Massively http://massively.joystiq.com Massively http://www.blogsmithmedia.com/http://massively.joystiq.com/media/feedlogo.gif Massively http://massively.joystiq.com en-us Copyright 2013 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[EVE Online redesigns radial menu for Odyssey]]>http://massively.joystiq.com/2013/05/21/eve-online-redesigns-radial-menu-for-odyssey/http://massively.joystiq.com/2013/05/21/eve-online-redesigns-radial-menu-for-odyssey/http://massively.joystiq.com/2013/05/21/eve-online-redesigns-radial-menu-for-odyssey/#commentsFiled under: , , , , , ,

EVE Online redesigns radial menu for OdysseyIn looking to trim down some of the menu bloat for EVE Online's Odyssey expansion, CCP Games is resurrecting and redesigning the radial menu to be a "silver bullet" for this issue.

The updated radial menu will be connected to the underutilized left mouse button and is confined to eight segments that will change depending on what the user is clicking. The studio wrote up a blog post on the subject, promising that the redesign is intuitive and will result in faster access to relevant commands.

Initially, the radial menu upgrade will be for ship flight only, although CCP is willing to expand its domain if players find it useful. This feature is currently available on the test server.

MassivelyEVE Online redesigns radial menu for Odyssey originally appeared on Massively on Tue, 21 May 2013 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesdev-blogdev-diaryeveeve-onlineinternet-spaceshipsmenumenusodysseyradial-menusandboxsci-fispreadsheets-onlineTue, 21 May 2013 15:30:00 EST<![CDATA[EVE Mobile is coming according to Jon Lander]]>http://massively.joystiq.com/2013/05/20/eve-mobile-is-coming-according-to-jon-lander/http://massively.joystiq.com/2013/05/20/eve-mobile-is-coming-according-to-jon-lander/http://massively.joystiq.com/2013/05/20/eve-mobile-is-coming-according-to-jon-lander/#commentsFiled under: , , , , , , ,

Now you can stand next to someone, blow up their ship on your phone, then punch them.
If you've ever been involved in a discussion about EVE Online, you've heard it referred to as a sequence of spreadsheets which occasionally let you fly a spaceship. Which certainly has some basis in truth. Certainly it's a game with many possible systems that could be ported to a mobile client, something that CCP's Jon Lander is claiming will be a reality in the near future. Lander has moved from being EVE's executive producer to mobile development, but his new position is clearly still tied to the same game.

Rather than simply being a series of spreadsheets for your smartphone, Lander has made it clear that the mobile team wants for the various EVE mobile apps to be functional games in their own right. It's a field that CCP has explored before, stopping either due to technical hurdles or business concerns. But Lander's confident that players will be using the mobile applications by the time next year's Fanfest rolls around.

MassivelyEVE Mobile is coming according to Jon Lander originally appeared on Massively on Mon, 20 May 2013 20:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gameseveeve-mobileeve-onlineinternet-spaceshipsjon-landermobilemobile-developmentsandboxsci-fispreadsheets-onlineMon, 20 May 2013 20:30:00 EST<![CDATA[The Stream Team: Monocle Day edition, May 20 - 26, 2013]]>http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/#commentsFiled under: , , ,

The Stream Team Monocle day edition, May 20 26, 2013
Two weeks ago, y'all had the chance to select a new holiday to help add some cheer to the otherwise bland weeks in the middle of May. The choices teased and tantalized you, but you're a discriminating crowd. In a race fraught with nail-biting suspense, only one ultimately prevailed. And so it is with further ado we bring to you: Monocle Day!

This Tuesday, May 21st, has been selected to be the auspicious day of this most storied celebration. Why? Because 5/21 splits into 5 + 2 + 1, which of course = 8, and we all know that 8 is just two monocles stacked on top of each other! And as always, Massively TV is here to help you ring in the new holiday, with special shows throughout the entire week. Check out the full schedule of celebratory events hosted by The Stream Team after the break. Then let us know if you'll be wearing your own monocle in honor of the festivities.

Continue reading The Stream Team: Monocle Day edition, May 20 - 26, 2013

MassivelyThe Stream Team: Monocle Day edition, May 20 - 26, 2013 originally appeared on Massively on Mon, 20 May 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>Achaeaaction-mmoactivisionagonanetAnno-Onlinearenanetaventurinebiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamescity-of-steamconsoleconsolescrypticcryptic-studiosdarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodfdndDotA-2dragonDragonrealmsdragonsdragons-propheteaelectronic-artselswordeq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfrfree-realmsfree-to-playfuncomgoblinguild-warsgwhi-rezhi-rez-studioshistoricalhorrorhousinginfernuminfernum-productionsinternet-spaceshipskid-friendlykidskids-mmolivestreamlivestreaminglivestreamslucasartsmassively-metamassively-tvmechanistmechanist-gamesmetamobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftneverwinteropen-pvpperfect-worldperfect-world-entertainmentplaneplanesplaystation-3playstation3pollps3pvppwerunewakerrunewaker-entertainmentsandboxsci-fantasysci-fisecret-worldskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicsteampunkstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorthe-old-republicthe-secret-worldthe-stream-teamthreshold-rpgtortswtwitchtwitch-tvunholy-warswarwarcraftwargaming.netwarplanewarplanesworld-of-warcraftworld-of-warplaneswowwowpMon, 20 May 2013 09:00:00 EST<![CDATA[EVE Evolved: Fanfest 2013 video roundup]]>http://massively.joystiq.com/2013/05/19/eve-evolved-fanfest-2013-video-roundup/http://massively.joystiq.com/2013/05/19/eve-evolved-fanfest-2013-video-roundup/http://massively.joystiq.com/2013/05/19/eve-evolved-fanfest-2013-video-roundup/#commentsFiled under: , , , , , , , , , , , , , , , , , , , , ,

EVE Evolved Fanfest 2013 video roundup
Last month saw the huge tenth anniversary EVE Online Fanfest, a three-day convention packed full of exclusive reveals, behind-the-scenes talks, and community events. This year's Fanfest was the biggest one yet, celebrating EVE's tenth anniversary with special guest speakers from the scientific community, the reveal of a new virtual reality dogfighter, DUST 514's launch, and details of the upcoming Odyssey expansion. Massively was there to bring you coverage of the big news as it happened, and CCP streamed some of the key talks and events live to viewers at home.

This year's Fanfest sold out so quickly that many people who wanted to go didn't get a chance to, and only a select few talks were shown on the public livestream. With such a packed event schedule, even players in attendance couldn't be there for every interesting talk. Thankfully, CCP recorded over 30 of the most anticipated events and has now uploaded the videos to YouTube. Highlights include the Make EVE Real videos, the EVE keynote, the CCP Presents Keynote, and the talks on how DUST 514 integrates with the EVE economy.

In this week's EVE Evolved, I round up all of the EVE Fanfest videos in a handy list.

Continue reading EVE Evolved: Fanfest 2013 video roundup

MassivelyEVE Evolved: Fanfest 2013 video roundup originally appeared on Massively on Sun, 19 May 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alliance-panelapocalypseasteroidasteroid-miningasteroidsbattleshipccpccp-gameschinaconcept-artconsoleconventioncrimewatchcsm-paneldustdust-514economyeveeve-evolvedeve-fanfesteve-fanfest-2013eve-is-realeve-onlineeventeventsfanfestfaster-than-lightfeaturedfpsftlgame-designgearinternet-spaceshipskeynotemake-eve-realminingmmofpsodysseyopinionplanetary-conquestplaystationplaystation-3progressionps3pvpsandboxsci-fishooterspace-elevatorspreadsheets-onlineuprisingSun, 19 May 2013 18:00:00 EST<![CDATA[One Shots: The many lives of Gwen Thackeray]]>http://massively.joystiq.com/2013/05/19/one-shots-the-many-lives-of-gwen-thackeray/http://massively.joystiq.com/2013/05/19/one-shots-the-many-lives-of-gwen-thackeray/http://massively.joystiq.com/2013/05/19/one-shots-the-many-lives-of-gwen-thackeray/#commentsFiled under: , , , , , ,

One Shots Looming death
Hey Gwen, how's it hanging? Find that flute yet? Yeah, don't worry, I'm sure it'll turn up around here somewhere. Don't get too near the river there, girl; those skale have a nasty bite! Say, what's that sulfurous smell in the air? And those distant screams that are drawing nearer at an incredible rate? And a sudden looming premonition that the property values around here are about to take a nosedive?

Reader Sharvis sent in this Guild Wars picture with a modicum of pity: "Here is Gwen moments before the Searing. Poor girl."

Don't feel too sorry for her, Sharvis! She gets an entire expansion, after all!

Continue reading One Shots: The many lives of Gwen Thackeray

MassivelyOne Shots: The many lives of Gwen Thackeray originally appeared on Massively on Sun, 19 May 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>activisionanetarenanetblizzardblizzard-entertainmentbring-back-one-shotsbuy-to-playccpccp-gameseveeve-onlinefantasygalleriesgalleryguild-warsguild-wars-2gwgw2internet-spaceshipsncsoftone-shotspics-or-it-didnt-happenreader-screenshotsreader-submissionssandboxsci-fiscreenshotscreenshotsspreadsheets-onlineuser-submissionswarcraftworld-of-warcraftwowSun, 19 May 2013 10:00:00 EST<![CDATA[EVE Online seeks tourney commentators, plans dual character training for Odyssey]]>http://massively.joystiq.com/2013/05/15/eve-onlines-11th-alliance-tourney-makes-changes-needs-commenta/http://massively.joystiq.com/2013/05/15/eve-onlines-11th-alliance-tourney-makes-changes-needs-commenta/http://massively.joystiq.com/2013/05/15/eve-onlines-11th-alliance-tourney-makes-changes-needs-commenta/#commentsFiled under: , , , ,

EVE Online's 11th Alliance tourney makes changes, needs commentators
Want to be a part of EVE Online's 11th annual Alliance Tournament that starts on July 20th, 2013, but not from the cockpit of your ship? You can apply to be one of the PvP commentators who will discuss the tourney, tactics, and teams involved live on air with developers as well as providing commentary on matches as they unfold. Yes, live means you'll actually be in Iceland for this gig! Qualifications include having a valid passport, being over 21, having a sharp wit, and being well-versed in PvP. Full details for the application process are available on the official site.

