Massively http://massively.joystiq.com Massively http://www.blogsmithmedia.com/http://massively.joystiq.com/media/feedlogo.gif Massively http://massively.joystiq.com en-us Copyright 2013 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[EVE Online redesigns radial menu for Odyssey]]>http://massively.joystiq.com/2013/05/21/eve-online-redesigns-radial-menu-for-odyssey/http://massively.joystiq.com/2013/05/21/eve-online-redesigns-radial-menu-for-odyssey/http://massively.joystiq.com/2013/05/21/eve-online-redesigns-radial-menu-for-odyssey/#commentsFiled under: , , , , , ,

EVE Online redesigns radial menu for OdysseyIn looking to trim down some of the menu bloat for EVE Online's Odyssey expansion, CCP Games is resurrecting and redesigning the radial menu to be a "silver bullet" for this issue.

The updated radial menu will be connected to the underutilized left mouse button and is confined to eight segments that will change depending on what the user is clicking. The studio wrote up a blog post on the subject, promising that the redesign is intuitive and will result in faster access to relevant commands.

Initially, the radial menu upgrade will be for ship flight only, although CCP is willing to expand its domain if players find it useful. This feature is currently available on the test server.

MassivelyEVE Online redesigns radial menu for Odyssey originally appeared on Massively on Tue, 21 May 2013 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesdev-blogdev-diaryeveeve-onlineinternet-spaceshipsmenumenusodysseyradial-menusandboxsci-fispreadsheets-onlineTue, 21 May 2013 15:30:00 EST<![CDATA[EVE Mobile is coming according to Jon Lander]]>http://massively.joystiq.com/2013/05/20/eve-mobile-is-coming-according-to-jon-lander/http://massively.joystiq.com/2013/05/20/eve-mobile-is-coming-according-to-jon-lander/http://massively.joystiq.com/2013/05/20/eve-mobile-is-coming-according-to-jon-lander/#commentsFiled under: , , , , , , ,

Now you can stand next to someone, blow up their ship on your phone, then punch them.
If you've ever been involved in a discussion about EVE Online, you've heard it referred to as a sequence of spreadsheets which occasionally let you fly a spaceship. Which certainly has some basis in truth. Certainly it's a game with many possible systems that could be ported to a mobile client, something that CCP's Jon Lander is claiming will be a reality in the near future. Lander has moved from being EVE's executive producer to mobile development, but his new position is clearly still tied to the same game.

Rather than simply being a series of spreadsheets for your smartphone, Lander has made it clear that the mobile team wants for the various EVE mobile apps to be functional games in their own right. It's a field that CCP has explored before, stopping either due to technical hurdles or business concerns. But Lander's confident that players will be using the mobile applications by the time next year's Fanfest rolls around.

MassivelyEVE Mobile is coming according to Jon Lander originally appeared on Massively on Mon, 20 May 2013 20:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gameseveeve-mobileeve-onlineinternet-spaceshipsjon-landermobilemobile-developmentsandboxsci-fispreadsheets-onlineMon, 20 May 2013 20:30:00 EST<![CDATA[The Stream Team: Monocle Day edition, May 20 - 26, 2013]]>http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/#commentsFiled under: , , ,

The Stream Team Monocle day edition, May 20 26, 2013
Two weeks ago, y'all had the chance to select a new holiday to help add some cheer to the otherwise bland weeks in the middle of May. The choices teased and tantalized you, but you're a discriminating crowd. In a race fraught with nail-biting suspense, only one ultimately prevailed. And so it is with further ado we bring to you: Monocle Day!

This Tuesday, May 21st, has been selected to be the auspicious day of this most storied celebration. Why? Because 5/21 splits into 5 + 2 + 1, which of course = 8, and we all know that 8 is just two monocles stacked on top of each other! And as always, Massively TV is here to help you ring in the new holiday, with special shows throughout the entire week. Check out the full schedule of celebratory events hosted by The Stream Team after the break. Then let us know if you'll be wearing your own monocle in honor of the festivities.

Continue reading The Stream Team: Monocle Day edition, May 20 - 26, 2013

MassivelyThe Stream Team: Monocle Day edition, May 20 - 26, 2013 originally appeared on Massively on Mon, 20 May 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>Achaeaaction-mmoactivisionagonanetAnno-Onlinearenanetaventurinebiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamescity-of-steamconsoleconsolescrypticcryptic-studiosdarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodfdndDotA-2dragonDragonrealmsdragonsdragons-propheteaelectronic-artselswordeq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfrfree-realmsfree-to-playfuncomgoblinguild-warsgwhi-rezhi-rez-studioshistoricalhorrorhousinginfernuminfernum-productionsinternet-spaceshipskid-friendlykidskids-mmolivestreamlivestreaminglivestreamslucasartsmassively-metamassively-tvmechanistmechanist-gamesmetamobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftneverwinteropen-pvpperfect-worldperfect-world-entertainmentplaneplanesplaystation-3playstation3pollps3pvppwerunewakerrunewaker-entertainmentsandboxsci-fantasysci-fisecret-worldskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicsteampunkstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorthe-old-republicthe-secret-worldthe-stream-teamthreshold-rpgtortswtwitchtwitch-tvunholy-warswarwarcraftwargaming.netwarplanewarplanesworld-of-warcraftworld-of-warplaneswowwowpMon, 20 May 2013 09:00:00 EST<![CDATA[EVE Evolved: Fanfest 2013 video roundup]]>http://massively.joystiq.com/2013/05/19/eve-evolved-fanfest-2013-video-roundup/http://massively.joystiq.com/2013/05/19/eve-evolved-fanfest-2013-video-roundup/http://massively.joystiq.com/2013/05/19/eve-evolved-fanfest-2013-video-roundup/#commentsFiled under: , , , , , , , , , , , , , , , , , , , , ,

EVE Evolved Fanfest 2013 video roundup
Last month saw the huge tenth anniversary EVE Online Fanfest, a three-day convention packed full of exclusive reveals, behind-the-scenes talks, and community events. This year's Fanfest was the biggest one yet, celebrating EVE's tenth anniversary with special guest speakers from the scientific community, the reveal of a new virtual reality dogfighter, DUST 514's launch, and details of the upcoming Odyssey expansion. Massively was there to bring you coverage of the big news as it happened, and CCP streamed some of the key talks and events live to viewers at home.

