Massively http://massively.joystiq.com Massively http://www.blogsmithmedia.com/http://massively.joystiq.com/media/feedlogo.gif Massively http://massively.joystiq.com en-us Copyright 2013 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[The Stream Team: Caveman edition, June 17 - 23, 2013]]>http://massively.joystiq.com/2013/06/17/the-stream-team-caveman-edition-june-17-23-2013/http://massively.joystiq.com/2013/06/17/the-stream-team-caveman-edition-june-17-23-2013/http://massively.joystiq.com/2013/06/17/the-stream-team-caveman-edition-june-17-23-2013/#commentsFiled under: , , ,

The Stream Team Caveman edition, June 17 23, 2013
With all the talk about bashing stuff lately, I can't help but envision a certain prehistoric child going around whacking everything with a club, "Bam! Bam! Bam!" Of course, who can blame the little tyke? There are definitely times in game that we've all wanted to swing a cudgel or two, be it a nerf design or a just-quitcher-whining bat.

Destructive tendencies can even be harbored in the gentle hearts of your favorite Stream Team hosts. A number of you can surely attest to that. Need proof? Just watch Massively TV and see for yourself. Warning: You may start to feel sympathy for those poor mobs...

Continue reading The Stream Team: Caveman edition, June 17 - 23, 2013

MassivelyThe Stream Team: Caveman edition, June 17 - 23, 2013 originally appeared on Massively on Mon, 17 Jun 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>activisionagonaionanetArcane-Sagaarenanetascensionaventurinebiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamesconquestconsoleconsolesdarkfalldarkfall-unholy-warsdfDotA-2eaelectronic-artseqeq-2eq-iieq1eq2eqiieveeve-onlineeverquesteverquest-2everquest-iif2pfactionfallen-earthfamilyfantasyfefeaturedfirefallfpsfrfree-realmsfree-to-playfuncomg1gamersfirstguild-wars-2gw2historicalhorrorinternet-spaceshipskid-friendlykidskids-mmokingsislekingsisle-entertainmentlivestreamlivestreaminglivestreamslucasartsmassively-metamassively-tvmetammo-shootermv-guidemv-tvmvguidemvtvmythologyncsoftopen-pvppiratepirate101piratesplaystation-3playstation3pollpost-apocpost-apocalypticps3pvpragnarok-online-2red-5red-5-studiosriftrift-literift-planes-of-telararvrsandboxsci-fantasysci-fisecret-worldshooterskill-basedsoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlessswtortanktankstelonthe-old-republicthe-secret-worldthe-stream-teamThe-Westthird-person-shooterthree-faction-pvpthree-way-pvptorTridektriontrion-worldstruly-freetswtwitchtwitch-tvunholy-warsvanguardvanguard-saga-of-heroesvgwarwarcraftwargaming.netwastelandsworld-of-tanksworld-of-warcraftwotwowMon, 17 Jun 2013 09:00:00 EST<![CDATA[EVE Evolved: Fitting battleships for PvP in Odyssey]]>http://massively.joystiq.com/2013/06/16/eve-evolved-fitting-battleships-for-pvp-in-odyssey/http://massively.joystiq.com/2013/06/16/eve-evolved-fitting-battleships-for-pvp-in-odyssey/http://massively.joystiq.com/2013/06/16/eve-evolved-fitting-battleships-for-pvp-in-odyssey/#commentsFiled under: , , , , , , , , , , ,

EVE Evolved Fitting battleships for PvP in Odyssey
Tech 1 ships in EVE Online used to be arranged in tiers that determined the cost and power of the ship and what level of the appropriate skill was required to fly it. This gave a sense of progression back in 2004 when all we had was frigates, cruisers, and battleships, but developers have since filled in the gaps between ship classes with destroyers, battlecruisers, strategic cruisers, and tech 2 ships of all shapes and sizes. In a recent game design initiative, CCP has been removing the tiers from within each tech 1 ship class by buffing the lower-tier ships up to the same rough power level as the largest ship in its class.

The recent Odyssey expansion saw the humble battleship buffed beyond all recognition. The Megathron, Raven, Tempest, and Apocalypse all became extreme damage-dealing powerhouses, but the Dominix, Scorpion, Typhoon, and Armageddon were buffed the most. Each of them can now fit several monster setups, dealing upward of 1,000 damage per second or completely disabling enemy ships with energy neutralisers and electronic warfare. The build costs of these tier one battleships were more than doubled in the expansion, but prices are only slowly rising due to the existing stock on the market. That makes the tier one battleships incredibly cost-effective PvP powerhouses at the moment, and players are beginning to take advantage of it.

In this week's EVE Evolved, I experiment with PvP setups for the newly revamped Typhoon, Armageddon, Scorpion, and Dominix battleships.

Continue reading EVE Evolved: Fitting battleships for PvP in Odyssey

MassivelyEVE Evolved: Fitting battleships for PvP in Odyssey originally appeared on Massively on Sun, 16 Jun 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>100kmarmageddonbattleshipbattleshipsbuffcapcapacitorcapacitor-warfareccpccp-gamesdominixdronedrone-damage-amplifierdronesecmelectronic-warfareeveeve-evolvedeve-onlinefeaturedgeddonguideinternet-spaceshipsjump-drivelowsecmicro-jump-driveneutneutraliserneutralizernullsecodysseyopinionpvpsandboxsci-fiscorpionshipship-fittingship-fittingsship-setupship-setupsshipssnipersnipingspreadsheets-onlinetiertier-1typhoonSun, 16 Jun 2013 18:00:00 EST<![CDATA[E3 2013: DUST 514 and EVE's virtual reality demo]]>http://massively.joystiq.com/2013/06/14/e3-2013-dust-514-and-eves-virtual-reality-demo/http://massively.joystiq.com/2013/06/14/e3-2013-dust-514-and-eves-virtual-reality-demo/http://massively.joystiq.com/2013/06/14/e3-2013-dust-514-and-eves-virtual-reality-demo/#commentsFiled under: , , , , , , , , , , ,

EVE
To an outsider, CCP Games' focus on EVE Online's player panel, comics, incoming television series about player adventures, and museum induction show just how much the company works to earn its players' respect, which might sound weird for studio running a cutthroat PvP sandbox. But I've always felt as if I made stronger personal attachments through high-stakes PvP than through most other gaming activities. I don't play EVE or its console cousin DUST 514, but after stopping by the CCP booth for my interview and hands-on at E3 yesterday, I feel as if I should be doing more than reading and writing about it.

Continue reading E3 2013: DUST 514 and EVE's virtual reality demo

MassivelyE3 2013: DUST 514 and EVE's virtual reality demo originally appeared on Massively on Fri, 14 Jun 2013 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesconconsoleconventionconvention-coveragedustdust-514e3e3-2013electronic-entertainment-expoeveeve-onlineeve-virtual-realityevent-coverageEVRexpofeaturedfpshands-oninternet-spaceshipsmassively-event-coveragemmofpsplaystationplaystation-3previewpreviewsps3sandboxsci-fishooterspreadsheets-onlineFri, 14 Jun 2013 16:00:00 EST<![CDATA[Free for All: My very own top ten list of MMO pet peeves]]>http://massively.joystiq.com/2013/06/12/free-for-all-my-very-own-top-ten-list-of-mmo-pet-peeves/http://massively.joystiq.com/2013/06/12/free-for-all-my-very-own-top-ten-list-of-mmo-pet-peeves/http://massively.joystiq.com/2013/06/12/free-for-all-my-very-own-top-ten-list-of-mmo-pet-peeves/#commentsFiled under: , , , , , , , , , , , , , , , , , , , , ,

Top ten list screenshot
I couldn't just sit back and let Justin Olivetti have all the fun, could I? When he published The Perfect Ten: My gaming pet peeves, I swept my fist to the sky and screamed "Sypsterrrr!" Literally a week earlier I had jotted down an idea for a similar column. I mean jotted down because I keep yellow pads around the house for late-night ideas or dog-walk eurekas.

Of course his will probably end up the superior article as he is the better writer (and has a good bit of facial hair), but I'm going to present mine anyway. In fact I'll do one better by listing 11 of my MMO pet peeves because, well, I jotted down 11.

Continue reading Free for All: My very own top ten list of MMO pet peeves

MassivelyFree for All: My very own top ten list of MMO pet peeves originally appeared on Massively on Wed, 12 Jun 2013 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>anetarenanetbeau-hindmanccpdefianceeve-onlineeverquestEverQuest-2f2pfeaturedffafree-for-allfree-to-playfreemiumGuild-Wars-2justin-olivettilord-of-the-rings-onlinelotromabinogimilmommortsNexonnexon-americaopinionperfect-tenplanetside-2RyzomSandboxsci-fiscience-fictionspellbornthe-chronicles-of-spellbornTop-Tentriontrion-worldsturbinevelvet-ropeWed, 12 Jun 2013 12:00:00 EST<![CDATA[E3 2013: Check out DUST 514's new trailer, EVE Online screenies]]>http://massively.joystiq.com/2013/06/11/e3-2013-check-out-dust-514s-new-trailer-eve-online-screenies/http://massively.joystiq.com/2013/06/11/e3-2013-check-out-dust-514s-new-trailer-eve-online-screenies/http://massively.joystiq.com/2013/06/11/e3-2013-check-out-dust-514s-new-trailer-eve-online-screenies/#commentsFiled under: , , , , , , , , , ,

E3 2013 Check out DUST 514's new trailer, EVE Online screenies
Sometimes a space cowboy or cowgirl just wants to gaze out of the cockpit and marvel at the beauty of the cosmos. Sometimes being that pensive is a good way to get podded, but at least those final moments are spent in awe.