If you'd prefer to participate in the battles themselves, note that there will be a few changes to the tourney from years past. To start, Alliance Tournament XI will run over only three weekends, not four. Second, qualifying rounds and group stages have been replaced by double elimination from the get go. Next, from the second weekend onward, two ship types will be banned from the match by team captains. And finally, to fly with an alliance you had to have been a member since downtime this morning. Dev blogs covering all the rules, the broadcast schedule, and sign-up details will be coming soon.

[Update: CCP has been busy today! The official site has now also been updated with a dev blog announcing that dual character training will ship with the Odyssey expansion next month.]

MassivelyEVE Online seeks tourney commentators, plans dual character training for Odyssey originally appeared on Massively on Wed, 15 May 2013 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alliance-tournamentAlliance-Tournament-XIccpccp-gamescommentatorseveeve-alliance-tournamenteve-onlineinternet-spaceshipsPvPsandboxsci-fispreadsheets-onlineWed, 15 May 2013 12:00:00 EST<![CDATA[Massively's DUST 514 launch impressions]]>http://massively.joystiq.com/2013/05/15/massivelys-dust-514-launch-impressions/http://massively.joystiq.com/2013/05/15/massivelys-dust-514-launch-impressions/http://massively.joystiq.com/2013/05/15/massivelys-dust-514-launch-impressions/#commentsFiled under: , , , , , , , , , , , , ,

DUST 514 - Dropship and merc troops
Playing EVE on my couch is bizarre. I know, technically it's called DUST 514, but let's be serious. DUST is basically the beginnings of a massive EVE Online expansion if you subscribe to the notion that EVE is a virtual world as opposed to merely a strategy game featuring internet spaceships and internet drama.

I've played EVE in some strange places prior to this. In an airport terminal, for example. On my toilet, even (yes, nature occasionally calls in the middle of a fleet fight and thank God for laptops). But DUST marks the first -- OK, technically the second -- time I've ever played in New Eden with a controller.

Continue reading Massively's DUST 514 launch impressions

MassivelyMassively's DUST 514 launch impressions originally appeared on Massively on Wed, 15 May 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesconsoleconsolesdustdust-514dust-514-impressionsdust-514-reviewdust-hands-ondust-impressionsdust-revieweveeve-onlinefeaturedfpsinternet-spaceshipsmmofpspc-master-raceplaystationplaystation-3ps3sandboxsci-fishooterspreadsheets-onlineWed, 15 May 2013 11:00:00 EST<![CDATA[Newbie tips to surviving the DUST 514 experience]]>http://massively.joystiq.com/2013/05/14/newbie-tips-to-surviving-the-dust-514-experience/http://massively.joystiq.com/2013/05/14/newbie-tips-to-surviving-the-dust-514-experience/http://massively.joystiq.com/2013/05/14/newbie-tips-to-surviving-the-dust-514-experience/#commentsFiled under: , , , , ,

Newbie tips to surviving the DUST 514 experience
It's DUST 514's launch day, and if you've hit dirt with your face more than your combat boots, then you might need a helping hand with CCP's MMO shooter. PlayStation Universe has posted a pair of guides to help new players get off to a strong start, and since Massively cares about each and every one of you, we wanted to pass them along so that you don't end up a shallow grave on an alien world.

The first guide is a hodge-podge of beginner's tips, and the second has to do with earning much-needed skill points. "In the early days, we think it's wise to hoard ISK and SP until a time when you're ready to decide on your specialization," the author writes. "Until then, the Militia Gear is good enough."

Good luck, soldiers! If you have any DUST 514 tips or tricks that you'd like to pass along to other Massively readers, please do so in the comments.

MassivelyNewbie tips to surviving the DUST 514 experience originally appeared on Massively on Tue, 14 May 2013 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>beginners-guideccpccp-gamesconsoledustdust-514eveeve-onlinefpsguideguideshintslaunchmmofpsplaystationplaystation-3ps3releasesandboxsci-fishooterskill-pointssptipstricksTue, 14 May 2013 15:30:00 EST<![CDATA[DUST 514 launch-day roundup]]>http://massively.joystiq.com/2013/05/14/dust-514-launch-day-roundup/http://massively.joystiq.com/2013/05/14/dust-514-launch-day-roundup/http://massively.joystiq.com/2013/05/14/dust-514-launch-day-roundup/#commentsFiled under: , , , , , ,

Dust 514 launchday roundup
This is it, soldier! Training is over, and it's time to head out to war. DUST 514 settles today, officially launching into the New Eden universe also occupied by EVE Online. Available only on the PlayStation 3, this shooter pits forces against each other in a ground assault while orbital strikes rain down from EVE allies and enemies above. Are you ready?

Ah, trapped behind a desk for a while still, are you? Well, don't worry; if you won't have the opportunity to soothe your itchy trigger finger until later, we've got some things to tide you over until you can join the fray yourself. Check out the factional warfare, learn about rewards, and much more in the hands-on experiences, screenshots, videos, news, and impressions after the break.

Continue reading DUST 514 launch-day roundup

MassivelyDUST 514 launch-day roundup originally appeared on Massively on Tue, 14 May 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesconsoledustdust-514eveeve-onlinefpslaunchlaunch-day-round-upmmofpsplaystationplaystation-3ps3round-upsandboxsci-fishooterTue, 14 May 2013 10:00:00 EST<![CDATA[Roguelikes inspire EVE Online's revamped hacking minigame]]>http://massively.joystiq.com/2013/05/13/roguelikes-inspire-eve-onlines-revamped-hacking-minigame/http://massively.joystiq.com/2013/05/13/roguelikes-inspire-eve-onlines-revamped-hacking-minigame/http://massively.joystiq.com/2013/05/13/roguelikes-inspire-eve-onlines-revamped-hacking-minigame/#commentsFiled under: , , , , , , ,

EVE Online hacking screen
June 4th is coming up fast, and with it EVE Online's new Odyssey expansion. The content drop will feature improved explorer pursuits, with particular emphasis on removing the "'sit and wait' aspect of exploration gameplay" in favor of "something interesting to do."

In the case of today's dev blog, the interesting thing to do is hacking, and CCP says that it drew inspiration from roguelikes for the new minigame's "procedurally generated levels, turn-based combat, and permadeath." You can read all about it on the official EVE Online website.

MassivelyRoguelikes inspire EVE Online's revamped hacking minigame originally appeared on Massively on Mon, 13 May 2013 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesdev-blogeveeve-expansioneve-hackingeve-onlineeve-online-odysseyexpansiongame-mechanicshackinginternet-spaceshipsminigamesodysseysandboxsci-fispreadsheets-onlineMon, 13 May 2013 17:30:00 EST<![CDATA[The Stream Team: MLT edition, May 13 - 19, 2013]]>http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/#commentsFiled under: , , ,

The Stream Team May 13 19, 2013
Nothing beats an MLT, especially when the tomato is nice and ripe! Except maybe Massively TV. MMmm mmmm. Now there's something you can really sink your teeth into -- the wild and crazy antics of your favorite Stream Team hosts! And they've got a menu for all tastes this week, from space adventures to dragons to WWII planes. Of course, it all comes with a side of reruns and a dessert highlight to complete your meal.

So pull up a chair and grab yourself a helping or two... or 10. Hey, there's no limit here; enjoy as much as you like! While you're enjoying the spread, be sure to join in the after-dinner chat in Outtakes.

Continue reading The Stream Team: MLT edition, May 13 - 19, 2013

MassivelyThe Stream Team: MLT edition, May 13 - 19, 2013 originally appeared on Massively on Mon, 13 May 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmoactivisionage-of-conanage-of-conan-unchainedagonanetaocaoc-unchainedarenanetarkark-hunterarkfallaventurinebiowareblizzardblizzard-entertainmentbuy-to-playccpccp-gamescity-of-steamconanconsoleconsolescrypticcryptic-studiosdarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodefiancedfdnddota-2Dragonrealmseaelectronic-artselswordeq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfree-to-playfuncomgoblinguild-warsgwhi-rezhi-rez-studioshistoricalhorrorhyboriainternet-spaceshipslivestreamlivestreaminglivestreamslucasartsmabinogimassively-metamassively-tvmechmechanistmechanist-gamesmechsmechwarriormechwarrior-mmomechwarrior-onlinemetammo-shootermobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmwomythologyncsoftneverwinternexonnexon-americaopen-pvpperfect-worldperfect-world-entertainmentpiranhapiranha-gamesplaneplanesplaystation-3playstation3pollps3pvppwesandboxsci-fantasysci-fisecret-worldshooterskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicsteampunkstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorsyfythe-old-republicthe-secret-worldthe-stream-teamthird-person-shootertortpstransmedia-synergytriontrion-worldstswtvtwitchtwitch-tvunchainedunholy-warswarwarcraftwargaming.netwarplanewarplanesworld-of-warcraftworld-of-warplaneswowwowpxboxMon, 13 May 2013 09:00:00 EST<![CDATA[EVE Evolved: Could EVE use twitch controls?]]>http://massively.joystiq.com/2013/05/12/eve-evolved-could-eve-use-twitch-controls/http://massively.joystiq.com/2013/05/12/eve-evolved-could-eve-use-twitch-controls/http://massively.joystiq.com/2013/05/12/eve-evolved-could-eve-use-twitch-controls/#commentsFiled under: , , , , , , , ,

EVE Evolved Could EVE use twitch controls
A few weeks ago, the EVE Online community went nuts for EVR, CCP's exciting new virtual reality dogfighter developed for the upcoming Oculus Rift gaming headset. The game demo was produced by a team of just a handful of developers in just seven weeks using nothing but their spare time, but attendees and press at EVE Fanfest 2013 were nevertheless blown away during test sessions. Though EVR isn't going to be integrated with the EVE universe, Senior Producer Andie Nordgren stated in her Keynote address that CCP will be looking into more immersive flight and combat mechanics for some the game's ships. This comment has sparked a lot of discussion over the possibility of finally getting some direct flight controls in EVE.

The lack of direct twitch-based controls in EVE is often cited by gamers as a big part of the reason they can't get into the game. There's no active dodging of missiles, manual ship targeting, or really complex tactical maneuvers in EVE, but that's kind of the point. Most ships in EVE are colossal lumbering hulks more akin to today's seafaring battleships than fighter planes, and combat with them is more a game of strategy and teamwork than a battle of reaction speeds. But that isn't exactly true of all ships; interceptors and fast microwarpdrive frigates move at several kilometres per second and are so agile that pilots can already pull off some interesting tactical maneuvers. So isn't it about time we made the combat for those ships a bit more visceral and immersive?