This year's Fanfest sold out so quickly that many people who wanted to go didn't get a chance to, and only a select few talks were shown on the public livestream. With such a packed event schedule, even players in attendance couldn't be there for every interesting talk. Thankfully, CCP recorded over 30 of the most anticipated events and has now uploaded the videos to YouTube. Highlights include the Make EVE Real videos, the EVE keynote, the CCP Presents Keynote, and the talks on how DUST 514 integrates with the EVE economy.

In this week's EVE Evolved, I round up all of the EVE Fanfest videos in a handy list.

Continue reading EVE Evolved: Fanfest 2013 video roundup

MassivelyEVE Evolved: Fanfest 2013 video roundup originally appeared on Massively on Sun, 19 May 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alliance-panelapocalypseasteroidasteroid-miningasteroidsbattleshipccpccp-gameschinaconcept-artconsoleconventioncrimewatchcsm-paneldustdust-514economyeveeve-evolvedeve-fanfesteve-fanfest-2013eve-is-realeve-onlineeventeventsfanfestfaster-than-lightfeaturedfpsftlgame-designgearinternet-spaceshipskeynotemake-eve-realminingmmofpsodysseyopinionplanetary-conquestplaystationplaystation-3progressionps3pvpsandboxsci-fishooterspace-elevatorspreadsheets-onlineuprisingSun, 19 May 2013 18:00:00 EST<![CDATA[One Shots: The many lives of Gwen Thackeray]]>http://massively.joystiq.com/2013/05/19/one-shots-the-many-lives-of-gwen-thackeray/http://massively.joystiq.com/2013/05/19/one-shots-the-many-lives-of-gwen-thackeray/http://massively.joystiq.com/2013/05/19/one-shots-the-many-lives-of-gwen-thackeray/#commentsFiled under: , , , , , ,

One Shots Looming death
Hey Gwen, how's it hanging? Find that flute yet? Yeah, don't worry, I'm sure it'll turn up around here somewhere. Don't get too near the river there, girl; those skale have a nasty bite! Say, what's that sulfurous smell in the air? And those distant screams that are drawing nearer at an incredible rate? And a sudden looming premonition that the property values around here are about to take a nosedive?

Reader Sharvis sent in this Guild Wars picture with a modicum of pity: "Here is Gwen moments before the Searing. Poor girl."

Don't feel too sorry for her, Sharvis! She gets an entire expansion, after all!

Continue reading One Shots: The many lives of Gwen Thackeray

MassivelyOne Shots: The many lives of Gwen Thackeray originally appeared on Massively on Sun, 19 May 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>activisionanetarenanetblizzardblizzard-entertainmentbring-back-one-shotsbuy-to-playccpccp-gameseveeve-onlinefantasygalleriesgalleryguild-warsguild-wars-2gwgw2internet-spaceshipsncsoftone-shotspics-or-it-didnt-happenreader-screenshotsreader-submissionssandboxsci-fiscreenshotscreenshotsspreadsheets-onlineuser-submissionswarcraftworld-of-warcraftwowSun, 19 May 2013 10:00:00 EST<![CDATA[EVE Online seeks tourney commentators, plans dual character training for Odyssey]]>http://massively.joystiq.com/2013/05/15/eve-onlines-11th-alliance-tourney-makes-changes-needs-commenta/http://massively.joystiq.com/2013/05/15/eve-onlines-11th-alliance-tourney-makes-changes-needs-commenta/http://massively.joystiq.com/2013/05/15/eve-onlines-11th-alliance-tourney-makes-changes-needs-commenta/#commentsFiled under: , , , ,

EVE Online's 11th Alliance tourney makes changes, needs commentators
Want to be a part of EVE Online's 11th annual Alliance Tournament that starts on July 20th, 2013, but not from the cockpit of your ship? You can apply to be one of the PvP commentators who will discuss the tourney, tactics, and teams involved live on air with developers as well as providing commentary on matches as they unfold. Yes, live means you'll actually be in Iceland for this gig! Qualifications include having a valid passport, being over 21, having a sharp wit, and being well-versed in PvP. Full details for the application process are available on the official site.

If you'd prefer to participate in the battles themselves, note that there will be a few changes to the tourney from years past. To start, Alliance Tournament XI will run over only three weekends, not four. Second, qualifying rounds and group stages have been replaced by double elimination from the get go. Next, from the second weekend onward, two ship types will be banned from the match by team captains. And finally, to fly with an alliance you had to have been a member since downtime this morning. Dev blogs covering all the rules, the broadcast schedule, and sign-up details will be coming soon.

[Update: CCP has been busy today! The official site has now also been updated with a dev blog announcing that dual character training will ship with the Odyssey expansion next month.]

MassivelyEVE Online seeks tourney commentators, plans dual character training for Odyssey originally appeared on Massively on Wed, 15 May 2013 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alliance-tournamentAlliance-Tournament-XIccpccp-gamescommentatorseveeve-alliance-tournamenteve-onlineinternet-spaceshipsPvPsandboxsci-fispreadsheets-onlineWed, 15 May 2013 12:00:00 EST<![CDATA[Massively's DUST 514 launch impressions]]>http://massively.joystiq.com/2013/05/15/massivelys-dust-514-launch-impressions/http://massively.joystiq.com/2013/05/15/massivelys-dust-514-launch-impressions/http://massively.joystiq.com/2013/05/15/massivelys-dust-514-launch-impressions/#commentsFiled under: , , , , , , , , , , , , ,

DUST 514 - Dropship and merc troops
Playing EVE on my couch is bizarre. I know, technically it's called DUST 514, but let's be serious. DUST is basically the beginnings of a massive EVE Online expansion if you subscribe to the notion that EVE is a virtual world as opposed to merely a strategy game featuring internet spaceships and internet drama.