So whether or not you're facing imminent combat, we've got some new CCP eye candy for you. Below are several new screenshots from EVE Online: Odyssey and DUST 514, and after the break is the E3 trailer for DUST called Fight Your Own War. Enjoy!

[Source: CCP Games]

Gallery: E3 2013: EVE Online and DUST 514

Continue reading E3 2013: Check out DUST 514's new trailer, EVE Online screenies

MassivelyE3 2013: Check out DUST 514's new trailer, EVE Online screenies originally appeared on Massively on Tue, 11 Jun 2013 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesconconsoleconventionconvention-coveragedustdust-514e3e3-2013electronic-entertainment-expoeveeve-onlineevent-coverageexpofpsgalleryinternet-spaceshipsmassively-event-coveragemmofpsodysseyplaystationplaystation-3ps3sandboxsci-fiscreenshotsshooterspreadsheets-onlinetrailervideoTue, 11 Jun 2013 17:30:00 EST<![CDATA[The Stream Team: Wedding singer edition, June 10 - 16, 2013]]>http://massively.joystiq.com/2013/06/10/the-stream-team-wedding-singer-edition-june-10-16-2013/http://massively.joystiq.com/2013/06/10/the-stream-team-wedding-singer-edition-june-10-16-2013/http://massively.joystiq.com/2013/06/10/the-stream-team-wedding-singer-edition-june-10-16-2013/#commentsFiled under: , , ,

The Stream Team Wedding singer edition, June 10 16, 2013
Have you ever been someplace, perhaps at an event, and spontaneously broken into song? And just maybe that wasn't quite an appropriate venue for a favorite heavy tune? Boy, the looks some people give you; I mean, what's really so wrong with injecting a little more groove into a wedding march anyways?

Well, luckily there are no such social taboos for spouting random song snippets on Massively TV! I know you understand that urge to just let loose a tune or two, right? It could be that you've belted out a concert-worthy rendition yourself when playing or watching your favorite games. We here at The Stream Team fully support that. We even contribute to the official organization: BOSS (Belting Out Spontaneous Songs). So why not join us where you know you won't be judged. Who knows, you might find a song to sing along with in this weeks streams.

Continue reading The Stream Team: Wedding singer edition, June 10 - 16, 2013

MassivelyThe Stream Team: Wedding singer edition, June 10 - 16, 2013 originally appeared on Massively on Mon, 10 Jun 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>activisionagonanetarenanetarkark-hunterarkfallaventurinebiowareblizzardblizzard-entertainmentbuy-to-playccpccp-gamesconquestdarkfalldarkfall-unholy-warsdefiancedfDotA-2eaelectronic-artselsword-onlineeqeq-2eq-iieq1eq2eqiieveeve-onlineeverquesteverquest-2everquest-iif2pfactionfantasyfeaturedfirefallfpsfree-to-playfuncomguild-wars-2gw2hi-rezhi-rez-studioshistoricalhorrorinternet-spaceshipslivestreamlivestreaminglivestreamslucasartsmassively-metamassively-tvmetammo-shootermobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftopen-pvpplaneplanespollpvpragnarok-online-2red-5red-5-studiosriftrift-literift-planes-of-telararvrsandboxsci-fantasysci-fisecret-worldshooterskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlessswtorsyfytanktankstelonthe-old-republicthe-secret-worldthe-stream-teamthird-person-shooterthree-faction-pvpthree-way-pvptortpstransmedia-synergytridektriontrion-worldstswtvtwitchtwitch-tvunholy-warsvanguardvanguard-saga-of-heroesvgwarwarcraftwargaming.netwarplanewarplanesworld-of-tanksworld-of-warcraftworld-of-warplaneswotwowwowpxboxMon, 10 Jun 2013 10:00:00 EST<![CDATA[EVE Evolved: First impressions of Odyssey]]>http://massively.joystiq.com/2013/06/09/eve-evolved-first-impressions-of-odyssey/http://massively.joystiq.com/2013/06/09/eve-evolved-first-impressions-of-odyssey/http://massively.joystiq.com/2013/06/09/eve-evolved-first-impressions-of-odyssey/#commentsFiled under: , , , , , , , , , , , , , , ,

EVE Evolved First impressions of Odyssey
The Odyssey expansion has been live for a couple of days now, but it's already starting to have a massive impact on EVE Online. Traffic through low-security space has increased significantly for the first time in years thanks to explorers hunting data and relic sites, and some players are even hunting asteroid belt NPCs in lowsec for the new security tags. New wars have erupted in nullsec following the redistribution of moon wealth, mining has become a more valuable profession, and the rebalanced battleships feel powerful again.

Unfortunately, Odyssey has seen its fair share of problems too. The new jump effect looks spectacular the first few times you see it, but long-term play is reportedly causing motion sickness in some players. Some players have also been objecting to the ice mining changes, and the revamped radial UI menu hasn't done much to fix the game's usability problems. Explorers in low-security space and nullsec are reporting incomes in the billions of ISK per day range thanks to the scan probe changes and new hacking minigame, but not everyone is happy with the new loot-scattering mechanic.

In this week's EVE Evolved, I look at the early impact of Odyssey on the EVE Online universe and discover the secrets behind collecting all the valuable loot when hacking.

Continue reading EVE Evolved: First impressions of Odyssey

MassivelyEVE Evolved: First impressions of Odyssey originally appeared on Massively on Sun, 09 Jun 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>archaeologyarcheologybattleshipbattleshipsblueprintBlueprintscargo-scannerccpccp-gamesdatadecryptoreveeve-evolvedeve-onlineexpansionexplorationfeaturedFirst-Impressionsgraphicsguidehackinghands-onhow-tointernet-spaceshipsjump-effectlootloot-distributionmaterialsmini-gameminigamenew-player-experienceodysseyopinionpartsprobesradial-menusandboxscan-probesscannersci-fispreadsheets-onlinestargateuiuser-interfaceSun, 09 Jun 2013 18:00:00 EST<![CDATA[CCP claims DUST 514 is 'driving' PS3 sales]]>http://massively.joystiq.com/2013/06/07/ccp-claims-dust-514-is-driving-ps3-sales/http://massively.joystiq.com/2013/06/07/ccp-claims-dust-514-is-driving-ps3-sales/http://massively.joystiq.com/2013/06/07/ccp-claims-dust-514-is-driving-ps3-sales/#commentsFiled under: , , , , ,

CCP claims DUST 514 is 'driving' PS3 sales
DUST 514 may be causing the CCP faithful to go out and buy a PlayStation 3, Vice President Thor Gunnarsson suggested. He claims that sales for Sony's console are increasing thanks to the popularity of the sci-fi MMOFPS.

"We already see that DUST 514, during open beta, had been driving hardware sales for Sony. We actually track that together," Gunnarsson said. "We know that our fanbase, DUST-curious players, are buying the PlayStation 3 to get into our game."

Recently, the studio claimed that DUST 514 was vital to the "long-term trajectory" of the company.

MassivelyCCP claims DUST 514 is 'driving' PS3 sales originally appeared on Massively on Fri, 07 Jun 2013 08:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesconsoledustdust-514eveeve-onlinefpsmmofpsplaystationplaystation-3ps3sandboxsci-fishooterthor-gunnarssonFri, 07 Jun 2013 08:30:00 EST<![CDATA[EVE Online flirts with virtual reality]]>http://massively.joystiq.com/2013/06/06/eve-online-flirts-with-virtual-reality/http://massively.joystiq.com/2013/06/06/eve-online-flirts-with-virtual-reality/http://massively.joystiq.com/2013/06/06/eve-online-flirts-with-virtual-reality/#commentsFiled under: , , , ,

EVE Online flirts with virtual reality
At this year's Fanfest, EVE Online teased the possibility of putting players into the game with the magic of virtual reality. The VR demo, courtesy of an Oculus Rift dev kit, turned a few heads both metaphorically and literally. Today, CCP put forth a blog post explaining the hows and whys that went into this intriguing project.

CCP Karuck details the journey that led the team to adapting the studio's flagship title for a VR headset: "We brought up many genres and styles, but in the end decided to make a game in the EVE universe where players could fly fighter spaceships. That idea just checked all the boxes, and who hasn't wanted to experience first-person space flight in EVE?"

Challenges for the team including modifying the UI to work with a headset and tweaking the experience so that users wouldn't get motion sickness. Karuck estimates that around a thousand players tried out the EVE VR demo at fanfest, and the team has plans to bring it to E3 for press previews. Still, he admits that he doesn't know what is in store for the future of it all: "We still don't know what will become of this little project of ours, with CCP considering various options."