In this week's EVE Evolved, I look at the fast-paced world of interceptors and explore how twitch controls and weapon aiming could possibly be implemented without killing the server.

Continue reading EVE Evolved: Could EVE use twitch controls?

MassivelyEVE Evolved: Could EVE use twitch controls? originally appeared on Massively on Sun, 12 May 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>Andie-Nordgrenccpccp-gamescontrolcontrolsdirectdirect-controlsdirect-flightDogfighterDogFightingevasiveeveeve-evolvedeve-onlinefeaturedfrigateinterceptorinterceptorsmaneuvermanoeuvermanualopinionopinion-piecepilotpvpsandboxsci-fispeedtwitchtwitch-combattwitch-controlsvectorzig-zagSun, 12 May 2013 18:00:00 EST<![CDATA[Not So Massively: MOBA patch week, Star Citizen hits $9 million, and Diablo II ladder reset]]>http://massively.joystiq.com/2013/05/06/not-so-massively-moba-patch-week-star-citizen-hits-9-million/http://massively.joystiq.com/2013/05/06/not-so-massively-moba-patch-week-star-citizen-hits-9-million/http://massively.joystiq.com/2013/05/06/not-so-massively-moba-patch-week-star-citizen-hits-9-million/#commentsFiled under: , , , , , , , , , , , , , , , , , , , ,

Not So Massively MOBA patch week, Star Citizen hits $9 million, and Diablo II ladder reset
This week is packed with MOBA news as almost every major title released a new patch. Infinite Crisis introduced new champions Poison Ivy and Gaslight Catwoman and announced that the game's closed beta will start in two days' time on May 8th. SMITE introduced new Norse god Fenrir the Unbound, and League of Legends released a champion spotlight on new Ice Witch champion Lissandra. Dota 2 also released new hero Elder Titan based on the original DotA hero Tauren Chieftain, and Heroes of Newerth released several months of balance changes at once in its colossal version 3.1 update.

Star Citizen celebrated hitting $9 million US in its ongoing crowdfunding campaign, and to celebrate, developers controversially gave all current backers free lifetime insurance on their ships. The title's success has also spurred EVE Online developer CCP Games to show off its own virtual reality dogfighter called EVR that uses the upcoming Oculus Rift headset.

Diablo III's first anniversary is just over a week away; details of any celebrations haven't yet been released. Developers confirmed that the PlayStation 4 version will not be getting mouse and keyboard support and that the PC version won't be getting support for analog controllers. For those of you up for some oldschool dungeon-crawling, Diablo II also announced that its ladder will be reset on May 14th this week and all players will start the game fresh again.

Continue reading Not So Massively: MOBA patch week, Star Citizen hits $9 million, and Diablo II ladder reset

MassivelyNot So Massively: MOBA patch week, Star Citizen hits $9 million, and Diablo II ladder reset originally appeared on Massively on Mon, 06 May 2013 22:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-rpgbattlenetbetabeta-testbeta-testingblizzardblizzard-entertainmentcash-shopccpccp-gameschris-robertscompetitive-gamingconsoled3defense-of-the-ancientsdiablodiablo-2diablo-3diablo-iidiablo-iiidotae-sporte-sportselder-titanesportesportseveeve-onlineevrexploitf2pfantasyfeaturedfree-to-playfreemiumgothic-fantasyhon-tourhontourice-witchinternet-spaceshipsladderladder-resetleagueleague-of-legendslissandralolmicrotransactionmicrotransactionsmobamultiplayernewsnot-so-massivelynsmoculus-riftonline-multiplayeropinionpatch-1.0.8playstationplaystation-3playstation-4Playstation3premiumps4pvpriotriot-gamesroguelikeround-uprounduprpgsandboxsci-fispreadsheets-onlinetauren-chieftaintestingtrailertrailersvideovideosvirtual-realitywitch-doctorMon, 06 May 2013 22:00:00 EST<![CDATA[DUST 514's Uprising update is now live]]>http://massively.joystiq.com/2013/05/06/dust-514s-uprising-update-is-now-live/http://massively.joystiq.com/2013/05/06/dust-514s-uprising-update-is-now-live/http://massively.joystiq.com/2013/05/06/dust-514s-uprising-update-is-now-live/#commentsFiled under: , , , , , , ,

Screenshot -- DUST 514
The official launch of DUST 514 is planned to go live later this month on -- what else -- May 14th. But judging by the latest CCP dev blog, players can expect a whole bevy of new features before the game launches thanks to an update by the name of Uprising which, as it happens, went live today. For starters, the skill system is getting totally revamped in order to "make it more intuitive and deep." CCP is also introducing three new dropsuits to the game, along with a new assault dropship. As if that weren't enough, the studio has "done major rebalancing on weapons, dropsuits, modules, and vehicles." In light of all of these changes, players will be receiving full skill respecs and market refunds. Uprising will also include the addition of the new starmap, new UI and graphics features, and adjustments to the faction warfare system.

But that's not all. When the game officially goes live on the 14th, CCP will introduce DUST's planetary conquest system, which means that DUST players will be able to take part in the great territorial control battles that will tie the game into EVE Online. The launch will also bring a few new weapons and a new game mode (Domination) and new maps over which players can vie for supremacy. If that's not enough to look forward to, then we're not sure what to tell you. For the full details on Uprising and DUST 514's official launch, go on and check out the full dev blog on the game's official site.

MassivelyDUST 514's Uprising update is now live originally appeared on Massively on Mon, 06 May 2013 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesconsoledustdust-514eveeve-onlinefpsmmofpspatchpatchesplaystationplaystation-3ps3sandboxsci-fishooteruprisingMon, 06 May 2013 20:00:00 EST<![CDATA[EVE Online smashes PCU record during anniversary celebrations]]>http://massively.joystiq.com/2013/05/06/eve-online-smashes-pcu-record-during-anniversary-celebrations/http://massively.joystiq.com/2013/05/06/eve-online-smashes-pcu-record-during-anniversary-celebrations/http://massively.joystiq.com/2013/05/06/eve-online-smashes-pcu-record-during-anniversary-celebrations/#commentsFiled under: , , , , , , , , , , , , ,

EVE Online smashes PCU record during anniversary celebrations
Sci-fi MMO EVE Online has seen phenomenal success recently, from breaking through the 500,000 subscriber boundary to successfully relaunching in China. The game officially turned ten years old today, and CCP celebrated the occasion with events and gifts for all current subcribers. The part-jovian Gnosis battlecruiser was given to every subscribed account at midnight last night and can be claimed before the end of the month, and players logging in yesterday or today will have found a whole slew of bonus gifts.

EVE smashed its previous Peak Concurrent User total during the festivities by a clear margin, replacing 2011's record of 63,170 with a new figure of 65,303 players logged in simultaneously. Part of the reason for the record was the huge number of player-run events taking place that evening, such as the ever-popular Flight of a Thousand Rifters. The event saw almost 2,500 players join together to take down player Marlona Sky's expensive supercarrier. Most of the participants were in small frigates like Rifters and ended up being easy prey when a nullsec sniper Loki fleet turned up. The event was nevertheless a massive success and huge fun for those involved. Continue reading for a gallery of screenshots from the event and video footage from player Scott Manley.

Continue reading EVE Online smashes PCU record during anniversary celebrations

MassivelyEVE Online smashes PCU record during anniversary celebrations originally appeared on Massively on Mon, 06 May 2013 13:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>anniversaryccpccp-gamesemergent-gameplayeveeve-onlineflight-of-a-thousand-riftersgnosisinternet-spaceshipsmarlona-skypvprifterrifterssandboxsci-fiscott-manleyspreadsheets-onlineten-year-anniversaryten-yearsthousand-riftersMon, 06 May 2013 13:30:00 EST<![CDATA[The Stream Team: Seis de Mayo edition, May 6 - 12, 2013]]>http://massively.joystiq.com/2013/05/06/the-stream-team-seis-de-mayo-edition-may-6-12-2013/http://massively.joystiq.com/2013/05/06/the-stream-team-seis-de-mayo-edition-may-6-12-2013/http://massively.joystiq.com/2013/05/06/the-stream-team-seis-de-mayo-edition-may-6-12-2013/#commentsFiled under: , , ,

The Stream Team Seis de Mayo edition, May 6 12, 2013
You have to agree, May is one month that's full of holidays. The first week alone contains May Day, (unofficial) Star Wars Day, and Cinco de Mayo. But the party doesn't stop there! Following quickly on the heels of these is perhaps one you are less familiar with: Seis de Mayo.

Not unlike its cousin the day before, Seis de Mayo is a day of celebration; however, this celebration centers on freedom from boredom via visual entertainment. No, really! And to commemorate the day, we're releasing an all-new Massively TV schedule, giving you the means to celebrate the whole week through with The Stream Team. If you can't celebrate live, just tune into a rerun and party whenever.

Well, even if you don't believe us, you can still commemorate the occasion with us. Just check out the past the cut for a heaping helping of daily festivities.