I've played EVE in some strange places prior to this. In an airport terminal, for example. On my toilet, even (yes, nature occasionally calls in the middle of a fleet fight and thank God for laptops). But DUST marks the first -- OK, technically the second -- time I've ever played in New Eden with a controller.

Continue reading Massively's DUST 514 launch impressions

MassivelyMassively's DUST 514 launch impressions originally appeared on Massively on Wed, 15 May 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesconsoleconsolesdustdust-514dust-514-impressionsdust-514-reviewdust-hands-ondust-impressionsdust-revieweveeve-onlinefeaturedfpsinternet-spaceshipsmmofpspc-master-raceplaystationplaystation-3ps3sandboxsci-fishooterspreadsheets-onlineWed, 15 May 2013 11:00:00 EST<![CDATA[Newbie tips to surviving the DUST 514 experience]]>http://massively.joystiq.com/2013/05/14/newbie-tips-to-surviving-the-dust-514-experience/http://massively.joystiq.com/2013/05/14/newbie-tips-to-surviving-the-dust-514-experience/http://massively.joystiq.com/2013/05/14/newbie-tips-to-surviving-the-dust-514-experience/#commentsFiled under: , , , , ,

Newbie tips to surviving the DUST 514 experience
It's DUST 514's launch day, and if you've hit dirt with your face more than your combat boots, then you might need a helping hand with CCP's MMO shooter. PlayStation Universe has posted a pair of guides to help new players get off to a strong start, and since Massively cares about each and every one of you, we wanted to pass them along so that you don't end up a shallow grave on an alien world.

The first guide is a hodge-podge of beginner's tips, and the second has to do with earning much-needed skill points. "In the early days, we think it's wise to hoard ISK and SP until a time when you're ready to decide on your specialization," the author writes. "Until then, the Militia Gear is good enough."

Good luck, soldiers! If you have any DUST 514 tips or tricks that you'd like to pass along to other Massively readers, please do so in the comments.

MassivelyNewbie tips to surviving the DUST 514 experience originally appeared on Massively on Tue, 14 May 2013 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>beginners-guideccpccp-gamesconsoledustdust-514eveeve-onlinefpsguideguideshintslaunchmmofpsplaystationplaystation-3ps3releasesandboxsci-fishooterskill-pointssptipstricksTue, 14 May 2013 15:30:00 EST<![CDATA[DUST 514 launch-day roundup]]>http://massively.joystiq.com/2013/05/14/dust-514-launch-day-roundup/http://massively.joystiq.com/2013/05/14/dust-514-launch-day-roundup/http://massively.joystiq.com/2013/05/14/dust-514-launch-day-roundup/#commentsFiled under: , , , , , ,

Dust 514 launchday roundup
This is it, soldier! Training is over, and it's time to head out to war. DUST 514 settles today, officially launching into the New Eden universe also occupied by EVE Online. Available only on the PlayStation 3, this shooter pits forces against each other in a ground assault while orbital strikes rain down from EVE allies and enemies above. Are you ready?

Ah, trapped behind a desk for a while still, are you? Well, don't worry; if you won't have the opportunity to soothe your itchy trigger finger until later, we've got some things to tide you over until you can join the fray yourself. Check out the factional warfare, learn about rewards, and much more in the hands-on experiences, screenshots, videos, news, and impressions after the break.

Continue reading DUST 514 launch-day roundup

MassivelyDUST 514 launch-day roundup originally appeared on Massively on Tue, 14 May 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesconsoledustdust-514eveeve-onlinefpslaunchlaunch-day-round-upmmofpsplaystationplaystation-3ps3round-upsandboxsci-fishooterTue, 14 May 2013 10:00:00 EST<![CDATA[Roguelikes inspire EVE Online's revamped hacking minigame]]>http://massively.joystiq.com/2013/05/13/roguelikes-inspire-eve-onlines-revamped-hacking-minigame/http://massively.joystiq.com/2013/05/13/roguelikes-inspire-eve-onlines-revamped-hacking-minigame/http://massively.joystiq.com/2013/05/13/roguelikes-inspire-eve-onlines-revamped-hacking-minigame/#commentsFiled under: , , , , , , ,

EVE Online hacking screen
June 4th is coming up fast, and with it EVE Online's new Odyssey expansion. The content drop will feature improved explorer pursuits, with particular emphasis on removing the "'sit and wait' aspect of exploration gameplay" in favor of "something interesting to do."

In the case of today's dev blog, the interesting thing to do is hacking, and CCP says that it drew inspiration from roguelikes for the new minigame's "procedurally generated levels, turn-based combat, and permadeath." You can read all about it on the official EVE Online website.

MassivelyRoguelikes inspire EVE Online's revamped hacking minigame originally appeared on Massively on Mon, 13 May 2013 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesdev-blogeveeve-expansioneve-hackingeve-onlineeve-online-odysseyexpansiongame-mechanicshackinginternet-spaceshipsminigamesodysseysandboxsci-fispreadsheets-onlineMon, 13 May 2013 17:30:00 EST<![CDATA[The Stream Team: MLT edition, May 13 - 19, 2013]]>http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/#commentsFiled under: , , ,

The Stream Team May 13 19, 2013
Nothing beats an MLT, especially when the tomato is nice and ripe! Except maybe Massively TV. MMmm mmmm. Now there's something you can really sink your teeth into -- the wild and crazy antics of your favorite Stream Team hosts! And they've got a menu for all tastes this week, from space adventures to dragons to WWII planes. Of course, it all comes with a side of reruns and a dessert highlight to complete your meal.

