we want to examine today.

What makes for a good battle music track? I think it has to get you excited without being annoying or grating and not so loud or incredibly noticeable that you can't help but get tired of it sooner rather than later. It was actually pretty tricky to pull together six such tracks for this column, but I managed to do with with the help of Colonel Bugle up there. He's got the best MP3 collection around.

Continue reading Jukebox Heroes: Battle music!

MassivelyJukebox Heroes: Battle music! originally appeared on Massively on Tue, 23 Apr 2013 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>anarchy-onlineaoatlanticaatlantica-onlinebiowarecamelotclassic-mmocomposercomposersconsoleconsolesdaocdark-age-of-cameloteaelectronic-artseqeq1everquestf2pfantasyfeaturedffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivfree-to-playfuncomgame-musicjukeboxjukebox-heroesjustin-olivettilord-of-the-ringslord-of-the-rings-onlinelotrommo-jukeboxmmo-musicmusicmythicmythic-entertainmentmythologynexonnexon-americanexon-koreaopinionpvprvrsci-fisoesonysony-online-entertainmentsoundtracksoundtrackssquaresquare-enixtactical-mmoturbineturbine-entertainmentTue, 23 Apr 2013 20:00:00 EST<![CDATA[The Secret World has a lot of clothing options]]>http://massively.joystiq.com/2013/04/23/the-secret-world-has-a-lot-of-clothing-options/http://massively.joystiq.com/2013/04/23/the-secret-world-has-a-lot-of-clothing-options/http://massively.joystiq.com/2013/04/23/the-secret-world-has-a-lot-of-clothing-options/#commentsFiled under: , , , , , , , ,

tsw dev guide on costumes see team email
If you've played The Secret World for more than five minutes, you're probably aware of the fact that it has some of the most extensive outfit options of any MMORPG on the market. If you're not aware of that fact, well, you're the target audience of Funcom's latest dev blog.

It's all about avatar customization, and it details how TSW's stats are kept separate from clothing items in order to satisfy your inner min-maxer and fashion maven simultaneously. Since the game is set in the modern world, you'll find many authentic styles available to earn in-game or purchase through the cash shop. If you're a fan of the otherworldly, don't fret. There are plenty of sci-fi, steampunk, horror, fantasy, and medieval get-ups as well.

MassivelyThe Secret World has a lot of clothing options originally appeared on Massively on Tue, 23 Apr 2013 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>buy-to-playfactionfantasyfuncomhorrormythologysci-fantasysecret-worldsecret-world-clothingsecret-world-customizationskill-basedsubscriptionlessthe-secret-worldtswtsw-clothingtsw-customizationTue, 23 Apr 2013 13:00:00 EST<![CDATA[Chaos Theory: Perfecting your build in The Secret World]]>http://massively.joystiq.com/2013/04/22/chaos-theory-perfecting-your-build-in-the-secret-world/http://massively.joystiq.com/2013/04/22/chaos-theory-perfecting-your-build-in-the-secret-world/http://massively.joystiq.com/2013/04/22/chaos-theory-perfecting-your-build-in-the-secret-world/#commentsFiled under: , , , , , , ,

Chaos Theory Perfecting your build in The Secret World
After discussing last week that build creation was on the minds of many a Secret World fan, I promised to provide some hints and tips on how to better maximize your performance in game. It truly is a topic relevant to all players, even those who aren't focused on or interested in endgame. After all, even folks (like yours truly) who are in it mainly for the awesome story may find their ability to continue with said story hampered at some point by an insufficient build.

With a limit of only seven active (eight if you have an auxiliary weapon) and seven passive skills available to use at any time, creating a build in The Secret World is not quite like most other MMOs, so you can't just automatically throw on gear of a higher level and call it good. Sure, you can eventually pound your way through many things, but you can save yourself some time and frustration by understanding a bit about how the gear works together with your skills. That's where today's Chaos Theory comes in.