Continue reading The Stream Team: Seis de Mayo edition, May 6 - 12, 2013

MassivelyThe Stream Team: Seis de Mayo edition, May 6 - 12, 2013 originally appeared on Massively on Mon, 06 May 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmoactivisionage-of-conanage-of-conan-unchainedagonaionanetaocaoc-unchainedarenanetarkark-hunterarkfallascensionaventurinebiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamesclone-warsclone-wars-adventuresconanconsoleconsolescrypticcryptic-studioscwadarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodefiancedfdnddota-2dragondragonsdragons-propheteaelectronic-artseq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfamilyfantasyfeaturedfpsfree-to-playfuncomguild-warsguild-wars-2gwgw2heroes-and-generalshi-rezhi-rez-studioshousinghyboriainfernuminfernum-productionsinternet-spaceshipskid-friendlykidskids-mmokingsislekingsisle-entertainmentlivestreamlivestreaminglivestreamslobbylucasartsmabinogimassively-metamassively-tvmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemetaminigamemmo-shootermmofpsmobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmwoncsoftneverwinternexonnexon-americaopen-pvpperfect-worldperfect-world-entertainmentpiranhapiranha-gamesplanetsideplanetside-2playstation-3playstation3pollps2ps3pvppwerunewakerrunewaker-entertainmentsandboxsci-fantasysci-fishooterSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsuperherosuperheroesswtorsyfythe-old-republicthe-stream-teamthird-person-shootertorTorchlight-2torchlight-iitpstransmedia-synergytriontrion-worldstruly-freetvtwitchtwitch-tvunchainedunholy-warswarcraftwarmage-battlegroundswizard101world-of-warcraftwowxboxMon, 06 May 2013 09:00:00 EST<![CDATA[EVE Evolved: Ten years of EVE Online]]>http://massively.joystiq.com/2013/05/05/eve-evolved-ten-years-of-eve-online/http://massively.joystiq.com/2013/05/05/eve-evolved-ten-years-of-eve-online/http://massively.joystiq.com/2013/05/05/eve-evolved-ten-years-of-eve-online/#commentsFiled under: , , , , , , , , , , , , , , , , , , , , , , , ,

EVE Evolved Ten years of EVE Online
Tomorrow marks a huge milestone in MMO history as sci-fi sandbox EVE Online officially turns ten years old. Released by a tiny icelandic development studio whose only previous release was a board game featuring Reykjavik's favourite cross-dressing mayor, EVE has slowly grown over the past decade to become one of the industry's biggest and most stable subscription titles. Following 2011's monoclegate scandal that led to around 8% of players quitting and CCP Games shedding 20% of its employees, this year saw EVE Online climb to new heights as it regained the playerbase's confidence and smashed the 500,000 subscriber barrier. As a special side-note, the EVE Evolved column also turned five years old last week; it has now officially been running for over half of EVE's lifetime.

The past year has been remarkably successful for CCP, with both of the year's EVE expansions being extremely well received and console MMOFPS DUST 514 finally starting to take shape. The Inferno and Retribution expansions fixed a staggering number of small issues that were broken in the game while also making big changes to bounty-hunting, piracy, and PvP across the board. We also saw huge emergent events like the Battle of Asakai, a $6,000 ship kill, and the five trillion ISK faction warfare exploit this year. With DUST 514 officially launching in just over a week on May 14th and players fired up about the upcoming Odyssey expansion, the future's looking bright for EVE Online as it heads into its second decade.

In this week's EVE Evolved, I look back at some of year's top EVE stories, stories that touched real life, and what the future holds for EVE's second decade.

Continue reading EVE Evolved: Ten years of EVE Online

MassivelyEVE Evolved: Ten years of EVE Online originally appeared on Massively on Sun, 05 May 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>6000-dollarsanniversaryanniversary-eventbounty-huntingcapsuleerccpccp-gamesconsolecrimewatchcynocyno-vigildeaddeathdecadedustdust-514eveeve-evolvedeve-fanfesteve-fanfest-2013eve-onlineeve-sourceexpansionexpansionsexploitfaction-warfarefanfestfeaturedfpsinfernointernet-spaceshipsinterviewinterviewskillkillmailkillmailslibyammofpsnuke-them-from-orbitodysseyopinionpiracyplaystationplaystation-3ps3pvpretributionsafetysandboxsci-fisean-smithsecond-decadeship-killshooterspreadsheets-onlineten-year-anniversaryten-yearsten-years-oldthe-second-decadetrailervideovigilvile-ratweapon-safetySun, 05 May 2013 18:00:00 EST<![CDATA[EVE Online celebrates 10 years of smuggling, intrigue, and the magic of teamwork]]>http://massively.joystiq.com/2013/05/03/eve-online-celebrates-10-years-of-smuggling-intrigue-and-the-m/http://massively.joystiq.com/2013/05/03/eve-online-celebrates-10-years-of-smuggling-intrigue-and-the-m/http://massively.joystiq.com/2013/05/03/eve-online-celebrates-10-years-of-smuggling-intrigue-and-the-m/#commentsFiled under: , , , , , ,

EVE
There ain't no party like an EVE Online 10-year anniversary party because an EVE Online 10-year anniversary party uses Facebook "likes" to unlock in-game gifts and fireworks.

No, really.

Every "like" that EVE Online's Facebook page receives will help unlock free gifts for players and hourly firework drops. The gifts will be handed out after downtime on Sunday the 5th of May. There will also be an attempt to break the current PCU record, so the park your accounts and enjoy the display. To keep you entertained, there will be two "Hunt a Dev" roams, prizes, and oodles of player events. You can check out all the details on the official page.

MassivelyEVE Online celebrates 10 years of smuggling, intrigue, and the magic of teamwork originally appeared on Massively on Fri, 03 May 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>10-year-anniversaryanniversaryccpccp-gameseveeve-onlineinternet-spaceshipssandboxsci-fispreadsheets-onlineFri, 03 May 2013 15:00:00 EST<![CDATA[EVE Online introduces a new way to raise your security status]]>http://massively.joystiq.com/2013/05/02/eve-online-introduces-a-new-way-to-raise-your-security-status/http://massively.joystiq.com/2013/05/02/eve-online-introduces-a-new-way-to-raise-your-security-status/http://massively.joystiq.com/2013/05/02/eve-online-introduces-a-new-way-to-raise-your-security-status/#commentsFiled under: , , , , , ,

EVE Online introduces pirate NPCs and a new way to raise your security status
EVE Online players will soon have a new method by which to raise their security status: New pirate NPCs are being added to asteroid belts in low-security space. Upon death, these pirates drop a new sort of pirate tag, which can be taken into low-sec CONCORD stations and turned in at the Security Office to raise a character's security status.

It should be noted that this is a viable method only for raising your security status up to zero. To get a positive status, you'll need to go through more traditional methods. Additionally, the tags can be traded on the market like most goods, giving players different ways to acquire them.

You can check out all the details on the dev blog.

MassivelyEVE Online introduces a new way to raise your security status originally appeared on Massively on Thu, 02 May 2013 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gameseveeve-onlineinternet-spaceshipssandboxsci-fispreadsheets-onlineThu, 02 May 2013 15:30:00 EST<![CDATA[MMO sandbox TUG launches its Kickstarter]]>http://massively.joystiq.com/2013/05/01/mmo-sandbox-tug-launches-its-kickstarter/http://massively.joystiq.com/2013/05/01/mmo-sandbox-tug-launches-its-kickstarter/http://massively.joystiq.com/2013/05/01/mmo-sandbox-tug-launches-its-kickstarter/#commentsFiled under: , , , , , , , , , , , ,

MMO sandbox TUG launches on Kickstarter
If you're the sort of sandbox aficionado who's more into crafting and exploration than griefing, then this post is for you. Brand-new to Kickstarter today is an MMO called, well, The Untitled Game, or TUG for short. Inspired by the likes of Minecraft, Zelda, and EVE Online, TUG promises an immersion-driven, "massive procedurally generated world to explore" along with such features as combat, crafting, building, an organic UI, modding tools, hidden civilizations, animal taming, "logic engineering," day/season cycles, realistic weights, support for roleplayers, and no DRM. Like rival Shroud of the Avatar, TUG will be playable solo, on a private server, and on the official MMO server.

Developer Nerd Kingdom styles itself as "a collective of scientists, researchers, technologists, economists, content creators, artists, modders, and gamers from a variety of disciplines and backgrounds" with a "deep passion for the nerdery of academic sciences, art, and technology," but in spite of its academic background, the studio promises a survival sandbox/multiplayer RPG hybrid without all the associated spreadsheets and number-crunching.

The game is targeting 2015 for launch with an alpha this coming July; the digital download edition of the game can be secured for as little as 10 bucks on Kickstarter now. See whether the videos behind the break don't convince you.

Continue reading MMO sandbox TUG launches its Kickstarter

MassivelyMMO sandbox TUG launches its Kickstarter originally appeared on Massively on Wed, 01 May 2013 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>craftingcrowdfundingeve-onlinekickstarterminecraftnerd-kingdomprocedural-generationprocedurally-generatedsandboxthe-untitled-gametrailertrailerstugvideovideosWed, 01 May 2013 17:00:00 EST<![CDATA[MMO Week in Review: EVE Fanfest 2013]]>http://massively.joystiq.com/2013/04/28/mmo-week-in-review-eve-fanfest-2013/http://massively.joystiq.com/2013/04/28/mmo-week-in-review-eve-fanfest-2013/http://massively.joystiq.com/2013/04/28/mmo-week-in-review-eve-fanfest-2013/#commentsFiled under: , , ,

EVE Fanfest
At the end of every week, we round up the best and most popular news stories, exclusive features, and insightful columns published on Massively and then present them all in one convenient place. If you missed a big MMO or WoW Insider story last week, you've come to the right post.

Every spring for the last 10 years, EVE Online fans from around the globe have journeyed to their MMO Mecca in Reykjavik, Iceland, for EVE Fanfest. This year, Massively's Brendan Drain attended the event to report not just on EVE but on CCP's other inbound titles, console shooter DUST 514 and vampire sandbox World of Darkness. From Brendan, we heard about EVE's virtual reality demo and revamp plans, DUST's launch date, EVE's anniversary collector's edition and TV series, and of course, World of Darkness' early development.

Read on for a peek at the rest of this week's top MMO stories.

Continue reading MMO Week in Review: EVE Fanfest 2013

MassivelyMMO Week in Review: EVE Fanfest 2013 originally appeared on Massively on Sun, 28 Apr 2013 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>eveeve-fanfesteve-fanfest-2013eve-onlineeve-online-fanfesteve-online-fanfest-2013eventevent-coveragefanfestfeaturedicelandjoystiqmassively-event-coveragemassively-metametareykjavikrounduptop-storiesweek-in-reviewweekly-recapweekly-roundupwow-insiderSun, 28 Apr 2013 20:00:00 EST<![CDATA[EVE Online's 8th Council of Stellar Management members announced]]>http://massively.joystiq.com/2013/04/28/eve-onlines-8th-council-of-stellar-management-members-announced/http://massively.joystiq.com/2013/04/28/eve-onlines-8th-council-of-stellar-management-members-announced/http://massively.joystiq.com/2013/04/28/eve-onlines-8th-council-of-stellar-management-members-announced/#commentsFiled under: , , , , ,

EVE Online's 8th Council of Stellar Management members announced
The results are in for EVE Online's eighth Council of Stellar Management (CSM8) as announced by Hilmar Veigar Pétursson during EVE Fanfest this weekend in Reykjavik, Iceland.