MassivelyEVE Online flirts with virtual reality originally appeared on Massively on Thu, 06 Jun 2013 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesccp-karucke3e3-2013eveeve-onlineeve-online-fanfest-2013eve-vrfanfestinternet-spaceshipssandboxsci-fispreadsheets-onlinevirtual-realityvrThu, 06 Jun 2013 16:00:00 EST<![CDATA[Choose My Adventure: Put me in, coach]]>http://massively.joystiq.com/2013/06/05/choose-my-adventure-put-me-in-coach/http://massively.joystiq.com/2013/06/05/choose-my-adventure-put-me-in-coach/http://massively.joystiq.com/2013/06/05/choose-my-adventure-put-me-in-coach/#commentsFiled under: , , ,

http://massively.joystiq.com/2013/06/05/choose-my-adventure-i-have-no-idea-what-im-doing-edition/
Every games writer must wonder, at some point in his career, whether he is in fact horrible at video games. Be the game Dota 2, EVE Online, or any of the other titles that make up my weekly play schedule, I worry I'm much better at having a good time than I am at actually manipulating game mechanics and making them perform the way I would want.

But it doesn't have to be that way. Yes, dear friends -- I can change. I just can't do it alone. I need your help to become the most powerful, handsome, talented, handsome, elite-geared, handsome video gamester in all the world. It's up to you to Choose My Adventure and in doing so to decide which title offers me the best chance of becoming a golden gaming god and offers you the best chance to be my tough-but-fair coach who is totally a lovable teddy bear underneath all the swearing and yelling.

Continue reading Choose My Adventure: Put me in, coach

MassivelyChoose My Adventure: Put me in, coach originally appeared on Massively on Wed, 05 Jun 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmoaionall-points-bulletinall-points-bulletin-reloadedapbapb-reloadedapbrascensionbrowserbrowser-basedccpccp-gameschoose-my-adventureclone-warsclone-wars-adventurescmacrimecrypticcryptic-studioscwadnddota-2eveeve-onlinef2pfallen-earthfamilyfantasyfeaturedfirefallfpsfree-to-playg1gamersfirsthands-onhi-rezhi-rez-studiosinternet-spaceshipskid-friendlykidslobbyminigamemmo-shootermmofpsmobamultiplayer-online-battle-arenancsoftneverwinteropinionperfect-worldperfect-world-entertainmentplanetsideplanetside-2pollpollsps2pvppwereaders-choicered-5red-5-studiossandboxScarlet-Bladesci-fantasysci-fishooterSmitesoesonysony-online-entertainmentspreadsheets-onlineStar-Coflictstar-warsthird-person-shootertruly-freevotevotingwarWed, 05 Jun 2013 09:00:00 EST<![CDATA[CCP gifting 50,000 skill points to EVE pilots due to downtime]]>http://massively.joystiq.com/2013/06/04/ccp-gifting-50-000-skill-points-to-eve-pilots-due-to-downtime/http://massively.joystiq.com/2013/06/04/ccp-gifting-50-000-skill-points-to-eve-pilots-due-to-downtime/http://massively.joystiq.com/2013/06/04/ccp-gifting-50-000-skill-points-to-eve-pilots-due-to-downtime/#commentsFiled under: , , , , ,

CCP gifting 50,000 skill points to EVE pilots due to downtime
CCP is ponying up 50,000 unallocated skill points as a way of saying thanks to EVE Online players who endured the game's extended downtime over the weekend. The firm took its Tranquility server cluster offline for much of June 2nd and portions of June 3rd in order to deal with a DDoS attack, which affected EVE and newly released PlayStation 3 shooter DUST 514.

The bonus skill points were distributed during today's Odyssey expansion deployment, and CCP says that all accounts except trials are included.

MassivelyCCP gifting 50,000 skill points to EVE pilots due to downtime originally appeared on Massively on Tue, 04 Jun 2013 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gameseveeve-ddoseve-downtimeeve-hackeve-onlineeve-skill-pointsinternet-spaceshipssandboxsci-fispreadsheets-onlineTue, 04 Jun 2013 19:00:00 EST<![CDATA[CCP marks EVE Online: Odyssey launch with trio of new videos]]>http://massively.joystiq.com/2013/06/04/ccp-marks-eve-online-odyssey-launch-with-trio-of-new-videos/http://massively.joystiq.com/2013/06/04/ccp-marks-eve-online-odyssey-launch-with-trio-of-new-videos/http://massively.joystiq.com/2013/06/04/ccp-marks-eve-online-odyssey-launch-with-trio-of-new-videos/#commentsFiled under: , , , , , ,

EVE Online: Odyssey
Odyssey, the 19th free content expansion for sci-fi sandbox EVE Online, is now live. Like the EVE expansions that came before it, Odyssey brings a collection of changes, tweaks and major overhauls to EVE's existing universe, among them resource redistribution, deep modifications to the exploration career, a brand-new radial navigation tool, upgrades to player-owned stations, and a redesigned system scanner.

To mark the occasion, CCP has released no fewer than three videos covering Odyssey, including the expansion's final launch trailer. Check out all three after the break, and have a look at our Odyssey coverage for in-depth information on everything that's changing.

Continue reading CCP marks EVE Online: Odyssey launch with trio of new videos

MassivelyCCP marks EVE Online: Odyssey launch with trio of new videos originally appeared on Massively on Tue, 04 Jun 2013 14:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>archaeologyccpccp-gamesdev-videoeveeve-onlineeve-online-odysseyhackinginternet-spaceshipslaunchOdysseysandboxsci-fispreadsheets-onlinetrailertrailersvideovideosTue, 04 Jun 2013 14:30:00 EST<![CDATA[96 percent of EVE Online players are male]]>http://massively.joystiq.com/2013/06/03/96-percent-of-eve-online-players-are-male/http://massively.joystiq.com/2013/06/03/96-percent-of-eve-online-players-are-male/http://massively.joystiq.com/2013/06/03/96-percent-of-eve-online-players-are-male/#commentsFiled under: , , , , , ,

EVE Online - Here's a huge helping of dudes
CCP marketing bigwig David Reid recently told Destructoid that 96 percent of EVE Online players are male. The site also interviewed EVE senior producer Andie Nordgren, who opined that the numbers are a byproduct of genre.

"Part of it is due to the theme of the game. Science fiction is an extremely male-dominated domain," she explained. Whatever the reasons, CCP is OK with EVE's current demographics. "It's not a goal for us as a development team to specifically increase the number of female players," Nordgren said. It's "more an indicator than something [to] strive for."

Massively96 percent of EVE Online players are male originally appeared on Massively on Mon, 03 Jun 2013 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>96-percent-of-eve-players-are-maleAndie-Nordgrenccpccp-gamesdavid-reideveeve-onlineinternet-spaceshipssandboxsausage-festsci-fispreadsheets-onlineMon, 03 Jun 2013 19:00:00 EST<![CDATA[EVE Online details Odyssey ship rebalancing]]>http://massively.joystiq.com/2013/06/03/eve-online-details-odyssey-ship-rebalancing/http://massively.joystiq.com/2013/06/03/eve-online-details-odyssey-ship-rebalancing/http://massively.joystiq.com/2013/06/03/eve-online-details-odyssey-ship-rebalancing/#commentsFiled under: , , , ,

EVE Online details Odyssey ship rebalancing
When Odyssey hits for EVE Online, it's going to be a whole new ballgame for many of its ships. CCP is planning to revamp and restructure its Navy faction ships across the board and has written up a nice fat post about the upcoming changes.

Odyssey will feature 40 revamped hulls, including four brand-new ones. This is being done to fit in with the ongoing ship balancing project that's seeking to kill tiers off in a brutal and uncompromising fashion. It also bring the hulls in line with a "Navy" theme that will be featured in the expansion.

There are a lot of changes to absorb, including a change-up to 23 ship skills, a division of cruisers into attack and combat categories, and a rebalancing of Tech 1 battleships.

MassivelyEVE Online details Odyssey ship rebalancing originally appeared on Massively on Mon, 03 Jun 2013 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesdev-blogdev-diarydev-posteveeve-onlineinternet-spaceshipsodysseysandboxsci-fiship-rebalancingspreadsheets-onlineMon, 03 Jun 2013 16:30:00 EST<![CDATA[Does CCP's future depend on DUST 514?]]>http://massively.joystiq.com/2013/06/03/ccps-future-depends-on-dust-514/http://massively.joystiq.com/2013/06/03/ccps-future-depends-on-dust-514/http://massively.joystiq.com/2013/06/03/ccps-future-depends-on-dust-514/#commentsFiled under: , , , , , , ,

CCP's future depends on DUST 514
It's been a couple of weeks since DUST 514 launched as a free-to-play title on the PlayStation 3. While it may be too early to tell whether the MMOFPS will be a big success story, a big flop, or something in the middle, Chief Marketing Officer David Reid argues that DUST 514 is vital to the future of CCP Games.

"The second product is often the big product," he said. "Anybody can have a hit, but can you have two? It's very important for CCP right now to make DUST 514 a success. It has a lot to do with the long-term trajectory of the company. We're definitely thinking about that."

Reid says that CCP is not trying to directly compete with MMO industry titans, but is forging its own path with a sustained cult following. He sees DUST 514 as an important step to the growth of the EVE Online universe: "On some level, DUST is a bit of a tracer bullet. A very big tracer bullet, a big investment, but it's a test bed. This could be the beginning of a much more interesting strategy of lots and lots of things joining into Tranquillity, and all being part of that shared economy, those shared politics and that shared universe."