What better way to inform and entertain you than to open myself up for some theorycrafting by someone who has a better knack for it? Using my little Illuminati as our guinea pig, I've bared her gear for all to see and learn what can be done to improve. With that, I welcome you to the first episode of "What Not to Wear in TSW"!

Continue reading Chaos Theory: Perfecting your build in The Secret World

MassivelyChaos Theory: Perfecting your build in The Secret World originally appeared on Massively on Mon, 22 Apr 2013 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbuildsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingDPS-builddragonfactionfaction-pvpfantasyfeaturedfuncomguideguide-to-DPS-buildshorrorilluminatimythologyopinionsci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorytheorycraftingthree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonMon, 22 Apr 2013 19:00:00 EST<![CDATA[One Shots: Yo ho ho!]]>http://massively.joystiq.com/2013/04/21/one-shots-yo-ho-ho/http://massively.joystiq.com/2013/04/21/one-shots-yo-ho-ho/http://massively.joystiq.com/2013/04/21/one-shots-yo-ho-ho/#commentsFiled under: , , , , , , ,

One Shots Yo ho ho!
There's probably no gulf as wide as the one between historical pirates and the pop culture versions that we venerate. As a guy who had a pirate-themed 30th birthday party, I can't say that I'm against our off-kilter brand of scallywags. Neither is reader Phinneas, who sent in our featured screenshot from Pirate101.

"These shots are of the main starting area with my fearsome pirate looking to the horizon for adventures ahead," he writes.

Best of luck to ye, laddie! May the wind be at your back, your enemies in Davey Jones' locker, and a bottle of ginger ale in your belly! Yet pirates are only the beginning of today's adventure through One Shots...

Continue reading One Shots: Yo ho ho!

MassivelyOne Shots: Yo ho ho! originally appeared on Massively on Sun, 21 Apr 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>anetarenanetbiowarebring-back-one-shotsbuy-to-playeaelectronic-artsf2pfactionfamilyfantasyfree-to-playfuncomgalleriesgalleryguild-wars-2gw2horrorkid-friendlykids-mmokingsislekingsisle-entertainmentlucasartsmythologyncsoftone-shotspics-or-it-didnt-happenpiratepirate101piratesreader-screenshotsreader-submissionssci-fantasysci-fiscreenshotscreenshotssecret-worldskill-basedstar-warsstar-wars-the-old-republicsubscriptionlessswtorthe-old-republicthe-secret-worldtortswuser-submissionsSun, 21 Apr 2013 10:00:00 EST<![CDATA[Chaos Theory: The Secret World community roundup]]>http://massively.joystiq.com/2013/04/15/chaos-theory-the-secret-world-community-roundup/http://massively.joystiq.com/2013/04/15/chaos-theory-the-secret-world-community-roundup/http://massively.joystiq.com/2013/04/15/chaos-theory-the-secret-world-community-roundup/#commentsFiled under: , , , , , ,

Chaos Theory The Secret World community roundup
You've heard me express my thoughts quite a bit over the last couple of months about everything from what I want to see in The Secret World (like housing and an encore to special events) to my experiences with different aspects of the game (such as sabotage missions and Issue #6). Now it's time to share yours! Yes, folks, this week follows in a time-honored tradition of community roundups, where we dive into the topics that are in the forefront of the community's collective mind.

Of course, we can't touch on everything here (that's what official forums are for), but we can explore a smattering of the topics raised. So what are TSW players chattering about lately? Among the ongoing conversations are discussions about veteran rewards, clothing, PvP tournaments, and builds.