Since this is the first time the Single Transferrable Vote mechanic has been used, each elected member received the necessary amount of votes (out of a total 49,702 votes) to get onto the CSM. When the council convenes for the first time, a chairman, vice-chairman, secretary, and vice-secretary will be chosen.

Be sure to read the complete election results for the names of all 14 CSM8 members and more on how the votes were calculated this year.

MassivelyEVE Online's 8th Council of Stellar Management members announced originally appeared on Massively on Sun, 28 Apr 2013 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>council-of-stellar-managementcsmcsm8eveeve-fanfesteve-fanfest-2013eve-onlineeve-online-fanfesteve-online-fanfest-2013eventevent-coveragefanfesticelandmassively-event-coveragereykjavikSun, 28 Apr 2013 19:00:00 EST<![CDATA[EVE Evolved: Hands-on with EVE's virtual reality demo]]>http://massively.joystiq.com/2013/04/28/eve-evolved-hands-on-with-eves-virtual-reality-demo/http://massively.joystiq.com/2013/04/28/eve-evolved-hands-on-with-eves-virtual-reality-demo/http://massively.joystiq.com/2013/04/28/eve-evolved-hands-on-with-eves-virtual-reality-demo/#commentsFiled under: , , , , , , , , , , , , , , , , , ,

EVE Evolved Handson with EVE's virtual reality demo
As EVE Online's tenth anniversary Fanfest slowly got underway, the press were led into a small upstairs room with chairs lined up and ominous-looking black headsets. The headsets turned out to be expensive prototype devkits of the Oculus Rift, a recently kickstarted PC peripheral that aims to make immersive virtual reality affordable for gamers. VR headsets are traditionally heavy monstrosities costing thousands of pounds and usually have input processing lag that make them unsuitable for high-action gaming, but the Oculus Rift is a light and highly responsive device currently clocking in at a more reasonable $300.

We were sat down to take part in a demo of EVR, a new virtual reality multiplayer dogfighter that uses art assets from EVE Online. It was an incredibly immersive experience for those of us unfamiliar with the Oculus Rift, and even members of the press who had used the device seemed impressed with the game. Fanfest attendees were equally excited when a trailer for EVR was shown at the EVE Keynote on Friday, and many attendees got to try the game first hand last night. But what impressed me the most was the story behind the demo's creation and the possibilities that Oculus Rift could potentially open up if support for it were brought to EVE Online.

In this week's EVE Evolved, I give my hands-on impressions of EVR, delve into the story behind its creation, and speculate on how Oculus Rift support could revolutionise EVE.

Continue reading EVE Evolved: Hands-on with EVE's virtual reality demo

MassivelyEVE Evolved: Hands-on with EVE's virtual reality demo originally appeared on Massively on Sun, 28 Apr 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>20-percent20-percent-time20-timedogfightingeveeve-evolvedeve-fanfesteve-fanfest-2013eve-keynoteeve-onlineeve-online-fanfesteve-online-fanfest-2013eve-virtual-realityeventevent-coverageevrfanfestfeaturedgoogleicelandjon-landermassively-event-coverageoculus-riftrekyjavikstar-citizentrailerunity-3dvideovirtual-realitySun, 28 Apr 2013 18:00:00 EST<![CDATA[EVE Fanfest 2013 final day: Trailers, EVE's TV show, and a vision for the future]]>http://massively.joystiq.com/2013/04/27/eve-fanfest-2013-final-day-new-trailer-a-vision-for-the-future/http://massively.joystiq.com/2013/04/27/eve-fanfest-2013-final-day-new-trailer-a-vision-for-the-future/http://massively.joystiq.com/2013/04/27/eve-fanfest-2013-final-day-new-trailer-a-vision-for-the-future/#commentsFiled under: , , , , , , , , , , , , , , , , , , , ,

EVE Fanfest 2013 final day New trailer, a vision for the future, EVE TV show and more
We usually don't expect to see much from the final day of the EVE Fanfest, but for this year's tenth anniversary celebration, CCP isn't doing anything by half measures. The first two days of the event had a strong focus on DUST 514 and EVE Online, delving into the specific details of DUST's upcoming Uprising update and EVE's Odyssey expansion. I went into the convention centre today expecting a nice slow wind down with the usual CCP Presents keynote looking at the state of the company, but I left with several huge reveals that seemed to come out of nowhere.

Not only did we find out that EVE Online is finally getting a collector's edition box full of goodies, but CCP revealed that a new EVE comic book and lore compendium are both on the way. As if that weren't enough, there's also an EVE TV series in the works based on player-submitted stories of true events inside the EVE universe. I couldn't help escaping the feeling, though, that this year's CCP Presents talk was more than a little marketing-oriented. As one of the press put it to me after the talk, it felt at times like watching an infomercial. On the plus side, we did get to see more of CCP's future vision for the EVE universe and an amazing new trailer showing the game's core storyline.

Read on to check out the incredible EVE Universe Origins trailer and my summary of the final day of Fanfest 2013.

Continue reading EVE Fanfest 2013 final day: Trailers, EVE's TV show, and a vision for the future

MassivelyEVE Fanfest 2013 final day: Trailers, EVE's TV show, and a vision for the future originally appeared on Massively on Sat, 27 Apr 2013 23:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>andie-nordgrenccp-seagullcollectors-editioneveeve-fanfesteve-fanfest-2013eve-onlineeve-online-fanfesteve-online-fanfest-2013eventevent-coveragefanfestfeaturedfive-year-planfive-year-visiongnosisicelandmassively-event-coverageoriginsplayer-owned-stationrekyjavikrifterstargateStargatestrailerusbusb-hubvideovisionSat, 27 Apr 2013 23:30:00 EST<![CDATA[DUST 514 launches on May 14]]>http://massively.joystiq.com/2013/04/27/dust-514-launches-on-may-14/http://massively.joystiq.com/2013/04/27/dust-514-launches-on-may-14/http://massively.joystiq.com/2013/04/27/dust-514-launches-on-may-14/#commentsFiled under: , , , , , , , , , ,

DUST 514 launches on May 14
CCP Games has just announced at this weekend's EVE Fanfest that the wait for DUST 514 will soon be over: DUST 514 is launching on May 14th.

The free-to-play PlayStation 3 shooter is built to connect with CCP's sci-fi MMORPG sandbox, EVE Online; players in one game can directly influence the players in the other.

"Gamers can look forward to an ever-progressing game, built on the experience CCP has gathered over the past decade, as new features and upgrades are rolled out for years to come," declares the press release posted today. Massively published a hands-on with the game in January.

[Source: CCP press release]

Gallery: DUST 514

Continue reading DUST 514 launches on May 14

MassivelyDUST 514 launches on May 14 originally appeared on Massively on Sat, 27 Apr 2013 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesconsoledustdust-514eveeve-fanfesteve-fanfest-2013eve-onlineeve-online-fanfesteve-online-fanfest-2013eventevent-coveragefanfestfpsgalleriesgalleryicelandlaunchlaunch-datemassively-event-coveragemmofpsplaystationplaystation-3ps3rekyjaviksandboxsci-fiscreenshotscreenshotsshooterSat, 27 Apr 2013 16:30:00 EST<![CDATA[True stories of EVE Online to become comic book and TV series]]>http://massively.joystiq.com/2013/04/27/true-stories-of-eve-online-to-become-comic-book-and-tv-series/http://massively.joystiq.com/2013/04/27/true-stories-of-eve-online-to-become-comic-book-and-tv-series/http://massively.joystiq.com/2013/04/27/true-stories-of-eve-online-to-become-comic-book-and-tv-series/#commentsFiled under: , , , , , , , , , , , , ,

True stories of EVE Online to become comic book and TV series
The CCP Presents Keynote at the annual EVE Online Fanfest is usually a fairly tame retrospective on how CCP has a company has done the past year and where it's going in the future, but for EVE's tenth anniversary, CCP broke out the big guns. In addition to announcing a massive new collector's edition, the studio has also revealed plans to turn real stories of events inside the sandbox into professional comic books and even a TV series.

Industry giant Dark Horse Comics, the company responsible for comics like Hellboy and Sin City, will be publishing the 54-page graphic novel this winter in both a paid-for print form and a free digital download. For the lore buffs among us, Dark Horse will also be producing a colossal 184-page glossy colour hardback book covering all of the NPC backstory and lore behind EVE Online and DUST 514. Titled EVE Source, the book will be an in-character almanac of everything in the EVE setting that isn't player-created and will even include previously unreleased concept art.

Continue reading True stories of EVE Online to become comic book and TV series

MassivelyTrue stories of EVE Online to become comic book and TV series originally appeared on Massively on Sat, 27 Apr 2013 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>comiccomicsdark-horsedark-horse-comicsdust-514eveeve-comiceve-fanfesteve-fanfest-2013eve-filmeve-onlineeve-online-fanfesteve-online-fanfest-2013eve-sourceeve-tveve-tv-serieseve-videoeventevent-coveragefactionsfanfestfilmhellboyicelandlorelore-booklore-booksmassively-event-coveragenewsnpc-storyrekyjaviksin-citystorylinestorylinestelevisiontvSat, 27 Apr 2013 15:30:00 EST<![CDATA[EVE Online Second Decade collector's edition revealed]]>http://massively.joystiq.com/2013/04/27/eve-online-second-decade-collectors-edition-revealed/http://massively.joystiq.com/2013/04/27/eve-online-second-decade-collectors-edition-revealed/http://massively.joystiq.com/2013/04/27/eve-online-second-decade-collectors-edition-revealed/#commentsFiled under: , , , , , , , , , , , , , ,

EVE Online Second Decade collector's edition revealed
Moments ago at EVE Online's tenth anniversary Fanfest, CCP revealed plans for its Second Decade Collector's Edition box. EVE never really had a proper collector's edition, and the tenth anniversary of the game is the perfect opportunity to release one. The box will come with an awesome physical Rifter model that doubles as a USB hub, a CD of the tenth anniversary EVE symphony from this year's Fanfest, and a series of codes to redeem to cosmetic items in EVE Online and DUST 514. The box is due for release in October 2013 and on the EVE store and Amazon and can be pre-purhased right now for $149.99 (€149.99 for those in Europe).