MassivelyDoes CCP's future depend on DUST 514? originally appeared on Massively on Mon, 03 Jun 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesconsoledavid-reiddustdust-514eveeve-onlinefpsinternet-spaceshipsmmofpsplaystationplaystation-3ps3sandboxsci-fishooterspreadsheets-onlineMon, 03 Jun 2013 11:00:00 EST<![CDATA[Why MMOs stopped getting bigger]]>http://massively.joystiq.com/2013/06/03/why-mmos-stopped-getting-bigger/http://massively.joystiq.com/2013/06/03/why-mmos-stopped-getting-bigger/http://massively.joystiq.com/2013/06/03/why-mmos-stopped-getting-bigger/#commentsFiled under: , , , , , , ,

Why MMOs stopped getting bigger
If after looking over the state of MMOs lately you've been left singing, "Where have all the big games gone?" to yourself, Ramin Shokrizade has an answer just for you. A virtual world economist, Shokrizade states that up until EVE Online and World of Warcraft, games grew in size and scope and then stopped. Why? Because it was never about getting big; it was about protecting and ensuring the equity of the gamers.

Shokrizade delves into why equity -- the sum of gamers' in-game efforts, such as levels and possessions -- is so important in a game and why those games that ignore protecting this equity don't measure up when it comes to success. He discusses how microtransactions that deal in in-game content destroy equity as well as how expansions that make previous content (such as crafting tiers) obsolete do the same thing. He then goes on to discuss the games that get it right, like League of Legends and World of Tanks.

MassivelyWhy MMOs stopped getting bigger originally appeared on Massively on Mon, 03 Jun 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>activisionblizzardblizzard-entertainmentccpccp-gamesdotae-sportesporteveeve-onlinef2pfantasyfree-to-playhistoricalinternet-spaceshipsleagueleague-of-legendslolmobapvpRamin-Shokrizaderiotriot-gamessandboxsci-fispreadsheets-onlinetanktankswarwarcraftwargaming.networld-of-tanksworld-of-warcraftwotwowMon, 03 Jun 2013 10:00:00 EST<![CDATA[The Stream Team: Calorie-free edition, June 3 - 9, 2013]]>http://massively.joystiq.com/2013/06/03/the-stream-team-calorie-free-edition-june-3-9-2013/http://massively.joystiq.com/2013/06/03/the-stream-team-calorie-free-edition-june-3-9-2013/http://massively.joystiq.com/2013/06/03/the-stream-team-calorie-free-edition-june-3-9-2013/#commentsFiled under: , , ,

The Stream Team Caloriefree edition, June 3 9, 2013
With summer right around the corner, a number of folks are thinking of ways to shape up a little more before hitting the beaches. Of course, as gamers we may not understand this strange desire to actually go out in the sunlight, but we, too, can be swept up in the fervor. So The Stream Team is here to offer you some calorie-free treats to help you through your week. Each and every tasty morsel on Massively TV is guaranteed to be 100% calorie-free.

Got cravings in between your livestream meals? Just click on a rerun and snack away anytime you like! Then just sit back and watch the hours just melt away.

Continue reading The Stream Team: Calorie-free edition, June 3 - 9, 2013

MassivelyThe Stream Team: Calorie-free edition, June 3 - 9, 2013 originally appeared on Massively on Mon, 03 Jun 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>activisionagonaionanetaq-worldsArcane-Sagaarenanetarkark-hunterarkfallascensionaventurinebiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamesconquestconsoleconsolesdarkfalldarkfall-unholy-warsdefiancedfdota-2eaelectronic-artselsword-onlineeq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfantasyfeaturedfpsfrfree-realmsfree-to-playguild-wars-2gw2hi-rezhi-rez-studioshistoricalinternet-spaceshipskid-friendlykidskids-mmolivestreamlivestreaminglivestreamslucasartsmassively-metamassively-tvmetammo-shootermmofpsmobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvncsoftopen-pvpplaneplanesplanetsideplanetside-2playstation-3playstation3pollps2ps3pvpriftrift-literift-planes-of-telararvrsandboxsci-fishooterSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamswtorsyfythe-old-republicthe-stream-teamthird-person-shooterthree-faction-pvpthree-way-pvptortpstransmedia-synergytriontrion-worldstruly-freetvtwitchtwitch-tvunholy-warswarwarcraftwargaming.netwarplanewarplanesworld-of-warcraftworld-of-warplaneswowwowpxboxMon, 03 Jun 2013 09:00:00 EST<![CDATA[EVE and DUST DDoS attack not a threat to customers]]>http://massively.joystiq.com/2013/06/03/eve-and-dust-ddos-attack-not-a-threat-to-customers/http://massively.joystiq.com/2013/06/03/eve-and-dust-ddos-attack-not-a-threat-to-customers/http://massively.joystiq.com/2013/06/03/eve-and-dust-ddos-attack-not-a-threat-to-customers/#commentsFiled under: , , , ,

EVE Online DDoS attack not a threat to costumers
This weekend's downtime in both EVE Online and DUST 514 -- the results of a distributed denial-of-service (DDoS) attack -- is now over and both CCP games are back online, according to a statement from the studio's COO, Jón Hörðdal Jónasson.

CCP assures its customers that "at no time was customer data compromised or accessible in any way." Compensation to all EVE and DUST players will be announced soon.

MassivelyEVE and DUST DDoS attack not a threat to customers originally appeared on Massively on Mon, 03 Jun 2013 07:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>attackccpccp-gamesconsoleddosdowntimedustdust-514eveeve-onlinefpsinternet-spaceshipsmmofpsplaystationplaystation-3ps3sandboxsci-fishooterspreadsheets-onlineMon, 03 Jun 2013 07:30:00 EST<![CDATA[EVE Evolved: Get ready for Odyssey]]>http://massively.joystiq.com/2013/06/02/eve-evolved-get-ready-for-odyssey/http://massively.joystiq.com/2013/06/02/eve-evolved-get-ready-for-odyssey/http://massively.joystiq.com/2013/06/02/eve-evolved-get-ready-for-odyssey/#commentsFiled under: , , , , , , , , , , ,

EVE Evolved Get ready for Odyssey
With just two days to go until EVE Online's exploration-focused Odyssey expansion goes live, players have been scouring the test server for information that can give them an edge. Some have been practicing moon surveying techniques for the upcoming redistribution of tech 2 minerals, and others are hoping to get rich quick by speculating on battleship price changes. Explorers are kitting out new exploration ships, theorycrafters are working on new setups for rebalanced ships, and pirates are setting up base in lowsec areas that are about to become fertile hunting grounds.

Odyssey isn't quite the Apocrypha-level expansion I've been hoping for, but it certainly seems set to shake things up. Changes to moon minerals will throw nullsec into chaos and hopefully ignite some big territorial wars, and battleship buffs may change EVE's popular fleet compositions. The Discovery Scanner Overlay will make exploration much easier for new players to get into, but will also give pirates another tool with which to hunt down explorers. A new co-operative hacking minigame will also make exploration more of a team sport. But how can you make the most of the expansion from day one, and what can you do today to prepare for it?

In this week's EVE Evolved, I look at the new exploration system and other changes you can expect when you log in on Tuesday, and what you can do now to make the most of them.

Continue reading EVE Evolved: Get ready for Odyssey

MassivelyEVE Evolved: Get ready for Odyssey originally appeared on Massively on Sun, 02 Jun 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alliance-warfareapocryphaarchaeologyarcheologybattleshipbattleshipsbuffccpccp-gamescloakdysprosiumeveeve-evolvedeve-onlineexpansionexpansionsexplorationfeaturedget-readygroup-pvehackinghighsecinternet-spaceshipsisklowsecmaking-iskmineralmineralsmoon-mineralsmoon-miningneodymiumnullsecodysseyopinionprepareprocurerprofitpromethiumpvepvpr64richsandboxsci-fiship-tiersspreadsheets-onlinetechtechnetiumthuliumtiertiericideSun, 02 Jun 2013 18:00:00 EST<![CDATA[CCP takes EVE and DUST offline due to DDoS attack]]>http://massively.joystiq.com/2013/06/02/ccp-takes-eve-and-dust-offline-due-to-ddos-attack/http://massively.joystiq.com/2013/06/02/ccp-takes-eve-and-dust-offline-due-to-ddos-attack/http://massively.joystiq.com/2013/06/02/ccp-takes-eve-and-dust-offline-due-to-ddos-attack/#commentsFiled under: , , , , , ,

CCP takes EVE and DUST offline due to DDoS attack
If you were looking to play EVE Online or DUST 514 this afternoon, you might want to go with your backup plan. CCP has taken its Tranquility server cluster offline in order to deal with a "significant and sustained distributed denial-of-service (DDoS) attack."

Tranquility hosts EVE and DUST players, and while CCP initially reopened the servers, it has since decided to close them down in order to conduct an investigation and "an exhaustive scan of our entire infrastructure." The outage also affects CCP's web presence. You can follow the situation via the company's Twitter feed.

[Thanks to everyone who tipped us.]