So pull up a chair and grab yourself a helping or two... or 10. Hey, there's no limit here; enjoy as much as you like! While you're enjoying the spread, be sure to join in the after-dinner chat in Outtakes.

Continue reading The Stream Team: MLT edition, May 13 - 19, 2013

MassivelyThe Stream Team: MLT edition, May 13 - 19, 2013 originally appeared on Massively on Mon, 13 May 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmoactivisionage-of-conanage-of-conan-unchainedagonanetaocaoc-unchainedarenanetarkark-hunterarkfallaventurinebiowareblizzardblizzard-entertainmentbuy-to-playccpccp-gamescity-of-steamconanconsoleconsolescrypticcryptic-studiosdarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodefiancedfdnddota-2Dragonrealmseaelectronic-artselswordeq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfree-to-playfuncomgoblinguild-warsgwhi-rezhi-rez-studioshistoricalhorrorhyboriainternet-spaceshipslivestreamlivestreaminglivestreamslucasartsmabinogimassively-metamassively-tvmechmechanistmechanist-gamesmechsmechwarriormechwarrior-mmomechwarrior-onlinemetammo-shootermobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmwomythologyncsoftneverwinternexonnexon-americaopen-pvpperfect-worldperfect-world-entertainmentpiranhapiranha-gamesplaneplanesplaystation-3playstation3pollps3pvppwesandboxsci-fantasysci-fisecret-worldshooterskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicsteampunkstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorsyfythe-old-republicthe-secret-worldthe-stream-teamthird-person-shootertortpstransmedia-synergytriontrion-worldstswtvtwitchtwitch-tvunchainedunholy-warswarwarcraftwargaming.netwarplanewarplanesworld-of-warcraftworld-of-warplaneswowwowpxboxMon, 13 May 2013 09:00:00 EST<![CDATA[EVE Evolved: Could EVE use twitch controls?]]>http://massively.joystiq.com/2013/05/12/eve-evolved-could-eve-use-twitch-controls/http://massively.joystiq.com/2013/05/12/eve-evolved-could-eve-use-twitch-controls/http://massively.joystiq.com/2013/05/12/eve-evolved-could-eve-use-twitch-controls/#commentsFiled under: , , , , , , , ,

EVE Evolved Could EVE use twitch controls
A few weeks ago, the EVE Online community went nuts for EVR, CCP's exciting new virtual reality dogfighter developed for the upcoming Oculus Rift gaming headset. The game demo was produced by a team of just a handful of developers in just seven weeks using nothing but their spare time, but attendees and press at EVE Fanfest 2013 were nevertheless blown away during test sessions. Though EVR isn't going to be integrated with the EVE universe, Senior Producer Andie Nordgren stated in her Keynote address that CCP will be looking into more immersive flight and combat mechanics for some the game's ships. This comment has sparked a lot of discussion over the possibility of finally getting some direct flight controls in EVE.

The lack of direct twitch-based controls in EVE is often cited by gamers as a big part of the reason they can't get into the game. There's no active dodging of missiles, manual ship targeting, or really complex tactical maneuvers in EVE, but that's kind of the point. Most ships in EVE are colossal lumbering hulks more akin to today's seafaring battleships than fighter planes, and combat with them is more a game of strategy and teamwork than a battle of reaction speeds. But that isn't exactly true of all ships; interceptors and fast microwarpdrive frigates move at several kilometres per second and are so agile that pilots can already pull off some interesting tactical maneuvers. So isn't it about time we made the combat for those ships a bit more visceral and immersive?

In this week's EVE Evolved, I look at the fast-paced world of interceptors and explore how twitch controls and weapon aiming could possibly be implemented without killing the server.

Continue reading EVE Evolved: Could EVE use twitch controls?

MassivelyEVE Evolved: Could EVE use twitch controls? originally appeared on Massively on Sun, 12 May 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>Andie-Nordgrenccpccp-gamescontrolcontrolsdirectdirect-controlsdirect-flightDogfighterDogFightingevasiveeveeve-evolvedeve-onlinefeaturedfrigateinterceptorinterceptorsmaneuvermanoeuvermanualopinionopinion-piecepilotpvpsandboxsci-fispeedtwitchtwitch-combattwitch-controlsvectorzig-zagSun, 12 May 2013 18:00:00 EST<![CDATA[Not So Massively: MOBA patch week, Star Citizen hits $9 million, and Diablo II ladder reset]]>http://massively.joystiq.com/2013/05/06/not-so-massively-moba-patch-week-star-citizen-hits-9-million/http://massively.joystiq.com/2013/05/06/not-so-massively-moba-patch-week-star-citizen-hits-9-million/http://massively.joystiq.com/2013/05/06/not-so-massively-moba-patch-week-star-citizen-hits-9-million/#commentsFiled under: , , , , , , , , , , , , , , , , , , , ,

Not So Massively MOBA patch week, Star Citizen hits $9 million, and Diablo II ladder reset
This week is packed with MOBA news as almost every major title released a new patch. Infinite Crisis introduced new champions Poison Ivy and Gaslight Catwoman and announced that the game's closed beta will start in two days' time on May 8th. SMITE introduced new Norse god Fenrir the Unbound, and League of Legends released a champion spotlight on new Ice Witch champion Lissandra. Dota 2 also released new hero Elder Titan based on the original DotA hero Tauren Chieftain, and Heroes of Newerth released several months of balance changes at once in its colossal version 3.1 update.

Star Citizen celebrated hitting $9 million US in its ongoing crowdfunding campaign, and to celebrate, developers controversially gave all current backers free lifetime insurance on their ships. The title's success has also spurred EVE Online developer CCP Games to show off its own virtual reality dogfighter called EVR that uses the upcoming Oculus Rift headset.

Diablo III's first anniversary is just over a week away; details of any celebrations haven't yet been released. Developers confirmed that the PlayStation 4 version will not be getting mouse and keyboard support and that the PC version won't be getting support for analog controllers. For those of you up for some oldschool dungeon-crawling, Diablo II also announced that its ladder will be reset on May 14th this week and all players will start the game fresh again.