Cosmetic upgrades for EVE include a new golden pod skin that applies permanently to one character, some new bloodline-based in-game clothing, and several collector's edition ships. Players will get a five-run blueprint copy of the tenth anniversary Gnosis battlecruiser and a re-skinned red Tash-Murkon Magnate, and pre-purchasers will get a bonus Nefnatar Thrasher. DUST 514 items include a set of permanant Amarr templar drop suits and weapons with the same stats as normal items but lower skill requirements.

Continue reading EVE Online Second Decade collector's edition revealed

MassivelyEVE Online Second Decade collector's edition revealed originally appeared on Massively on Sat, 27 Apr 2013 14:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3d-modelsamarranniversarybreakingcollectors-editiondecadedropsuitsdustdust-514eveeve-fanfesteve-fanfest-2013eve-onlineeve-online-fanfesteve-online-fanfest-2013eve-symphonyeventevent-coveragefanfestgnosisicelandmassively-event-coverageNefnatarnefnatar-thrasherorchestrarekyjavikriftersecond-decadesymphonytash-murkontash-murkon-magnatetemplartemplar-dropsuitthrasherusbusb-hubSat, 27 Apr 2013 14:30:00 EST<![CDATA[EVE Fanfest 2013 day two: World of Darkness, Odyssey, and EVE Virtual Reality with the Oculus Rift]]>http://massively.joystiq.com/2013/04/26/eve-fanfest-2013-day-two-world-of-darkness-odyssey-and-eve-vi/http://massively.joystiq.com/2013/04/26/eve-fanfest-2013-day-two-world-of-darkness-odyssey-and-eve-vi/http://massively.joystiq.com/2013/04/26/eve-fanfest-2013-day-two-world-of-darkness-odyssey-and-eve-vi/#commentsFiled under: , , , , , , , , , , , , , , , , , ,

EVE Fanfest 2013 day two World of Darkness, Odyssey, and EVE Virtual Reality with the Oculus Rift
EVE Online's tenth anniversary Fanfest promised to be its biggest yet, with over 1,400 players packed into Iceland's Harpa convention centre to find out the latest on EVE Online, DUST 514, and World of Darkness. The first day focused mainly on DUST and its link with the EVE universe, but today the focus largely switched back to internet spaceships. There were plenty of roundtable discussions, and the CSM and Alliance panels were as awesome as ever, but it was the EVE Keynote that really blew the crowd away.

The day got off to a good start with the highly anticipated World of Darkness talk. Most fans were probably expecting to see more airy game design ideas and another shiny trailer, but this year CCP just came out and put all its cards on the table. We saw that the game is still firmly in pre-production, with much of the previous work going into developing the engine and cool content creation tools and shaders. While I was initially disappointed at the lack of gameplay progress or shiny cinematics, I found this approach of being open and direct with fans very refreshing. As I told WoD art director Thomas Holt, honest beats shiny every time.

Read on for a full run-down of the EVE reveals from the second day of EVE's tenth anniversary Fanfest, including in-depth details of the Odyssey expansion's features.

Continue reading EVE Fanfest 2013 day two: World of Darkness, Odyssey, and EVE Virtual Reality with the Oculus Rift

MassivelyEVE Fanfest 2013 day two: World of Darkness, Odyssey, and EVE Virtual Reality with the Oculus Rift originally appeared on Massively on Fri, 26 Apr 2013 23:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>anniversaryarchaeologyarcheologyccp-soundwavediscovery-scannereveeve-fanfesteve-fanfest-2013eve-onlineeve-online-fanfesteve-online-fanfest-2013eventevent-coverageevtfanfestfeaturedgraphicshackinghilmarhilmar-peturssonhilmar-veigar-peturssonicelandisotopesjon-landerjump-effectjumpingkeynotemassively-event-coverageminingoculus-riftodysseyorepreviewpreviewsprobeprobesprobingpvepvprekyjavikscan-probesscannerscanningstarbase-fuelstargatestargatesten-yearsthomas-holtvideovideoswodworld-of-darknessFri, 26 Apr 2013 23:30:00 EST<![CDATA[EVE Online plans major mining and industry revamp for Odyssey]]>http://massively.joystiq.com/2013/04/26/eve-online-plans-major-mining-and-industry-revamp-for-odyssey/http://massively.joystiq.com/2013/04/26/eve-online-plans-major-mining-and-industry-revamp-for-odyssey/http://massively.joystiq.com/2013/04/26/eve-online-plans-major-mining-and-industry-revamp-for-odyssey/#commentsFiled under: , , , , , , , , , ,

EVE Online plans major mining and industry revamp for Odyssey
Details of EVE Online's exploration-focused Odyssey expansion have been floating around since PAX East, but it seems the company saved some pretty huge changes to reveal at this year's tenth anniversary Fanfest. In two massive devblogs accompanying today's EVE Online Keynote speech, CCP Fozzie discussed plans to overhaul EVE's entire resource distribution system. Everything from asteroid and ice mining to moon harvesting and nullsec industry will be affected by the revamp.

Miners will find their ice belts have been moved from static locations to hidden exploration sites that have to be scanned down, but to compensate it will now mine at double the normal rate. Normal asteroid mining in lowsec and nullsec is also due for a buff with the addition of large quantities of low-end minerals. Hidden asteroid belts will no longer need to be probed down but can be quickly located with the new Discovery scanner, and to top it off there'll even be new high quality ore sites that can only be found in prime areas of nullsec.

Outpost industrial infrastructure is due for an update with new purchaseable upgrade paths expanding factory, office and research lab capabilities to the same level as fully-fledged empire stations. Lastly, moon minerals are finally being addressed with a redistribution of rare materials and several new reaction paths to bypass current bottlenecks. A lot of value will be moved from Technetium back to rarer materials like Thulium, Neodymium, Promethium and Dysprosium, and new supplies of all four will be distributed randomly into moons across the universe. Re-scan all of your nearby moons when Odyssey lands because it could suddenly be worth a fortune!

Whether you're a die-hard fan of internet spaceships or just a gawker on the sidelines, EVE Fanfest is the EVE Online event of the year (and the key source of new DUST 514 and World of Darkness scoops!). Follow Massively's Brendan Drain as he reports back on this year's Fanfest starpower, scheming, and spoilers from exotic Reykjavik, Iceland.

MassivelyEVE Online plans major mining and industry revamp for Odyssey originally appeared on Massively on Fri, 26 Apr 2013 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>asteroidasteroidsdysprosiumeveeve-fanfesteve-fanfest-2013eve-onlineeve-online-fanfesteve-online-fanfest-2013eventevent-coveragefanfesticeicelandmassively-event-coverageminingneodymiumorepromethiumrekyjavikstarbasestarbase-fueltechnetiumthuliumFri, 26 Apr 2013 18:30:00 EST<![CDATA[Some Assembly Required: Community as content]]>http://massively.joystiq.com/2013/04/26/some-assembly-required-community-as-content/http://massively.joystiq.com/2013/04/26/some-assembly-required-community-as-content/http://massively.joystiq.com/2013/04/26/some-assembly-required-community-as-content/#commentsFiled under: , , , , ,

Some Assembly Required Community as content
Not too long ago, I had the opportunity to cover an occasion during which an in-game community came together and created a new player-run annual event. Born as an anniversary follow-up to a service event for the young terminally ill player Ribbitribbit, the new tradition focused on celebrating that very community that pulled together to create him a dream playground within EverQuest II. If the game lacked a sense of community in the game before that original project, it certainly didn't after.

After tugging at my heartstrings for a while, that experience made me reflect on how much our communities are really a cornerstone of player-generated content. How often have you attended or participated in an event or run a mission created by someone other than yourself? And yet, when discussing important tools and elements needed to support player-generated content, we often overlook the necessity of a vibrant community. It's like trying to bake a cake without adding the flour. Or how about this analogy: You can give folks a giant tool box full of a shiny implements and tell them to build a house, but not much will happen without the actual wood and materials! So to foster PGC, games need to foster building communities.

Continue reading Some Assembly Required: Community as content

MassivelySome Assembly Required: Community as content originally appeared on Massively on Fri, 26 Apr 2013 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>aionascensionbuy-to-playcommunitycommunity-buildingcommunity-building-toolseaelectronic-artsendless-trialeq-2eq-iieq2eqiieveeve-fanfesteve-fanfest-2013eve-onlineeve-online-fanfesteve-online-fanfest-2013eventevent-coverageeverquest-2everquest-iif2pfactionfanfestfantasyfeaturedfree-to-playfuncomgame-mechanicshorroricelandin-game-calendarlineagelineage-2lineage-iimassively-event-coveragemythicmythic-entertainmentmythologyncsoftopinionpgcplayer-contentplayer-generated-contentpvprekyjavikrvrsandboxsarsci-fantasysecret-worldskill-basedsoesome-assembly-requiredsonysony-online-entertainmentsubscriptionlessthe-secret-worldtruly-freetswwarwarhammerwarhammer-onlineFri, 26 Apr 2013 16:00:00 EST<![CDATA[World of Darkness development shown at EVE Fanfest 2013]]>http://massively.joystiq.com/2013/04/26/world-of-darkness-development-shown-at-eve-fanfest-2013/http://massively.joystiq.com/2013/04/26/world-of-darkness-development-shown-at-eve-fanfest-2013/http://massively.joystiq.com/2013/04/26/world-of-darkness-development-shown-at-eve-fanfest-2013/#commentsFiled under: , , , , , , , , , , ,

World of Darkness development shown at EVE Fanfest 2013
When the World of Darkness MMO was first announced in November 2006, it was just an idea and we knew that it wouldn't be released any time soon. The chance to play a sandbox game set in the Vampire: The Masquerade universe nevertheless made fans of the series go nuts, but now over six years later we haven't seen much progress on the game. At EVE Fanfest 2013 today, CCP laid the current state of development bare for all to see and showed some plans for the coming year. There are now 70 people on the WoD team, and they've spent the past week working on everything from art tools and server infrastructure to vampire powers and social options.


"You're a powerful, immortal lord of the night. You don't want to stitch a shirt."
Development plans for 2013 include working on out-of-game web-based social tools, clothing systems, and PvE game environments. There are also plans to work on item creation, but direct crafting is probably not on the cards. As the presenter put it, "You're a powerful, immortal lord of the night. You don't want to stitch a shirt." Though the game is still in the pre-production stage, CCP was keen to show off the tools it's made to speed up the development process. "Some of these videos are a bit dry and technical," joked the presenter, but it came across as more real and honest than another trailer or musings on theoretical gameplay.