MassivelyCCP takes EVE and DUST offline due to DDoS attack originally appeared on Massively on Sun, 02 Jun 2013 14:15:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>breakingccpccp-gamesconsoleddosdustdust-514dust-ddoseveeve-ddoseve-hackeve-onlinefpshackedinternet-spaceshipsmmofpsplaystationplaystation-3ps3sandboxsci-fishooterspreadsheets-onlineSun, 02 Jun 2013 14:15:00 EST<![CDATA[EVE Online dev blog discusses Odyssey UI changes]]>http://massively.joystiq.com/2013/05/30/eve-online-dev-blog-discusses-odyssey-ui-changes/http://massively.joystiq.com/2013/05/30/eve-online-dev-blog-discusses-odyssey-ui-changes/http://massively.joystiq.com/2013/05/30/eve-online-dev-blog-discusses-odyssey-ui-changes/#commentsFiled under: , , , , ,

Screenshot -- EVE Online's new Fleet Management window
The folks over at CCP have put up a new, puntastically titled post on the EVE Online site to fill players in on some of the UI changes coming in EVE Online: Odyssey. The changes range from the miniscule ("you can now make the input field in chat a single line and gain like 20 extra pixels! Yay!") to the more ambitious (such as a major reworking of the game's fleet management window), plus a few things in-between. To get the down-and-dirty details on all of the UI changes coming with Odyssey, just head on over and read the full post at the game's official site.

MassivelyEVE Online dev blog discusses Odyssey UI changes originally appeared on Massively on Thu, 30 May 2013 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gameseveeve-onlineeve-online-odysseyinternet-spaceshipsodysseyreal-punny-guyssandboxsci-fispreadsheets-onlineuiuser-interfaceThu, 30 May 2013 19:00:00 EST<![CDATA[EVE Online lays down Alliance Tournament rules]]>http://massively.joystiq.com/2013/05/29/eve-online-lays-down-alliance-tournament-rules/http://massively.joystiq.com/2013/05/29/eve-online-lays-down-alliance-tournament-rules/http://massively.joystiq.com/2013/05/29/eve-online-lays-down-alliance-tournament-rules/#commentsFiled under: , , , , ,

EVE Online lays down Alliance Tournament rules
EVE Online's Alliance Tournament XI is coming up this summer, and prospective combatants can now check out the full list of official rules as well as format details. Changes from past tournaments include the elimination of pre-qualifying and group stages, an entry fee of just 5 PLEX, the addition of a practice server, and a new tie-breaking system.

The tournament will pit 64 alliance teams against each other in a single stage that involves double-elimination brackets and random initial seeding.

MassivelyEVE Online lays down Alliance Tournament rules originally appeared on Massively on Wed, 29 May 2013 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alliance-tournament-xiccpccp-gameseveeve-onlineformatinternet-spaceshipspvprulessandboxsci-fispreadsheets-onlinetournamentWed, 29 May 2013 19:00:00 EST<![CDATA[Jukebox Heroes: EVE Online's soundtrack]]>http://massively.joystiq.com/2013/05/28/jukebox-heroes-eve-onlines-soundtrack/http://massively.joystiq.com/2013/05/28/jukebox-heroes-eve-onlines-soundtrack/http://massively.joystiq.com/2013/05/28/jukebox-heroes-eve-onlines-soundtrack/#commentsFiled under: , , ,

Jukebox Heroes EVE Online's soundtrack
EVE Online's soundtrack is a strange puppy to me. I've heard players proclaim their love and undying affection for it, although I believe that a great deal of that is tied into game loyalty and monogamy. From this outsider's perspective, it's a large number of ambient synth tracks that are big on atmosphere and small on catchy melodies or memorable themes.

Even though I wouldn't rate it as one of the most exciting scores I've covered for this column, I don't want to dismiss its atmospheric nature as a negative. Creating a soundscape that communicates the wonder, mystery, and largely empty gulf of the cosmos has proven to be a great asset to gamer immersion for EVE, and at least most of these tracks are soothing and low-key enough to warrant a high rating on the replayability scale.

Icelandic composer Jón Hallur Haraldsson was in charge of this project. Responding to an interview question about the score's musical category, Haraldsson said, "Back in the days I used to concern myself a lot with defining my music, but I don't do that as much anymore. I like to amalgamate, to take whatever I like from whatever style and try to put that into my music."

You can listen to a bulk of the game's music on Sound Cloud, but here are my picks for the six best tracks out of the bunch!

Continue reading Jukebox Heroes: EVE Online's soundtrack

MassivelyJukebox Heroes: EVE Online's soundtrack originally appeared on Massively on Tue, 28 May 2013 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamescomposercomposerseveeve-onlinefanfestfeaturedgame-musicinternet-spaceshipsJón-Hallur-HaraldssonJon-Hallur-Haraldssonjukeboxjukebox-heroesjustin-olivettimmo-jukeboxmmo-musicmusicopinionsandboxsci-fisoundtracksoundtracksspreadsheets-onlinesymphonyTue, 28 May 2013 20:00:00 EST<![CDATA[EVE Online: Odyssey promises huge changes, dual character training]]>http://massively.joystiq.com/2013/05/28/eve-online-odyssey-promises-huge-changes-dual-character-traini/http://massively.joystiq.com/2013/05/28/eve-online-odyssey-promises-huge-changes-dual-character-traini/http://massively.joystiq.com/2013/05/28/eve-online-odyssey-promises-huge-changes-dual-character-traini/#commentsFiled under: , , , , , , , , , ,

EVE Online: Odyssey
It's time again for another enormous EVE Online expansion. This latest chunk of tweaks, changes, and updates, titled Odyssey and due for launch June 4, marks the 19th free content addition in the space-based MMO's 10-year history. And like the expansions that came before it, Odyssey promises to make a host of changes to the EVE universe -- some big, some small, and some even game-changing.

We sat down with CCP to get a look at Odyssey and some of its more major components, including a huge exploration overhaul, more user-friendly controls, and a dramatic change to the way in which resources are distributed across its vast, starry expanses.

Here's what we've learned.

Continue reading EVE Online: Odyssey promises huge changes, dual character training

MassivelyEVE Online: Odyssey promises huge changes, dual character training originally appeared on Massively on Tue, 28 May 2013 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gameseveEve-Expansioneve-onlineeve-online-odysseyexpansionfeaturedinternet-spaceshipsinterviewinterviewskristoffer-touborgodysseypreviewpreviewssandboxsci-fispreadsheets-onlineTue, 28 May 2013 17:00:00 EST<![CDATA[EVE Evolved: Archaeology and Hacking in Odyssey]]>http://massively.joystiq.com/2013/05/26/eve-evolved-archaeology-and-hacking-in-odyssey/http://massively.joystiq.com/2013/05/26/eve-evolved-archaeology-and-hacking-in-odyssey/http://massively.joystiq.com/2013/05/26/eve-evolved-archaeology-and-hacking-in-odyssey/#commentsFiled under: , , , , , , , , , ,

EVE Evolved Hacking and Archaeology in Odyssey
EVE Online's Odyssey expansion is set to land in just over a week's time, kicking off the game's second decade with a focus on exploration, immersion, and resource rebalancing. Developers plan to shake up nullsec by redistributing the value of various moon minerals and buffing player-owned outposts, and lowsec will become a more tempting place to visit with the addition of valuable new tags to asteroid belt NPCs. But what's in it for highsec players?

In addition to new navy issue battlecruisers and immersive new jump and death sequences, players from all corners of EVE will find new exploration content in their back yards. A big part of the new exploration system is a complete redesign of the Hacking and Archaeology mini-professions, which have been in EVE for as long as I can remember and have remained relatively unchanged. Odyssey will add new sites for both professions and replace the boring old chance-based system with a new minigame that emphasises co-operation with other players.

In this week's EVE Evolved, I look at the history of Hacking and Archaeology in EVE and what the new system brings to the table.

Continue reading EVE Evolved: Archaeology and Hacking in Odyssey

MassivelyEVE Evolved: Archaeology and Hacking in Odyssey originally appeared on Massively on Sun, 26 May 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>analyzerarchaeologyarcheologyccpccp-gamescodebreakerconsoledustdust-514eveeve-evolvedeve-onlineexpansionexplorationfeaturedfpshackhackerhackinginternet-spaceshipsmini-gameminigamemmofpsodysseyopinionplaystationplaystation-3ps3sandboxsci-fishooterspreadsheets-onlineSun, 26 May 2013 18:00:00 EST<![CDATA[EVE Online redesigns radial menu for Odyssey]]>http://massively.joystiq.com/2013/05/21/eve-online-redesigns-radial-menu-for-odyssey/http://massively.joystiq.com/2013/05/21/eve-online-redesigns-radial-menu-for-odyssey/http://massively.joystiq.com/2013/05/21/eve-online-redesigns-radial-menu-for-odyssey/#commentsFiled under: , , , , , ,

EVE Online redesigns radial menu for OdysseyIn looking to trim down some of the menu bloat for EVE Online's Odyssey expansion, CCP Games is resurrecting and redesigning the radial menu to be a "silver bullet" for this issue.

The updated radial menu will be connected to the underutilized left mouse button and is confined to eight segments that will change depending on what the user is clicking. The studio wrote up a blog post on the subject, promising that the redesign is intuitive and will result in faster access to relevant commands.