Continue reading Chaos Theory: The Secret World community roundup

MassivelyChaos Theory: The Secret World community roundup originally appeared on Massively on Mon, 15 Apr 2013 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbuy-to-playchaos-theoryclothingcommunity-roundupconspiracyconspiracy-thriillerdark-days-are-comingdragonfactionfaction-pvpfantasyfeaturedfuncomhorrorilluminatimythologyopinionPvPsci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorytheory-craftingthree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonveteran-rewardsMon, 15 Apr 2013 19:00:00 EST<![CDATA[New raid included in today's Secret World patch]]>http://massively.joystiq.com/2013/04/15/new-raid-included-in-todays-secret-world-patch/http://massively.joystiq.com/2013/04/15/new-raid-included-in-todays-secret-world-patch/http://massively.joystiq.com/2013/04/15/new-raid-included-in-todays-secret-world-patch/#commentsFiled under: , , , , , ,

New raid included in The Secret World's patch
Amid the general bug squashing and polishing released in today's patch, The Secret World has tucked away a tasty little morsel of content: an all new lair raid encounter. A weak point between realities has been discovered out in the Kingsmouth wreckage, and groups of 10 adventurers can enter the extra-dimensional prison, The Island of Stillborn Stars, to face Eidolon of the Outer Dark.

Bits of housekeeping also included in the patch were fixes to several exploits in lairs, dungeons, and PvP as well as assorted bugs (say goodbye to area spam when anyone nearby uses a reconstructor and black screens after using the Helevator). Players will also find a brand new item for sale at the Envoy of Ca' d'Oro. For a full listing of all the changes, check out the official patch notes.

[Source: Funcom press release]

MassivelyNew raid included in today's Secret World patch originally appeared on Massively on Mon, 15 Apr 2013 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bug-fixesbuy-to-playfactionfantasyfuncomhorrorlairlairsmythologynew-raidpatchsci-fantasysecret-worldskill-basedsubscriptionlessthe-secret-worldtswMon, 15 Apr 2013 14:00:00 EST<![CDATA[The Stream Team: Stepping on tax edition, April 15 - 21, 2013]]>http://massively.joystiq.com/2013/04/15/the-stream-team-stepping-on-tax-edition-april-15-21-2013/http://massively.joystiq.com/2013/04/15/the-stream-team-stepping-on-tax-edition-april-15-21-2013/http://massively.joystiq.com/2013/04/15/the-stream-team-stepping-on-tax-edition-april-15-21-2013/#commentsFiled under: , , , ,

The Stream Team Stepping on tax edition, April 15 21, 2013
'Tis the season! Just... not that season. This isn't one we really want; it's not a season of joyousness and brotherly kindness. No, this one's more akin to scattering LEGOs and thumbtacks all across the floor then dashing barefoot from wall to wall just to hit your head against them over and over. We understand the pain. Truly, we do. And The Stream Team is here for you.

They say nothing's certain in life except death and taxes, but we disagree! We'd totally add Massively TV to that list. Have we ever left you in your times of need? No! And we know you need us now more than ever. We're here to help you, with a full line-up of shows to help ease the pain and take your mind off the traumas that cannot be avoided. So take a load off and check out this week's schedule, catch a few reruns, see the highlight of the week, and take part in our two polls. Then remember, at least this only happens once a year!