Continue reading World of Darkness development shown at EVE Fanfest 2013

MassivelyWorld of Darkness development shown at EVE Fanfest 2013 originally appeared on Massively on Fri, 26 Apr 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>breakingdevelopmentDirectX-11dx11eveeve-fanfesteve-fanfest-2013eve-onlineeve-online-fanfesteve-online-fanfest-2013eventevent-coveragefanfestgame-developmentgraphicsicelandmassively-event-coveragerekyjaviksandboxvampirevampire-the-masqueradewodworld-of-darknessworld-of-darkness-onlineFri, 26 Apr 2013 09:00:00 EST<![CDATA[What to expect from EVE Fanfest today: World of Darkness, EVE Keynote, and an interview with Jon Lander]]>http://massively.joystiq.com/2013/04/26/what-to-expect-from-eve-fanfest-2013-world-of-darkness-eve-key/http://massively.joystiq.com/2013/04/26/what-to-expect-from-eve-fanfest-2013-world-of-darkness-eve-key/http://massively.joystiq.com/2013/04/26/what-to-expect-from-eve-fanfest-2013-world-of-darkness-eve-key/#commentsFiled under: , , , , , , , , , , , , , , ,

What to expect from EVE Fanfest 2013 World of Darkness, EVE Keynote, and an interview with Jon lander
The second day of EVE Fanfest 2013 is now underway, and the schedule is packed! Today kicks off with a highly anticipated talk on World of Darkness at 7:00 a.m. EDT, and continues with the CSM Panel at 8:00 a.m. EDT, Alliance Panel at 9:00 a.m. EDT and Art Panel at 10:00 a.m. EDT. The CSM and Alliance panels are usually filled with hilarious banter, but this year the CSM Panel happens at the same time as the Faction Warfare roundtable and a talk on DUST 514 planet conquering in lowsec. The big event today is of course the EVE Online Keynote at 1:00 p.m. EDT, where we'll find out details of the upcoming Odyssey expansion.

World of Darkness is still pretty early in development, so the presentation will be talking mostly about the tools being used to build it. We're unlikely to get a release schedule or any solid gameplay demos, but with developers raving about their internal play-tests I expect to see some serious progress compared to last year. Since the CSM panel is likely being streamed, I'll try to hit up the Faction Warfare roundtable and see what CCP's current thoughts are on how to improve this aging game system.

Continue reading What to expect from EVE Fanfest today: World of Darkness, EVE Keynote, and an interview with Jon Lander

MassivelyWhat to expect from EVE Fanfest today: World of Darkness, EVE Keynote, and an interview with Jon Lander originally appeared on Massively on Fri, 26 Apr 2013 07:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alliance-panelcouncil-of-stellar-managementcsmcsm-paneldust-514eveeve-fanfesteve-fanfest-2013eve-keynoteeve-onlineeve-online-fanfesteve-online-fanfest-2013eventevent-coveragefaction-warfarefactional-warfarefanfesticelandinternet-spaceshipskeynotemassively-event-coverageodysseyrekyjavikroundtablewodworld-of-darknessFri, 26 Apr 2013 07:00:00 EST<![CDATA[EVE Fanfest 2013 day one: DUST 514, wormholes, and lowsec PvP]]>http://massively.joystiq.com/2013/04/25/eve-fanfest-2013-day-one-dust-514-wormholes-and-lowsec-pvp/http://massively.joystiq.com/2013/04/25/eve-fanfest-2013-day-one-dust-514-wormholes-and-lowsec-pvp/http://massively.joystiq.com/2013/04/25/eve-fanfest-2013-day-one-dust-514-wormholes-and-lowsec-pvp/#commentsFiled under: , , , , , , , , , , , , , , , , , , ,

EVE Fanfest 2013 day one roundup DUST 514, wormholes, lowsec PvP and Retribution
The 10th anniversary EVE Online Fanfest is beyond massive, with over 1,400 players piling into Reykjavik's Harpa building for three days of intense internet spaceshippery. Players fly from across the world to meet their corpmates and chat with other players as passionate about EVE as they are. CCP runs a packed schedule of game design presentations, reveals, and roundtable discussions with players, but for many attendees, the event is about being a part of a tight-knit community that usually exists only inside a game server.

CCP made the bold statement to the press team this morning that its goal is "to create virtual worlds more meaningful than real life," and with so many people flying across the world to meet other players face to face, I'd say the studio has succeeded. Today saw talks on EVE's hugely successful Retribution expansion, ship rebalancing, map generation in DUST 514, and lowsec PvP, and of course, we attended the DUST 514 keynote speech. There were also some hilarious shenanigans with the wormhole roundtable room filling to bursting and a guest science lecture on the possibility of faster than light travel in real life.

Continue reading EVE Fanfest 2013 day one: DUST 514, wormholes, and lowsec PvP

MassivelyEVE Fanfest 2013 day one: DUST 514, wormholes, and lowsec PvP originally appeared on Massively on Thu, 25 Apr 2013 23:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesconsoledustdust-514eveeve-fanfesteve-fanfest-2013eve-onlineeve-online-fanfesteve-online-fanfest-2013eventevent-coveragefanfestfeaturedfpsgraphicsicelandinternet-spaceshipslowsecmassively-event-coveragemmofpsnewspiracypirateplanetary-interactionplaystationplaystation-3previewpreviewsps3pvprekyjaviksandboxsci-fishooterspreadsheets-onlineterritorial-controlvideovideoswormholewormhole-explorationwormholesThu, 25 Apr 2013 23:00:00 EST<![CDATA[EVE Online store reopens with new products]]>http://massively.joystiq.com/2013/04/25/eve-online-store-reopens-with-new-products/http://massively.joystiq.com/2013/04/25/eve-online-store-reopens-with-new-products/http://massively.joystiq.com/2013/04/25/eve-online-store-reopens-with-new-products/#commentsFiled under: , , ,

EVE Online store reopens with new products
What better way to express your love for EVE Online than with EVE-branded clothing? OK, well, a tattoo might beat that, but you'll have less regret with a Concord Ops jacket.

CCP has announced today that its EVE store has reopened, allowing fans of the popular space MMO to buy starmap-adorned t-shirts and Guristas jackets to their hearts' content. In addition to what's currently available on the store, CCP plans to announce all new products (an expansion pack for the store, if you will) at this weekend's Fanfest.

Speaking of Fanfest, you can follow our coverage of the Icelandic party event all weekend.

MassivelyEVE Online store reopens with new products originally appeared on Massively on Thu, 25 Apr 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesclothingeveeve-onlineeve-storeinternet-spaceshipsreal-world-merchsandboxsci-fispreadsheets-onlineThu, 25 Apr 2013 11:00:00 EST<![CDATA[What to expect from EVE Fanfest 2013 today: DUST 514 keynote and more]]>http://massively.joystiq.com/2013/04/25/what-to-expect-from-eve-fanfest-2013-today-dust-514-keynote-and/http://massively.joystiq.com/2013/04/25/what-to-expect-from-eve-fanfest-2013-today-dust-514-keynote-and/http://massively.joystiq.com/2013/04/25/what-to-expect-from-eve-fanfest-2013-today-dust-514-keynote-and/#commentsFiled under: , , , , , , , , , , , , , , , ,

What to expect from EVE Fanfest 2013 Day 1
EVE Online's colossal tenth anniversary Fanfest hasn't even officially begun, but the excitement from attendees is already practically palpable. The Reykjavik nightlife has been invaded by hundreds of foreigners yelling about internet spaceships as players from around the world reunite with their online comrades and meet corpmates for the first time. Over the course of the weekend, a record 1,400 EVE fans and hundreds more press and partners will flood into the Harpa building for non-stop news and festivities from EVE Online, DUST 514, and World of Darkness.

The talks and events start later today, but last night CCP kicked off the festivities with the Icelandic Symphony Orchestra delivering stunning renditions of tracks from the EVE Online soundtrack. Today, I'll be reporting back from key talks including the Retribution expansion roundup at 8 a.m. EDT (noon GMT), ship rebalancing at 9 a.m. EDT (1 p.m. GMT), lowsec PvP and crimewatch at noon EDT (4 p.m. GMT), and of course, the DUST 514 keynote speech at 2 p.m. EDT (6 p.m. GMT). I may also be able to join in on the roundtable discussion on wormholes and live events at 10 a.m. EDT (2 p.m. GMT) for an inside look at CCP's current thoughts. Check out the Fanfest timetable and let me know if there's something interesting you think I should try to squeeze in.

I'd expect the tone of these talks to be one of looking back at another successful year and the great player response to the Retribution expansion. We probably won't hear much of anything about the Odyssey expansion today, but I do expect some big DUST 514 news from the keynote. While many are probably hoping for word of a PC release, I'd be very surprised to see CCP actually do it. We'll most likely just get a release schedule for the PS3 launch and possibly footage of the game running on a PS4 devkit. I'm personally also hoping for more details on post-release updates such as the ability for DUST corps to own and manage their own territory and industrial supply chains.

Whether you're a die-hard fan of internet spaceships or just a gawker on the sidelines, EVE Fanfest is the EVE Online event of the year (and the key source of new DUST 514 and World of Darkness scoops!). Follow Massively's Brendan Drain as he reports back on this year's Fanfest starpower, scheming, and spoilers from exotic Reykjavik, Iceland.

MassivelyWhat to expect from EVE Fanfest 2013 today: DUST 514 keynote and more originally appeared on Massively on Thu, 25 Apr 2013 02:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dustdust-514dust-514-keynoteeveeve-fanfesteve-fanfest-2013eve-onlineeve-online-fanfesteve-online-fanfest-2013eventevent-coveragefanfestharpaicelandicelandickeynotekeynote-speechlive-eventslowsecmassively-event-coveragemusicorchestraorchestralpvprekyjavikround-tableroundtableroundtable-discussionssandboxsci-fisymphonywormhole-explorationwormholesThu, 25 Apr 2013 02:00:00 EST<![CDATA[EVE Evolved: Five years of EVE Evolved]]>http://massively.joystiq.com/2013/04/21/eve-evolved-five-years-of-eve-evolved/http://massively.joystiq.com/2013/04/21/eve-evolved-five-years-of-eve-evolved/http://massively.joystiq.com/2013/04/21/eve-evolved-five-years-of-eve-evolved/#commentsFiled under: , , , , , , , , , , , , , , , , , ,

EVE Evolved title image
About five years ago, on April 27th, 2008, I joined the Massively team and wrote the very first issue of the EVE Evolved column. Five years later, the column is still going strong and delivering its weekly dose of EVE Online to thousands of readers. I used to worry about running out of ideas to write about, but regular game updates and hilarious player shenanigans mean there's always something interesting going on in New Eden. When EVE hits its 10th anniversary in May, this column will have been running for just over half of the game's lifetime. In that time, I've written over 250 in-depth articles, guides, in-game stories and opinion pieces on EVE Online and a few on DUST 514.