Initially, the radial menu upgrade will be for ship flight only, although CCP is willing to expand its domain if players find it useful. This feature is currently available on the test server.

MassivelyEVE Online redesigns radial menu for Odyssey originally appeared on Massively on Tue, 21 May 2013 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesdev-blogdev-diaryeveeve-onlineinternet-spaceshipsmenumenusodysseyradial-menusandboxsci-fispreadsheets-onlineTue, 21 May 2013 15:30:00 EST<![CDATA[EVE Mobile is coming according to Jon Lander]]>http://massively.joystiq.com/2013/05/20/eve-mobile-is-coming-according-to-jon-lander/http://massively.joystiq.com/2013/05/20/eve-mobile-is-coming-according-to-jon-lander/http://massively.joystiq.com/2013/05/20/eve-mobile-is-coming-according-to-jon-lander/#commentsFiled under: , , , , , , ,

Now you can stand next to someone, blow up their ship on your phone, then punch them.
If you've ever been involved in a discussion about EVE Online, you've heard it referred to as a sequence of spreadsheets which occasionally let you fly a spaceship. Which certainly has some basis in truth. Certainly it's a game with many possible systems that could be ported to a mobile client, something that CCP's Jon Lander is claiming will be a reality in the near future. Lander has moved from being EVE's executive producer to mobile development, but his new position is clearly still tied to the same game.

Rather than simply being a series of spreadsheets for your smartphone, Lander has made it clear that the mobile team wants for the various EVE mobile apps to be functional games in their own right. It's a field that CCP has explored before, stopping either due to technical hurdles or business concerns. But Lander's confident that players will be using the mobile applications by the time next year's Fanfest rolls around.

MassivelyEVE Mobile is coming according to Jon Lander originally appeared on Massively on Mon, 20 May 2013 20:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gameseveeve-mobileeve-onlineinternet-spaceshipsjon-landermobilemobile-developmentsandboxsci-fispreadsheets-onlineMon, 20 May 2013 20:30:00 EST<![CDATA[The Stream Team: Monocle Day edition, May 20 - 26, 2013]]>http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/#commentsFiled under: , , ,

The Stream Team Monocle day edition, May 20 26, 2013
Two weeks ago, y'all had the chance to select a new holiday to help add some cheer to the otherwise bland weeks in the middle of May. The choices teased and tantalized you, but you're a discriminating crowd. In a race fraught with nail-biting suspense, only one ultimately prevailed. And so it is with further ado we bring to you: Monocle Day!

This Tuesday, May 21st, has been selected to be the auspicious day of this most storied celebration. Why? Because 5/21 splits into 5 + 2 + 1, which of course = 8, and we all know that 8 is just two monocles stacked on top of each other! And as always, Massively TV is here to help you ring in the new holiday, with special shows throughout the entire week. Check out the full schedule of celebratory events hosted by The Stream Team after the break. Then let us know if you'll be wearing your own monocle in honor of the festivities.

Continue reading The Stream Team: Monocle Day edition, May 20 - 26, 2013

MassivelyThe Stream Team: Monocle Day edition, May 20 - 26, 2013 originally appeared on Massively on Mon, 20 May 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>Achaeaaction-mmoactivisionagonanetAnno-Onlinearenanetaventurinebiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamescity-of-steamconsoleconsolescrypticcryptic-studiosdarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodfdndDotA-2dragonDragonrealmsdragonsdragons-propheteaelectronic-artselswordeq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfrfree-realmsfree-to-playfuncomgoblinguild-warsgwhi-rezhi-rez-studioshistoricalhorrorhousinginfernuminfernum-productionsinternet-spaceshipskid-friendlykidskids-mmolivestreamlivestreaminglivestreamslucasartsmassively-metamassively-tvmechanistmechanist-gamesmetamobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftneverwinteropen-pvpperfect-worldperfect-world-entertainmentplaneplanesplaystation-3playstation3pollps3pvppwerunewakerrunewaker-entertainmentsandboxsci-fantasysci-fisecret-worldskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicsteampunkstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorthe-old-republicthe-secret-worldthe-stream-teamthreshold-rpgtortswtwitchtwitch-tvunholy-warswarwarcraftwargaming.netwarplanewarplanesworld-of-warcraftworld-of-warplaneswowwowpMon, 20 May 2013 09:00:00 EST<![CDATA[EVE Evolved: Fanfest 2013 video roundup]]>http://massively.joystiq.com/2013/05/19/eve-evolved-fanfest-2013-video-roundup/http://massively.joystiq.com/2013/05/19/eve-evolved-fanfest-2013-video-roundup/http://massively.joystiq.com/2013/05/19/eve-evolved-fanfest-2013-video-roundup/#commentsFiled under: , , , , , , , , , , , , , , , , , , , , ,

EVE Evolved Fanfest 2013 video roundup
Last month saw the huge tenth anniversary EVE Online Fanfest, a three-day convention packed full of exclusive reveals, behind-the-scenes talks, and community events. This year's Fanfest was the biggest one yet, celebrating EVE's tenth anniversary with special guest speakers from the scientific community, the reveal of a new virtual reality dogfighter, DUST 514's launch, and details of the upcoming Odyssey expansion. Massively was there to bring you coverage of the big news as it happened, and CCP streamed some of the key talks and events live to viewers at home.

This year's Fanfest sold out so quickly that many people who wanted to go didn't get a chance to, and only a select few talks were shown on the public livestream. With such a packed event schedule, even players in attendance couldn't be there for every interesting talk. Thankfully, CCP recorded over 30 of the most anticipated events and has now uploaded the videos to YouTube. Highlights include the Make EVE Real videos, the EVE keynote, the CCP Presents Keynote, and the talks on how DUST 514 integrates with the EVE economy.

In this week's EVE Evolved, I round up all of the EVE Fanfest videos in a handy list.

Continue reading EVE Evolved: Fanfest 2013 video roundup

MassivelyEVE Evolved: Fanfest 2013 video roundup originally appeared on Massively on Sun, 19 May 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alliance-panelapocalypseasteroidasteroid-miningasteroidsbattleshipccpccp-gameschinaconcept-artconsoleconventioncrimewatchcsm-paneldustdust-514economyeveeve-evolvedeve-fanfesteve-fanfest-2013eve-is-realeve-onlineeventeventsfanfestfaster-than-lightfeaturedfpsftlgame-designgearinternet-spaceshipskeynotemake-eve-realminingmmofpsodysseyopinionplanetary-conquestplaystationplaystation-3progressionps3pvpsandboxsci-fishooterspace-elevatorspreadsheets-onlineuprisingSun, 19 May 2013 18:00:00 EST<![CDATA[One Shots: The many lives of Gwen Thackeray]]>http://massively.joystiq.com/2013/05/19/one-shots-the-many-lives-of-gwen-thackeray/http://massively.joystiq.com/2013/05/19/one-shots-the-many-lives-of-gwen-thackeray/http://massively.joystiq.com/2013/05/19/one-shots-the-many-lives-of-gwen-thackeray/#commentsFiled under: , , , , , ,

One Shots Looming death
Hey Gwen, how's it hanging? Find that flute yet? Yeah, don't worry, I'm sure it'll turn up around here somewhere. Don't get too near the river there, girl; those skale have a nasty bite! Say, what's that sulfurous smell in the air? And those distant screams that are drawing nearer at an incredible rate? And a sudden looming premonition that the property values around here are about to take a nosedive?

Reader Sharvis sent in this Guild Wars picture with a modicum of pity: "Here is Gwen moments before the Searing. Poor girl."

Don't feel too sorry for her, Sharvis! She gets an entire expansion, after all!

Continue reading One Shots: The many lives of Gwen Thackeray

MassivelyOne Shots: The many lives of Gwen Thackeray originally appeared on Massively on Sun, 19 May 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>activisionanetarenanetblizzardblizzard-entertainmentbring-back-one-shotsbuy-to-playccpccp-gameseveeve-onlinefantasygalleriesgalleryguild-warsguild-wars-2gwgw2internet-spaceshipsncsoftone-shotspics-or-it-didnt-happenreader-screenshotsreader-submissionssandboxsci-fiscreenshotscreenshotsspreadsheets-onlineuser-submissionswarcraftworld-of-warcraftwowSun, 19 May 2013 10:00:00 EST<![CDATA[EVE Online seeks tourney commentators, plans dual character training for Odyssey]]>http://massively.joystiq.com/2013/05/15/eve-onlines-11th-alliance-tourney-makes-changes-needs-commenta/http://massively.joystiq.com/2013/05/15/eve-onlines-11th-alliance-tourney-makes-changes-needs-commenta/http://massively.joystiq.com/2013/05/15/eve-onlines-11th-alliance-tourney-makes-changes-needs-commenta/#commentsFiled under: , , , ,

EVE Online's 11th Alliance tourney makes changes, needs commentators
Want to be a part of EVE Online's 11th annual Alliance Tournament that starts on July 20th, 2013, but not from the cockpit of your ship? You can apply to be one of the PvP commentators who will discuss the tourney, tactics, and teams involved live on air with developers as well as providing commentary on matches as they unfold. Yes, live means you'll actually be in Iceland for this gig! Qualifications include having a valid passport, being over 21, having a sharp wit, and being well-versed in PvP. Full details for the application process are available on the official site.