Continue reading The Stream Team: Stepping on tax edition, April 15 - 21, 2013

MassivelyThe Stream Team: Stepping on tax edition, April 15 - 21, 2013 originally appeared on Massively on Mon, 15 Apr 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>activisionage-of-wulinage-of-wushuagotaionanetarenanetarkark-hunterarkfallartplayascensionasiabigpointbiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gameschampionschampions-onlinechampschinachinesechinese-mmococonsoleconsolescrypticcryptic-studiosdefianceeaelectronic-artseq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfamilyfantasyfeaturedfrfree-realmsfree-to-playfuncomgame of thronesgame-of-thrones-ascentgame-of-thrones-mmogame-of-thrones-seven-kingdomsgeorge-martingeorge-rr-martingotgot7kgpotatoguild-warsguild-wars-2gvggwgw2hbohi-rezhi-rez-studioshistoricalhorrorinternet-spaceshipskid-friendlykidnappingkidskids-mmokingsislekingsisle-entertainmentlivestreamlivestreaminglivestreamslucasartsmartial-artsmassively-metamassively-tvmetamight-and-magicmight-and-magic-duel-of-championsming-dynastymmo-shootermobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftperfect-worldperfect-world-entertainmentplaneplanesplaystation-3playstation3pollps3pvppwesandboxsci-fantasysci-fisecret-worldseven-kingdomsshooterskill-basedSmitesnail-gamessnail-games-usasoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorsyfytanktankstelonthe-aurora-worldthe-old-republicthe-secret-worldthe-stream-teamthird-person-shootertortpstransmedia-synergytriontrion-worldstruly-freetswtvtwitchtwitch-tvvanguardvanguard-saga-of-heroesvgvillagers-and-heroeswarwarcraftwargaming.netwarplanewarplaneswesteroswizard101world-of-tanksworld-of-warcraftworld-of-warplaneswotwowwowpwushuwuxiaxboxMon, 15 Apr 2013 09:00:00 EST<![CDATA[Chaos Theory: Exploring The Secret World's endgame]]>http://massively.joystiq.com/2013/04/08/chaos-theory-exploring-endgame/http://massively.joystiq.com/2013/04/08/chaos-theory-exploring-endgame/http://massively.joystiq.com/2013/04/08/chaos-theory-exploring-endgame/#commentsFiled under: , , , , , , ,

Chaos Theory Exploring endgame
Throughout my tenure as the Chaos Theory author, I've ruminated on a number of Secret World subjects that personally interest, intrigue, or otherwise affect me. I've covered ARGs, different issue updates, sabotage quests, the conversion to buy-to-play, ambiance, and more. I've even expounded on things I'd like to see in game, like housing and vehicles. But one thing I haven't covered with much detail are areas that don't have much personal relevance to me... yet.

While it makes sense to talk most about my personal experiences, The Secret World offers so much more than what I have delved into. There really are different strokes for different folks, all wrapped up within the one world. So this week we are exploring an area that captures the attention of others if not mine: endgame.

Continue reading Chaos Theory: Exploring The Secret World's endgame

MassivelyChaos Theory: Exploring The Secret World's endgame originally appeared on Massively on Mon, 08 Apr 2013 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragonendgamefactionfaction-pvpfantasyfeaturedfuncomhorrorilluminatimythologynightmare-modenightmare-mode-dungeonsopinionsci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorytheorycraftingthree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonMon, 08 Apr 2013 12:00:00 EST<![CDATA[The Stream Team: Bleepity bleep edition, April 8 - 14, 2013]]>http://massively.joystiq.com/2013/04/08/the-stream-team-bleepity-bleep-edition-april-8-14-2013/http://massively.joystiq.com/2013/04/08/the-stream-team-bleepity-bleep-edition-april-8-14-2013/http://massively.joystiq.com/2013/04/08/the-stream-team-bleepity-bleep-edition-april-8-14-2013/#commentsFiled under: , , ,

The Stream Team Bleepity bleep edition, April 8 14, 2013

It's definitely not a new thing. Throughout the ages, when intense frustration strikes, a colorful epithet can slip past the lips of even the most soft-spoken. Heck, at particularly annoying times, a full string of them has been known fly forth from the most unexpected sources. And we all know that there are plenty of frustration-inducing situations in gaming. So it's not hard to equate swearing with gaming, right?

Of course, we at Massively TV advocate a responsible use of language during our adventures. While there could be a time or a place for the universally known curses, we prefer bursts of creative language skills. And if there's one thing The Stream Team has, it's an abundance of creativity! We've learned it is possible to express frustration while avoiding the censors because censors are mean and carry big, painful sticks! Ouch.