Continue reading Not So Massively: MOBA patch week, Star Citizen hits $9 million, and Diablo II ladder reset

MassivelyNot So Massively: MOBA patch week, Star Citizen hits $9 million, and Diablo II ladder reset originally appeared on Massively on Mon, 06 May 2013 22:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-rpgbattlenetbetabeta-testbeta-testingblizzardblizzard-entertainmentcash-shopccpccp-gameschris-robertscompetitive-gamingconsoled3defense-of-the-ancientsdiablodiablo-2diablo-3diablo-iidiablo-iiidotae-sporte-sportselder-titanesportesportseveeve-onlineevrexploitf2pfantasyfeaturedfree-to-playfreemiumgothic-fantasyhon-tourhontourice-witchinternet-spaceshipsladderladder-resetleagueleague-of-legendslissandralolmicrotransactionmicrotransactionsmobamultiplayernewsnot-so-massivelynsmoculus-riftonline-multiplayeropinionpatch-1.0.8playstationplaystation-3playstation-4Playstation3premiumps4pvpriotriot-gamesroguelikeround-uprounduprpgsandboxsci-fispreadsheets-onlinetauren-chieftaintestingtrailertrailersvideovideosvirtual-realitywitch-doctorMon, 06 May 2013 22:00:00 EST<![CDATA[DUST 514's Uprising update is now live]]>http://massively.joystiq.com/2013/05/06/dust-514s-uprising-update-is-now-live/http://massively.joystiq.com/2013/05/06/dust-514s-uprising-update-is-now-live/http://massively.joystiq.com/2013/05/06/dust-514s-uprising-update-is-now-live/#commentsFiled under: , , , , , , ,

Screenshot -- DUST 514
The official launch of DUST 514 is planned to go live later this month on -- what else -- May 14th. But judging by the latest CCP dev blog, players can expect a whole bevy of new features before the game launches thanks to an update by the name of Uprising which, as it happens, went live today. For starters, the skill system is getting totally revamped in order to "make it more intuitive and deep." CCP is also introducing three new dropsuits to the game, along with a new assault dropship. As if that weren't enough, the studio has "done major rebalancing on weapons, dropsuits, modules, and vehicles." In light of all of these changes, players will be receiving full skill respecs and market refunds. Uprising will also include the addition of the new starmap, new UI and graphics features, and adjustments to the faction warfare system.

But that's not all. When the game officially goes live on the 14th, CCP will introduce DUST's planetary conquest system, which means that DUST players will be able to take part in the great territorial control battles that will tie the game into EVE Online. The launch will also bring a few new weapons and a new game mode (Domination) and new maps over which players can vie for supremacy. If that's not enough to look forward to, then we're not sure what to tell you. For the full details on Uprising and DUST 514's official launch, go on and check out the full dev blog on the game's official site.

MassivelyDUST 514's Uprising update is now live originally appeared on Massively on Mon, 06 May 2013 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesconsoledustdust-514eveeve-onlinefpsmmofpspatchpatchesplaystationplaystation-3ps3sandboxsci-fishooteruprisingMon, 06 May 2013 20:00:00 EST<![CDATA[World of Darkness 'years away' from launch]]>http://massively.joystiq.com/2013/05/06/world-of-darkness-years-away-from-launch/http://massively.joystiq.com/2013/05/06/world-of-darkness-years-away-from-launch/http://massively.joystiq.com/2013/05/06/world-of-darkness-years-away-from-launch/#commentsFiled under: , , , , ,

World of Darkness still has years of development ahead of it
If you are hanging your hopes and dreams on World of Darkness coming along to rescue you from the humdrum of life and your precious mortality, well... be prepared to settle in for a good long wait. Executive Producer Chris McDonough said in an interview that the title is still in pre-production and that players shouldn't expect to see it for a few years yet. However, CCP did show a few technical videos to the press to assure folks that the game is still alive.

McDonough did have good news to share, however. World of Darkness has a 70-person crew that is currently building the framework for the title, and according to the producer, they are "making phenomenal progress." The team plans to host the entire game on a single server where active combat and politicking between vampires will be the crux of the content.

"We're making sure this is a next-generation MMO. It's very focused on movement and motion and capturing what it's like to be a vampire," he said. "People ask about our high level designs for World of Darkness, and we've called this a vampire simulator. What's it like to be a vampire. Not a superhero, but a super-powered individual. The way the characters move around the city feels very vampiric."

MassivelyWorld of Darkness 'years away' from launch originally appeared on Massively on Mon, 06 May 2013 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alphabetaccpccp-gamesChris-McDonoughfantasygothichorrormasqueradepre-productionsupernaturalvampirevampireswhite-wolfwodworld-of-darknessMon, 06 May 2013 17:00:00 EST<![CDATA[EVE Online smashes PCU record during anniversary celebrations]]>http://massively.joystiq.com/2013/05/06/eve-online-smashes-pcu-record-during-anniversary-celebrations/http://massively.joystiq.com/2013/05/06/eve-online-smashes-pcu-record-during-anniversary-celebrations/http://massively.joystiq.com/2013/05/06/eve-online-smashes-pcu-record-during-anniversary-celebrations/#commentsFiled under: , , , , , , , , , , , , ,

EVE Online smashes PCU record during anniversary celebrations
Sci-fi MMO EVE Online has seen phenomenal success recently, from breaking through the 500,000 subscriber boundary to successfully relaunching in China. The game officially turned ten years old today, and CCP celebrated the occasion with events and gifts for all current subcribers. The part-jovian Gnosis battlecruiser was given to every subscribed account at midnight last night and can be claimed before the end of the month, and players logging in yesterday or today will have found a whole slew of bonus gifts.