If you'd prefer to participate in the battles themselves, note that there will be a few changes to the tourney from years past. To start, Alliance Tournament XI will run over only three weekends, not four. Second, qualifying rounds and group stages have been replaced by double elimination from the get go. Next, from the second weekend onward, two ship types will be banned from the match by team captains. And finally, to fly with an alliance you had to have been a member since downtime this morning. Dev blogs covering all the rules, the broadcast schedule, and sign-up details will be coming soon.

[Update: CCP has been busy today! The official site has now also been updated with a dev blog announcing that dual character training will ship with the Odyssey expansion next month.]

MassivelyEVE Online seeks tourney commentators, plans dual character training for Odyssey originally appeared on Massively on Wed, 15 May 2013 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alliance-tournamentAlliance-Tournament-XIccpccp-gamescommentatorseveeve-alliance-tournamenteve-onlineinternet-spaceshipsPvPsandboxsci-fispreadsheets-onlineWed, 15 May 2013 12:00:00 EST<![CDATA[Massively's DUST 514 launch impressions]]>http://massively.joystiq.com/2013/05/15/massivelys-dust-514-launch-impressions/http://massively.joystiq.com/2013/05/15/massivelys-dust-514-launch-impressions/http://massively.joystiq.com/2013/05/15/massivelys-dust-514-launch-impressions/#commentsFiled under: , , , , , , , , , , , , ,

DUST 514 - Dropship and merc troops
Playing EVE on my couch is bizarre. I know, technically it's called DUST 514, but let's be serious. DUST is basically the beginnings of a massive EVE Online expansion if you subscribe to the notion that EVE is a virtual world as opposed to merely a strategy game featuring internet spaceships and internet drama.

I've played EVE in some strange places prior to this. In an airport terminal, for example. On my toilet, even (yes, nature occasionally calls in the middle of a fleet fight and thank God for laptops). But DUST marks the first -- OK, technically the second -- time I've ever played in New Eden with a controller.

Continue reading Massively's DUST 514 launch impressions

MassivelyMassively's DUST 514 launch impressions originally appeared on Massively on Wed, 15 May 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesconsoleconsolesdustdust-514dust-514-impressionsdust-514-reviewdust-hands-ondust-impressionsdust-revieweveeve-onlinefeaturedfpsinternet-spaceshipsmmofpspc-master-raceplaystationplaystation-3ps3sandboxsci-fishooterspreadsheets-onlineWed, 15 May 2013 11:00:00 EST<![CDATA[Newbie tips to surviving the DUST 514 experience]]>http://massively.joystiq.com/2013/05/14/newbie-tips-to-surviving-the-dust-514-experience/http://massively.joystiq.com/2013/05/14/newbie-tips-to-surviving-the-dust-514-experience/http://massively.joystiq.com/2013/05/14/newbie-tips-to-surviving-the-dust-514-experience/#commentsFiled under: , , , , ,

Newbie tips to surviving the DUST 514 experience
It's DUST 514's launch day, and if you've hit dirt with your face more than your combat boots, then you might need a helping hand with CCP's MMO shooter. PlayStation Universe has posted a pair of guides to help new players get off to a strong start, and since Massively cares about each and every one of you, we wanted to pass them along so that you don't end up a shallow grave on an alien world.

The first guide is a hodge-podge of beginner's tips, and the second has to do with earning much-needed skill points. "In the early days, we think it's wise to hoard ISK and SP until a time when you're ready to decide on your specialization," the author writes. "Until then, the Militia Gear is good enough."

Good luck, soldiers! If you have any DUST 514 tips or tricks that you'd like to pass along to other Massively readers, please do so in the comments.

MassivelyNewbie tips to surviving the DUST 514 experience originally appeared on Massively on Tue, 14 May 2013 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>beginners-guideccpccp-gamesconsoledustdust-514eveeve-onlinefpsguideguideshintslaunchmmofpsplaystationplaystation-3ps3releasesandboxsci-fishooterskill-pointssptipstricksTue, 14 May 2013 15:30:00 EST<![CDATA[DUST 514 launch-day roundup]]>http://massively.joystiq.com/2013/05/14/dust-514-launch-day-roundup/http://massively.joystiq.com/2013/05/14/dust-514-launch-day-roundup/http://massively.joystiq.com/2013/05/14/dust-514-launch-day-roundup/#commentsFiled under: , , , , , ,

Dust 514 launchday roundup
This is it, soldier! Training is over, and it's time to head out to war. DUST 514 settles today, officially launching into the New Eden universe also occupied by EVE Online. Available only on the PlayStation 3, this shooter pits forces against each other in a ground assault while orbital strikes rain down from EVE allies and enemies above. Are you ready?

Ah, trapped behind a desk for a while still, are you? Well, don't worry; if you won't have the opportunity to soothe your itchy trigger finger until later, we've got some things to tide you over until you can join the fray yourself. Check out the factional warfare, learn about rewards, and much more in the hands-on experiences, screenshots, videos, news, and impressions after the break.

Continue reading DUST 514 launch-day roundup

MassivelyDUST 514 launch-day roundup originally appeared on Massively on Tue, 14 May 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesconsoledustdust-514eveeve-onlinefpslaunchlaunch-day-round-upmmofpsplaystationplaystation-3ps3round-upsandboxsci-fishooterTue, 14 May 2013 10:00:00 EST<![CDATA[Roguelikes inspire EVE Online's revamped hacking minigame]]>http://massively.joystiq.com/2013/05/13/roguelikes-inspire-eve-onlines-revamped-hacking-minigame/http://massively.joystiq.com/2013/05/13/roguelikes-inspire-eve-onlines-revamped-hacking-minigame/http://massively.joystiq.com/2013/05/13/roguelikes-inspire-eve-onlines-revamped-hacking-minigame/#commentsFiled under: , , , , , , ,

EVE Online hacking screen
June 4th is coming up fast, and with it EVE Online's new Odyssey expansion. The content drop will feature improved explorer pursuits, with particular emphasis on removing the "'sit and wait' aspect of exploration gameplay" in favor of "something interesting to do."

In the case of today's dev blog, the interesting thing to do is hacking, and CCP says that it drew inspiration from roguelikes for the new minigame's "procedurally generated levels, turn-based combat, and permadeath." You can read all about it on the official EVE Online website.

MassivelyRoguelikes inspire EVE Online's revamped hacking minigame originally appeared on Massively on Mon, 13 May 2013 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesdev-blogeveeve-expansioneve-hackingeve-onlineeve-online-odysseyexpansiongame-mechanicshackinginternet-spaceshipsminigamesodysseysandboxsci-fispreadsheets-onlineMon, 13 May 2013 17:30:00 EST<![CDATA[The Stream Team: MLT edition, May 13 - 19, 2013]]>http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/#commentsFiled under: , , ,

The Stream Team May 13 19, 2013
Nothing beats an MLT, especially when the tomato is nice and ripe! Except maybe Massively TV. MMmm mmmm. Now there's something you can really sink your teeth into -- the wild and crazy antics of your favorite Stream Team hosts! And they've got a menu for all tastes this week, from space adventures to dragons to WWII planes. Of course, it all comes with a side of reruns and a dessert highlight to complete your meal.

So pull up a chair and grab yourself a helping or two... or 10. Hey, there's no limit here; enjoy as much as you like! While you're enjoying the spread, be sure to join in the after-dinner chat in Outtakes.

Continue reading The Stream Team: MLT edition, May 13 - 19, 2013

MassivelyThe Stream Team: MLT edition, May 13 - 19, 2013 originally appeared on Massively on Mon, 13 May 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmoactivisionage-of-conanage-of-conan-unchainedagonanetaocaoc-unchainedarenanetarkark-hunterarkfallaventurinebiowareblizzardblizzard-entertainmentbuy-to-playccpccp-gamescity-of-steamconanconsoleconsolescrypticcryptic-studiosdarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodefiancedfdnddota-2Dragonrealmseaelectronic-artselswordeq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfree-to-playfuncomgoblinguild-warsgwhi-rezhi-rez-studioshistoricalhorrorhyboriainternet-spaceshipslivestreamlivestreaminglivestreamslucasartsmabinogimassively-metamassively-tvmechmechanistmechanist-gamesmechsmechwarriormechwarrior-mmomechwarrior-onlinemetammo-shootermobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmwomythologyncsoftneverwinternexonnexon-americaopen-pvpperfect-worldperfect-world-entertainmentpiranhapiranha-gamesplaneplanesplaystation-3playstation3pollps3pvppwesandboxsci-fantasysci-fisecret-worldshooterskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicsteampunkstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorsyfythe-old-republicthe-secret-worldthe-stream-teamthird-person-shootertortpstransmedia-synergytriontrion-worldstswtvtwitchtwitch-tvunchainedunholy-warswarwarcraftwargaming.netwarplanewarplanesworld-of-warcraftworld-of-warplaneswowwowpxboxMon, 13 May 2013 09:00:00 EST<![CDATA[EVE Evolved: Could EVE use twitch controls?]]>http://massively.joystiq.com/2013/05/12/eve-evolved-could-eve-use-twitch-controls/http://massively.joystiq.com/2013/05/12/eve-evolved-could-eve-use-twitch-controls/http://massively.joystiq.com/2013/05/12/eve-evolved-could-eve-use-twitch-controls/#commentsFiled under: , , , , , , , ,

EVE Evolved Could EVE use twitch controls
A few weeks ago, the EVE Online community went nuts for EVR, CCP's exciting new virtual reality dogfighter developed for the upcoming Oculus Rift gaming headset. The game demo was produced by a team of just a handful of developers in just seven weeks using nothing but their spare time, but attendees and press at EVE Fanfest 2013 were nevertheless blown away during test sessions. Though EVR isn't going to be integrated with the EVE universe, Senior Producer Andie Nordgren stated in her Keynote address that CCP will be looking into more immersive flight and combat mechanics for some the game's ships. This comment has sparked a lot of discussion over the possibility of finally getting some direct flight controls in EVE.