As usual, I'll be celebrating this anniversary by rounding up this year's column highlights and giving away two 30-day Pilot's License Extensions to two lucky readers. To enter the competition, write a comment explaining which EVE Evolved articles from this year you liked best and what topics you'd like to see covered in the coming year. You will need an active EVE account to claim the prize, so be sure to include your character name in your comment if you want to be in with a chance. If you'd rather not give out your character name or don't have an EVE account but would like to give the game a go, you can sign up a new trial account and use the name of your new character.

In this week's EVE Evolved, I look back at the highlights from the column's fifth year!

Continue reading EVE Evolved: Five years of EVE Evolved

MassivelyEVE Evolved: Five years of EVE Evolved originally appeared on Massively on Sun, 21 Apr 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>anetanniversaryapocryphaasakaibaitingbounty-hunterbounty-huntingccpccp-gamesconsolecrimewatchcruisersdecadedustdust-514eoneveeve-evolvedeve-onlineexpansionexpansionsexplorationfeaturedfive-year-anniversaryfive-yearsfpsfrigatesgame-designguideguideshistoryhulkinfernolowsecmmofpsnyphurodysseyopinionopinion-piecepiracyplaystationplaystation-3ps3pvepvpretributionrisk-vs-rewardsandboxsci-fiship-fittingship-fittingsship-setupsshooterspeculationstoriesstorystorytellingthe-battle-for-caldari-primewormholewormholesSun, 21 Apr 2013 18:00:00 EST<![CDATA[Make your EVE Fanfest plans with the official program]]>http://massively.joystiq.com/2013/04/18/make-your-eve-fanfest-plans-with-the-official-program/http://massively.joystiq.com/2013/04/18/make-your-eve-fanfest-plans-with-the-official-program/http://massively.joystiq.com/2013/04/18/make-your-eve-fanfest-plans-with-the-official-program/#commentsFiled under: , , , , , ,

Make your EVE Fanfest plans with the official program
EVE Fanfest is next week and the faithful are preparing to descend upon Reykjavik, Iceland, for the three-day convention. If you're one of the travelers who are heading there or are just looking to follow along on livestream, CCP has released the full program with the event's schedule.

Fanfest will have three keynotes about the past, present, and future of CCP's titles, respectively. There will also be several panels, including one discussing EVE Online's inclusion in the New York Museum of Modern Art.

EVE Online also released a new dev blog talking about the team's war on unauthorized client modification and violations of the EULA. Apparently CCP has taken additional steps to beef up detection and prevention, and the team wanted to be clear with players as to what is and is not allowed.

MassivelyMake your EVE Fanfest plans with the official program originally appeared on Massively on Thu, 18 Apr 2013 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesconsoleconventiondustdust-514eveeve-fanfesteve-fanfest-2013eve-onlineeventfanfestfanfest-2013fantasyfpsgothichorrorinternet-spaceshipslivestreammmofpsplaystationplaystation-3ps3real-world-eventsandboxschedulesci-fishooterspreadsheets-onlinesupernaturalvampirevampireswhite-wolfwodworld-of-darknessThu, 18 Apr 2013 15:30:00 EST<![CDATA[CCP revamping DUST 514's skill system]]>http://massively.joystiq.com/2013/04/18/ccp-revamping-dust-514s-skill-system/http://massively.joystiq.com/2013/04/18/ccp-revamping-dust-514s-skill-system/http://massively.joystiq.com/2013/04/18/ccp-revamping-dust-514s-skill-system/#commentsFiled under: , , , , , , , , , , ,

CCP revamping DUST 514's skill system
DUST 514's May 6th Uprising patch will revamp the sci-fi shooter's skill system. Among the changes are the removal of multiple prerequisite skills and a new node-based skill tree view that will replace the current list-based approach.

CCP is also refunding skill points and ISK and AUR for certain items based on their market value at the time of the respec. "You may have committed to a certain play style, and with an overhauled layout and collection of skills, you may find yourself regretting some of your prior choices," explains DUST creative director Atli Mar Sveinsson on the PlayStation Blog. "We have thus decided that it is far better to respec not only the skills but items as well. In short, you will get your skill points back and the ISK and AUR value of any item that is removed from your inventory."

MassivelyCCP revamping DUST 514's skill system originally appeared on Massively on Thu, 18 Apr 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>atli-mar-sveinssonccpccp-gamesccp-praetorianconsoledustdust-514dust-514-uprisingdust-skillsdust-skll-revampeveeve-onlinefpsmmofpsplaystationplaystation-3ps3sandboxsci-fishooterskill-basedskill-systemuprisingThu, 18 Apr 2013 10:00:00 EST<![CDATA[EVE Online collecting player stories, CSM elections halfway over]]>http://massively.joystiq.com/2013/04/17/eve-online-collecting-player-stories-cms-elections-halfway-over/http://massively.joystiq.com/2013/04/17/eve-online-collecting-player-stories-cms-elections-halfway-over/http://massively.joystiq.com/2013/04/17/eve-online-collecting-player-stories-cms-elections-halfway-over/#commentsFiled under: , , , , , , ,

Screenshot -- EVE Online
In a lot of ways, EVE Online players are a lot like vikings. Or so CCP's new promotional video would have you believe. It draws comparisons between early Icelandic settlers carving out their place in the world to players in the galaxy of EVE Online doing much the same. It also makes the fine point that we would know nothing about the settlers of Iceland were it not for the few who took the time to write about the events of the time. The fine scholars at CCP want to preserve the history of EVE Online in a similar way, and they want players' help to do it. Internet spacefarers can go to the EVE True Stories site and submit their favorite tales, which will be voted upon by fellow players. One lucky player will even win a trip to Iceland to visit CCP's studios and take in the splendor of the country.

EVE players and politicians may also want to remember that the 8th Council of Stellar Management elections are halfway done, and voting will close on April 17th (that's today!) at 7 p.m. EST (midnight GMT). So if you want to make your voice heard, head on over to the election page and cast your ballot. Also, don't forget to check out the True Stories video after the cut.SM

Continue reading EVE Online collecting player stories, CSM elections halfway over

MassivelyEVE Online collecting player stories, CSM elections halfway over originally appeared on Massively on Wed, 17 Apr 2013 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamescmscms-8contestcontestscouncil-of-stellar-managementcouncil-of-stellar-management-8eveeve-onlineinternet-spaceshipssandboxsci-fispreadsheets-onlinetrue-talesvideovideosWed, 17 Apr 2013 17:00:00 EST<![CDATA[The Stream Team: Stepping on tax edition, April 15 - 21, 2013]]>http://massively.joystiq.com/2013/04/15/the-stream-team-stepping-on-tax-edition-april-15-21-2013/http://massively.joystiq.com/2013/04/15/the-stream-team-stepping-on-tax-edition-april-15-21-2013/http://massively.joystiq.com/2013/04/15/the-stream-team-stepping-on-tax-edition-april-15-21-2013/#commentsFiled under: , , , ,

The Stream Team Stepping on tax edition, April 15 21, 2013
'Tis the season! Just... not that season. This isn't one we really want; it's not a season of joyousness and brotherly kindness. No, this one's more akin to scattering LEGOs and thumbtacks all across the floor then dashing barefoot from wall to wall just to hit your head against them over and over. We understand the pain. Truly, we do. And The Stream Team is here for you.

They say nothing's certain in life except death and taxes, but we disagree! We'd totally add Massively TV to that list. Have we ever left you in your times of need? No! And we know you need us now more than ever. We're here to help you, with a full line-up of shows to help ease the pain and take your mind off the traumas that cannot be avoided. So take a load off and check out this week's schedule, catch a few reruns, see the highlight of the week, and take part in our two polls. Then remember, at least this only happens once a year!

Continue reading The Stream Team: Stepping on tax edition, April 15 - 21, 2013

MassivelyThe Stream Team: Stepping on tax edition, April 15 - 21, 2013 originally appeared on Massively on Mon, 15 Apr 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>activisionage-of-wulinage-of-wushuagotaionanetarenanetarkark-hunterarkfallartplayascensionasiabigpointbiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gameschampionschampions-onlinechampschinachinesechinese-mmococonsoleconsolescrypticcryptic-studiosdefianceeaelectronic-artseq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfamilyfantasyfeaturedfrfree-realmsfree-to-playfuncomgame of thronesgame-of-thrones-ascentgame-of-thrones-mmogame-of-thrones-seven-kingdomsgeorge-martingeorge-rr-martingotgot7kgpotatoguild-warsguild-wars-2gvggwgw2hbohi-rezhi-rez-studioshistoricalhorrorinternet-spaceshipskid-friendlykidnappingkidskids-mmokingsislekingsisle-entertainmentlivestreamlivestreaminglivestreamslucasartsmartial-artsmassively-metamassively-tvmetamight-and-magicmight-and-magic-duel-of-championsming-dynastymmo-shootermobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftperfect-worldperfect-world-entertainmentplaneplanesplaystation-3playstation3pollps3pvppwesandboxsci-fantasysci-fisecret-worldseven-kingdomsshooterskill-basedSmitesnail-gamessnail-games-usasoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorsyfytanktankstelonthe-aurora-worldthe-old-republicthe-secret-worldthe-stream-teamthird-person-shootertortpstransmedia-synergytriontrion-worldstruly-freetswtvtwitchtwitch-tvvanguardvanguard-saga-of-heroesvgvillagers-and-heroeswarwarcraftwargaming.netwarplanewarplaneswesteroswizard101world-of-tanksworld-of-warcraftworld-of-warplaneswotwowwowpwushuwuxiaxboxMon, 15 Apr 2013 09:00:00 EST