EVE smashed its previous Peak Concurrent User total during the festivities by a clear margin, replacing 2011's record of 63,170 with a new figure of 65,303 players logged in simultaneously. Part of the reason for the record was the huge number of player-run events taking place that evening, such as the ever-popular Flight of a Thousand Rifters. The event saw almost 2,500 players join together to take down player Marlona Sky's expensive supercarrier. Most of the participants were in small frigates like Rifters and ended up being easy prey when a nullsec sniper Loki fleet turned up. The event was nevertheless a massive success and huge fun for those involved. Continue reading for a gallery of screenshots from the event and video footage from player Scott Manley.

Continue reading EVE Online smashes PCU record during anniversary celebrations

MassivelyEVE Online smashes PCU record during anniversary celebrations originally appeared on Massively on Mon, 06 May 2013 13:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>anniversaryccpccp-gamesemergent-gameplayeveeve-onlineflight-of-a-thousand-riftersgnosisinternet-spaceshipsmarlona-skypvprifterrifterssandboxsci-fiscott-manleyspreadsheets-onlineten-year-anniversaryten-yearsthousand-riftersMon, 06 May 2013 13:30:00 EST<![CDATA[The Stream Team: Seis de Mayo edition, May 6 - 12, 2013]]>http://massively.joystiq.com/2013/05/06/the-stream-team-seis-de-mayo-edition-may-6-12-2013/http://massively.joystiq.com/2013/05/06/the-stream-team-seis-de-mayo-edition-may-6-12-2013/http://massively.joystiq.com/2013/05/06/the-stream-team-seis-de-mayo-edition-may-6-12-2013/#commentsFiled under: , , ,

The Stream Team Seis de Mayo edition, May 6 12, 2013
You have to agree, May is one month that's full of holidays. The first week alone contains May Day, (unofficial) Star Wars Day, and Cinco de Mayo. But the party doesn't stop there! Following quickly on the heels of these is perhaps one you are less familiar with: Seis de Mayo.

Not unlike its cousin the day before, Seis de Mayo is a day of celebration; however, this celebration centers on freedom from boredom via visual entertainment. No, really! And to commemorate the day, we're releasing an all-new Massively TV schedule, giving you the means to celebrate the whole week through with The Stream Team. If you can't celebrate live, just tune into a rerun and party whenever.

Well, even if you don't believe us, you can still commemorate the occasion with us. Just check out the past the cut for a heaping helping of daily festivities.

Continue reading The Stream Team: Seis de Mayo edition, May 6 - 12, 2013

MassivelyThe Stream Team: Seis de Mayo edition, May 6 - 12, 2013 originally appeared on Massively on Mon, 06 May 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmoactivisionage-of-conanage-of-conan-unchainedagonaionanetaocaoc-unchainedarenanetarkark-hunterarkfallascensionaventurinebiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamesclone-warsclone-wars-adventuresconanconsoleconsolescrypticcryptic-studioscwadarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodefiancedfdnddota-2dragondragonsdragons-propheteaelectronic-artseq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfamilyfantasyfeaturedfpsfree-to-playfuncomguild-warsguild-wars-2gwgw2heroes-and-generalshi-rezhi-rez-studioshousinghyboriainfernuminfernum-productionsinternet-spaceshipskid-friendlykidskids-mmokingsislekingsisle-entertainmentlivestreamlivestreaminglivestreamslobbylucasartsmabinogimassively-metamassively-tvmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemetaminigamemmo-shootermmofpsmobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmwoncsoftneverwinternexonnexon-americaopen-pvpperfect-worldperfect-world-entertainmentpiranhapiranha-gamesplanetsideplanetside-2playstation-3playstation3pollps2ps3pvppwerunewakerrunewaker-entertainmentsandboxsci-fantasysci-fishooterSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsuperherosuperheroesswtorsyfythe-old-republicthe-stream-teamthird-person-shootertorTorchlight-2torchlight-iitpstransmedia-synergytriontrion-worldstruly-freetvtwitchtwitch-tvunchainedunholy-warswarcraftwarmage-battlegroundswizard101world-of-warcraftwowxboxMon, 06 May 2013 09:00:00 EST<![CDATA[EVE Evolved: Ten years of EVE Online]]>http://massively.joystiq.com/2013/05/05/eve-evolved-ten-years-of-eve-online/http://massively.joystiq.com/2013/05/05/eve-evolved-ten-years-of-eve-online/http://massively.joystiq.com/2013/05/05/eve-evolved-ten-years-of-eve-online/#commentsFiled under: , , , , , , , , , , , , , , , , , , , , , , , ,

EVE Evolved Ten years of EVE Online
Tomorrow marks a huge milestone in MMO history as sci-fi sandbox EVE Online officially turns ten years old. Released by a tiny icelandic development studio whose only previous release was a board game featuring Reykjavik's favourite cross-dressing mayor, EVE has slowly grown over the past decade to become one of the industry's biggest and most stable subscription titles. Following 2011's monoclegate scandal that led to around 8% of players quitting and CCP Games shedding 20% of its employees, this year saw EVE Online climb to new heights as it regained the playerbase's confidence and smashed the 500,000 subscriber barrier. As a special side-note, the EVE Evolved column also turned five years old last week; it has now officially been running for over half of EVE's lifetime.

The past year has been remarkably successful for CCP, with both of the year's EVE expansions being extremely well received and console MMOFPS DUST 514 finally starting to take shape. The Inferno and Retribution expansions fixed a staggering number of small issues that were broken in the game while also making big changes to bounty-hunting, piracy, and PvP across the board. We also saw huge emergent events like the Battle of Asakai, a $6,000 ship kill, and the five trillion ISK faction warfare exploit this year. With DUST 514 officially launching in just over a week on May 14th and players fired up about the upcoming Odyssey expansion, the future's looking bright for EVE Online as it heads into its second decade.

In this week's EVE Evolved, I look back at some of year's top EVE stories, stories that touched real life, and what the future holds for EVE's second decade.