Need proof? Pop into any of the shows scheduled this week or the reruns from last; watch how deftly (or not) our intrepid streamers react to curse-creating incidents. Hope as they might, nothing can go smoothly all the time... or for the very unlucky, at all! A perfect demonstration of this is highlighted in our newest section, a place devoted to showcasing a stream of the week. Catch MJ's colorful repurposing of the English language first-hand in Highlight Reels, then offer your most creative expression in the Outtakes.

Continue reading The Stream Team: Bleepity bleep edition, April 8 - 14, 2013

MassivelyThe Stream Team: Bleepity bleep edition, April 8 - 14, 2013 originally appeared on Massively on Mon, 08 Apr 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2la-mystical-landactionaction-mmoactivisionage-of-wulinage-of-wushuaionanetarenanetarkark-hunterarkfallascensionasiabiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gameschampionschampions-onlinechampschinachinesechinese-mmococonquestconsoleconsolescrypticcryptic-studiosdc-universedc-universe-onlinedcuodefianceDinostormdotadota-2e-sporteaelectronic-artseq-2eq-iieq2eqiiesporteveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfrfree-realmsfree-to-playfuncomgpotatoguild-warsguild-wars-2gvggwgw2heroes-of-newerthhi-rezhi-rez-studioshistoricalhonhorrorinternet-spaceshipskid-friendlykidnappingkidskids-mmolindenlinden-lablivestreamlivestreaminglivestreamslucasartsmartial-artsmassively-metamassively-tvmetaming-dynastymmo-shootermobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftperfect-worldperfect-world-entertainmentplaystation-3playstation3pollps3pvppweraiderzreal-liferiftrift-literift-planes-of-telararvrs2s2-gamessandboxScarlet-Bladesci-fantasysci-fisecond-lifesecret-worldshooterskill-basedslSmitesnail-gamessnail-games-usasoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorsyfytanktanksthe-old-republicthe-secret-worldthe-stream-teamthird-person-shooterthree-faction-pvpthree-way-pvptortpstransmedia-synergytriontrion-worldstruly-freetswtvtwitchtwitch-tvVillagers-andheroesvirtual-worldvirtual-worldswarwarcraftwargaming.networld-of-tanksworld-of-warcraftwotwowwushuwuxiaxboxMon, 08 Apr 2013 09:00:00 EST<![CDATA[Chaos Theory: The wonderful world of sabotage in TSW]]>http://massively.joystiq.com/2013/04/01/chaos-theory-the-wonderful-world-of-sabotage-in-tsw/http://massively.joystiq.com/2013/04/01/chaos-theory-the-wonderful-world-of-sabotage-in-tsw/http://massively.joystiq.com/2013/04/01/chaos-theory-the-wonderful-world-of-sabotage-in-tsw/#commentsFiled under: , , , , ,

Chaos Theory
It's certainly no secret that I love The Secret World's investigation missions. I have mentioned it a time to two (times 20 or so) at different points in articles and livestreams alike. And that's not even counting how many times I regale my friends and family with my investigative exploits. Getting to use skills of the mind more than the fingers is not a regular occurrence in MMORPGs, but it darn well should be! It is a refreshing alternative to pew-pew all the time.

However, investigations aren't the only unique breed of missions I love in TSW. The game has a second kind that involves something other than just going out and showing off your prowess with a weapon. In fact, significant portions of these missions actually eschew the use of weapons entirely, and engaging in combat is a pretty big no-no when completing certain objectives. Welcome to sabotage missions.

Continue reading Chaos Theory: The wonderful world of sabotage in TSW

MassivelyChaos Theory: The wonderful world of sabotage in TSW originally appeared on Massively on Mon, 01 Apr 2013 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-faction3-factionsalternative-playstylesATCbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragonfactionfaction-pvpfantasyfeaturedfuncomhorrorilluminatimythologyopinionOrachi-GroupOrochiOrochi-Groupsabotage-missionssci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonMon, 01 Apr 2013 19:00:00 EST