The lack of direct twitch-based controls in EVE is often cited by gamers as a big part of the reason they can't get into the game. There's no active dodging of missiles, manual ship targeting, or really complex tactical maneuvers in EVE, but that's kind of the point. Most ships in EVE are colossal lumbering hulks more akin to today's seafaring battleships than fighter planes, and combat with them is more a game of strategy and teamwork than a battle of reaction speeds. But that isn't exactly true of all ships; interceptors and fast microwarpdrive frigates move at several kilometres per second and are so agile that pilots can already pull off some interesting tactical maneuvers. So isn't it about time we made the combat for those ships a bit more visceral and immersive?

In this week's EVE Evolved, I look at the fast-paced world of interceptors and explore how twitch controls and weapon aiming could possibly be implemented without killing the server.

Continue reading EVE Evolved: Could EVE use twitch controls?

MassivelyEVE Evolved: Could EVE use twitch controls? originally appeared on Massively on Sun, 12 May 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>Andie-Nordgrenccpccp-gamescontrolcontrolsdirectdirect-controlsdirect-flightDogfighterDogFightingevasiveeveeve-evolvedeve-onlinefeaturedfrigateinterceptorinterceptorsmaneuvermanoeuvermanualopinionopinion-piecepilotpvpsandboxsci-fispeedtwitchtwitch-combattwitch-controlsvectorzig-zagSun, 12 May 2013 18:00:00 EST<![CDATA[Not So Massively: MOBA patch week, Star Citizen hits $9 million, and Diablo II ladder reset]]>http://massively.joystiq.com/2013/05/06/not-so-massively-moba-patch-week-star-citizen-hits-9-million/http://massively.joystiq.com/2013/05/06/not-so-massively-moba-patch-week-star-citizen-hits-9-million/http://massively.joystiq.com/2013/05/06/not-so-massively-moba-patch-week-star-citizen-hits-9-million/#commentsFiled under: , , , , , , , , , , , , , , , , , , , ,

Not So Massively MOBA patch week, Star Citizen hits $9 million, and Diablo II ladder reset
This week is packed with MOBA news as almost every major title released a new patch. Infinite Crisis introduced new champions Poison Ivy and Gaslight Catwoman and announced that the game's closed beta will start in two days' time on May 8th. SMITE introduced new Norse god Fenrir the Unbound, and League of Legends released a champion spotlight on new Ice Witch champion Lissandra. Dota 2 also released new hero Elder Titan based on the original DotA hero Tauren Chieftain, and Heroes of Newerth released several months of balance changes at once in its colossal version 3.1 update.

Star Citizen celebrated hitting $9 million US in its ongoing crowdfunding campaign, and to celebrate, developers controversially gave all current backers free lifetime insurance on their ships. The title's success has also spurred EVE Online developer CCP Games to show off its own virtual reality dogfighter called EVR that uses the upcoming Oculus Rift headset.

Diablo III's first anniversary is just over a week away; details of any celebrations haven't yet been released. Developers confirmed that the PlayStation 4 version will not be getting mouse and keyboard support and that the PC version won't be getting support for analog controllers. For those of you up for some oldschool dungeon-crawling, Diablo II also announced that its ladder will be reset on May 14th this week and all players will start the game fresh again.

Continue reading Not So Massively: MOBA patch week, Star Citizen hits $9 million, and Diablo II ladder reset

MassivelyNot So Massively: MOBA patch week, Star Citizen hits $9 million, and Diablo II ladder reset originally appeared on Massively on Mon, 06 May 2013 22:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-rpgbattlenetbetabeta-testbeta-testingblizzardblizzard-entertainmentcash-shopccpccp-gameschris-robertscompetitive-gamingconsoled3defense-of-the-ancientsdiablodiablo-2diablo-3diablo-iidiablo-iiidotae-sporte-sportselder-titanesportesportseveeve-onlineevrexploitf2pfantasyfeaturedfree-to-playfreemiumgothic-fantasyhon-tourhontourice-witchinternet-spaceshipsladderladder-resetleagueleague-of-legendslissandralolmicrotransactionmicrotransactionsmobamultiplayernewsnot-so-massivelynsmoculus-riftonline-multiplayeropinionpatch-1.0.8playstationplaystation-3playstation-4Playstation3premiumps4pvpriotriot-gamesroguelikeround-uprounduprpgsandboxsci-fispreadsheets-onlinetauren-chieftaintestingtrailertrailersvideovideosvirtual-realitywitch-doctorMon, 06 May 2013 22:00:00 EST<![CDATA[DUST 514's Uprising update is now live]]>http://massively.joystiq.com/2013/05/06/dust-514s-uprising-update-is-now-live/http://massively.joystiq.com/2013/05/06/dust-514s-uprising-update-is-now-live/http://massively.joystiq.com/2013/05/06/dust-514s-uprising-update-is-now-live/#commentsFiled under: , , , , , , ,

Screenshot -- DUST 514
The official launch of DUST 514 is planned to go live later this month on -- what else -- May 14th. But judging by the latest CCP dev blog, players can expect a whole bevy of new features before the game launches thanks to an update by the name of Uprising which, as it happens, went live today. For starters, the skill system is getting totally revamped in order to "make it more intuitive and deep." CCP is also introducing three new dropsuits to the game, along with a new assault dropship. As if that weren't enough, the studio has "done major rebalancing on weapons, dropsuits, modules, and vehicles." In light of all of these changes, players will be receiving full skill respecs and market refunds. Uprising will also include the addition of the new starmap, new UI and graphics features, and adjustments to the faction warfare system.

But that's not all. When the game officially goes live on the 14th, CCP will introduce DUST's planetary conquest system, which means that DUST players will be able to take part in the great territorial control battles that will tie the game into EVE Online. The launch will also bring a few new weapons and a new game mode (Domination) and new maps over which players can vie for supremacy. If that's not enough to look forward to, then we're not sure what to tell you. For the full details on Uprising and DUST 514's official launch, go on and check out the full dev blog on the game's official site.

MassivelyDUST 514's Uprising update is now live originally appeared on Massively on Mon, 06 May 2013 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesconsoledustdust-514eveeve-onlinefpsmmofpspatchpatchesplaystationplaystation-3ps3sandboxsci-fishooteruprisingMon, 06 May 2013 20:00:00 EST<![CDATA[EVE Online smashes PCU record during anniversary celebrations]]>http://massively.joystiq.com/2013/05/06/eve-online-smashes-pcu-record-during-anniversary-celebrations/http://massively.joystiq.com/2013/05/06/eve-online-smashes-pcu-record-during-anniversary-celebrations/http://massively.joystiq.com/2013/05/06/eve-online-smashes-pcu-record-during-anniversary-celebrations/#commentsFiled under: , , , , , , , , , , , , ,

EVE Online smashes PCU record during anniversary celebrations
Sci-fi MMO EVE Online has seen phenomenal success recently, from breaking through the 500,000 subscriber boundary to successfully relaunching in China. The game officially turned ten years old today, and CCP celebrated the occasion with events and gifts for all current subcribers. The part-jovian Gnosis battlecruiser was given to every subscribed account at midnight last night and can be claimed before the end of the month, and players logging in yesterday or today will have found a whole slew of bonus gifts.

EVE smashed its previous Peak Concurrent User total during the festivities by a clear margin, replacing 2011's record of 63,170 with a new figure of 65,303 players logged in simultaneously. Part of the reason for the record was the huge number of player-run events taking place that evening, such as the ever-popular Flight of a Thousand Rifters. The event saw almost 2,500 players join together to take down player Marlona Sky's expensive supercarrier. Most of the participants were in small frigates like Rifters and ended up being easy prey when a nullsec sniper Loki fleet turned up. The event was nevertheless a massive success and huge fun for those involved. Continue reading for a gallery of screenshots from the event and video footage from player Scott Manley.

Continue reading EVE Online smashes PCU record during anniversary celebrations

MassivelyEVE Online smashes PCU record during anniversary celebrations originally appeared on Massively on Mon, 06 May 2013 13:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>anniversaryccpccp-gamesemergent-gameplayeveeve-onlineflight-of-a-thousand-riftersgnosisinternet-spaceshipsmarlona-skypvprifterrifterssandboxsci-fiscott-manleyspreadsheets-onlineten-year-anniversaryten-yearsthousand-riftersMon, 06 May 2013 13:30:00 EST