Continue reading EVE Evolved: Ten years of EVE Online

MassivelyEVE Evolved: Ten years of EVE Online originally appeared on Massively on Sun, 05 May 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>6000-dollarsanniversaryanniversary-eventbounty-huntingcapsuleerccpccp-gamesconsolecrimewatchcynocyno-vigildeaddeathdecadedustdust-514eveeve-evolvedeve-fanfesteve-fanfest-2013eve-onlineeve-sourceexpansionexpansionsexploitfaction-warfarefanfestfeaturedfpsinfernointernet-spaceshipsinterviewinterviewskillkillmailkillmailslibyammofpsnuke-them-from-orbitodysseyopinionpiracyplaystationplaystation-3ps3pvpretributionsafetysandboxsci-fisean-smithsecond-decadeship-killshooterspreadsheets-onlineten-year-anniversaryten-yearsten-years-oldthe-second-decadetrailervideovigilvile-ratweapon-safetySun, 05 May 2013 18:00:00 EST<![CDATA[EVE Online celebrates 10 years of smuggling, intrigue, and the magic of teamwork]]>http://massively.joystiq.com/2013/05/03/eve-online-celebrates-10-years-of-smuggling-intrigue-and-the-m/http://massively.joystiq.com/2013/05/03/eve-online-celebrates-10-years-of-smuggling-intrigue-and-the-m/http://massively.joystiq.com/2013/05/03/eve-online-celebrates-10-years-of-smuggling-intrigue-and-the-m/#commentsFiled under: , , , , , ,

EVE
There ain't no party like an EVE Online 10-year anniversary party because an EVE Online 10-year anniversary party uses Facebook "likes" to unlock in-game gifts and fireworks.

No, really.

Every "like" that EVE Online's Facebook page receives will help unlock free gifts for players and hourly firework drops. The gifts will be handed out after downtime on Sunday the 5th of May. There will also be an attempt to break the current PCU record, so the park your accounts and enjoy the display. To keep you entertained, there will be two "Hunt a Dev" roams, prizes, and oodles of player events. You can check out all the details on the official page.

MassivelyEVE Online celebrates 10 years of smuggling, intrigue, and the magic of teamwork originally appeared on Massively on Fri, 03 May 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>10-year-anniversaryanniversaryccpccp-gameseveeve-onlineinternet-spaceshipssandboxsci-fispreadsheets-onlineFri, 03 May 2013 15:00:00 EST<![CDATA[EVE Online introduces a new way to raise your security status]]>http://massively.joystiq.com/2013/05/02/eve-online-introduces-a-new-way-to-raise-your-security-status/http://massively.joystiq.com/2013/05/02/eve-online-introduces-a-new-way-to-raise-your-security-status/http://massively.joystiq.com/2013/05/02/eve-online-introduces-a-new-way-to-raise-your-security-status/#commentsFiled under: , , , , , ,

EVE Online introduces pirate NPCs and a new way to raise your security status
EVE Online players will soon have a new method by which to raise their security status: New pirate NPCs are being added to asteroid belts in low-security space. Upon death, these pirates drop a new sort of pirate tag, which can be taken into low-sec CONCORD stations and turned in at the Security Office to raise a character's security status.

It should be noted that this is a viable method only for raising your security status up to zero. To get a positive status, you'll need to go through more traditional methods. Additionally, the tags can be traded on the market like most goods, giving players different ways to acquire them.

You can check out all the details on the dev blog.

MassivelyEVE Online introduces a new way to raise your security status originally appeared on Massively on Thu, 02 May 2013 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gameseveeve-onlineinternet-spaceshipssandboxsci-fispreadsheets-onlineThu, 02 May 2013 15:30:00 EST<![CDATA[DUST 514 launches on May 14]]>http://massively.joystiq.com/2013/04/27/dust-514-launches-on-may-14/http://massively.joystiq.com/2013/04/27/dust-514-launches-on-may-14/http://massively.joystiq.com/2013/04/27/dust-514-launches-on-may-14/#commentsFiled under: , , , , , , , , , ,

DUST 514 launches on May 14
CCP Games has just announced at this weekend's EVE Fanfest that the wait for DUST 514 will soon be over: DUST 514 is launching on May 14th.

The free-to-play PlayStation 3 shooter is built to connect with CCP's sci-fi MMORPG sandbox, EVE Online; players in one game can directly influence the players in the other.

"Gamers can look forward to an ever-progressing game, built on the experience CCP has gathered over the past decade, as new features and upgrades are rolled out for years to come," declares the press release posted today. Massively published a hands-on with the game in January.

[Source: CCP press release]

Gallery: DUST 514

Continue reading DUST 514 launches on May 14

MassivelyDUST 514 launches on May 14 originally appeared on Massively on Sat, 27 Apr 2013 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesconsoledustdust-514eveeve-fanfesteve-fanfest-2013eve-onlineeve-online-fanfesteve-online-fanfest-2013eventevent-coveragefanfestfpsgalleriesgalleryicelandlaunchlaunch-datemassively-event-coveragemmofpsplaystationplaystation-3ps3rekyjaviksandboxsci-fiscreenshotscreenshotsshooterSat, 27 Apr 2013 16:30:00 EST<![CDATA[EVE Fanfest 2013 day one: DUST 514, wormholes, and lowsec PvP]]>http://massively.joystiq.com/2013/04/25/eve-fanfest-2013-day-one-dust-514-wormholes-and-lowsec-pvp/http://massively.joystiq.com/2013/04/25/eve-fanfest-2013-day-one-dust-514-wormholes-and-lowsec-pvp/http://massively.joystiq.com/2013/04/25/eve-fanfest-2013-day-one-dust-514-wormholes-and-lowsec-pvp/#commentsFiled under: , , , , , , , , , , , , , , , , , , ,

EVE Fanfest 2013 day one roundup DUST 514, wormholes, lowsec PvP and Retribution
The 10th anniversary EVE Online Fanfest is beyond massive, with over 1,400 players piling into Reykjavik's Harpa building for three days of intense internet spaceshippery. Players fly from across the world to meet their corpmates and chat with other players as passionate about EVE as they are. CCP runs a packed schedule of game design presentations, reveals, and roundtable discussions with players, but for many attendees, the event is about being a part of a tight-knit community that usually exists only inside a game server.

CCP made the bold statement to the press team this morning that its goal is "to create virtual worlds more meaningful than real life," and with so many people flying across the world to meet other players face to face, I'd say the studio has succeeded. Today saw talks on EVE's hugely successful Retribution expansion, ship rebalancing, map generation in DUST 514, and lowsec PvP, and of course, we attended the DUST 514 keynote speech. There were also some hilarious shenanigans with the wormhole roundtable room filling to bursting and a guest science lecture on the possibility of faster than light travel in real life.

Continue reading EVE Fanfest 2013 day one: DUST 514, wormholes, and lowsec PvP

MassivelyEVE Fanfest 2013 day one: DUST 514, wormholes, and lowsec PvP originally appeared on Massively on Thu, 25 Apr 2013 23:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesconsoledustdust-514eveeve-fanfesteve-fanfest-2013eve-onlineeve-online-fanfesteve-online-fanfest-2013eventevent-coveragefanfestfeaturedfpsgraphicsicelandinternet-spaceshipslowsecmassively-event-coveragemmofpsnewspiracypirateplanetary-interactionplaystationplaystation-3previewpreviewsps3pvprekyjaviksandboxsci-fishooterspreadsheets-onlineterritorial-controlvideovideoswormholewormhole-explorationwormholesThu, 25 Apr 2013 23:00:00 EST<![CDATA[EVE Online store reopens with new products]]>http://massively.joystiq.com/2013/04/25/eve-online-store-reopens-with-new-products/http://massively.joystiq.com/2013/04/25/eve-online-store-reopens-with-new-products/http://massively.joystiq.com/2013/04/25/eve-online-store-reopens-with-new-products/#commentsFiled under: , , ,

EVE Online store reopens with new products
What better way to express your love for EVE Online than with EVE-branded clothing? OK, well, a tattoo might beat that, but you'll have less regret with a Concord Ops jacket.

CCP has announced today that its EVE store has reopened, allowing fans of the popular space MMO to buy starmap-adorned t-shirts and Guristas jackets to their hearts' content. In addition to what's currently available on the store, CCP plans to announce all new products (an expansion pack for the store, if you will) at this weekend's Fanfest.

Speaking of Fanfest, you can follow our coverage of the Icelandic party event all weekend.

MassivelyEVE Online store reopens with new products originally appeared on Massively on Thu, 25 Apr 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesclothingeveeve-onlineeve-storeinternet-spaceshipsreal-world-merchsandboxsci-fispreadsheets-onlineThu, 25 Apr 2013 11:00:00 EST<![CDATA[EVE Evolved: Five years of EVE Evolved]]>http://massively.joystiq.com/2013/04/21/eve-evolved-five-years-of-eve-evolved/http://massively.joystiq.com/2013/04/21/eve-evolved-five-years-of-eve-evolved/http://massively.joystiq.com/2013/04/21/eve-evolved-five-years-of-eve-evolved/#commentsFiled under: , , , , , , , , , , , , , , , , , ,

EVE Evolved title image
About five years ago, on April 27th, 2008, I joined the Massively team and wrote the very first issue of the EVE Evolved column. Five years later, the column is still going strong and delivering its weekly dose of EVE Online to thousands of readers. I used to worry about running out of ideas to write about, but regular game updates and hilarious player shenanigans mean there's always something interesting going on in New Eden. When EVE hits its 10th anniversary in May, this column will have been running for just over half of the game's lifetime. In that time, I've written over 250 in-depth articles, guides, in-game stories and opinion pieces on EVE Online and a few on DUST 514.

As usual, I'll be celebrating this anniversary by rounding up this year's column highlights and giving away two 30-day Pilot's License Extensions to two lucky readers. To enter the competition, write a comment explaining which EVE Evolved articles from this year you liked best and what topics you'd like to see covered in the coming year. You will need an active EVE account to claim the prize, so be sure to include your character name in your comment if you want to be in with a chance. If you'd rather not give out your character name or don't have an EVE account but would like to give the game a go, you can sign up a new trial account and use the name of your new character.

In this week's EVE Evolved, I look back at the highlights from the column's fifth year!

Continue reading EVE Evolved: Five years of EVE Evolved

MassivelyEVE Evolved: Five years of EVE Evolved originally appeared on Massively on Sun, 21 Apr 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>anetanniversaryapocryphaasakaibaitingbounty-hunterbounty-huntingccpccp-gamesconsolecrimewatchcruisersdecadedustdust-514eoneveeve-evolvedeve-onlineexpansionexpansionsexplorationfeaturedfive-year-anniversaryfive-yearsfpsfrigatesgame-designguideguideshistoryhulkinfernolowsecmmofpsnyphurodysseyopinionopinion-piecepiracyplaystationplaystation-3ps3pvepvpretributionrisk-vs-rewardsandboxsci-fiship-fittingship-fittingsship-setupsshooterspeculationstoriesstorystorytellingthe-battle-for-caldari-primewormholewormholesSun, 21 Apr 2013 18:00:00 EST<![CDATA[Make your EVE Fanfest plans with the official program]]>http://massively.joystiq.com/2013/04/18/make-your-eve-fanfest-plans-with-the-official-program/http://massively.joystiq.com/2013/04/18/make-your-eve-fanfest-plans-with-the-official-program/http://massively.joystiq.com/2013/04/18/make-your-eve-fanfest-plans-with-the-official-program/#commentsFiled under: , , , , , ,

Make your EVE Fanfest plans with the official program
EVE Fanfest is next week and the faithful are preparing to descend upon Reykjavik, Iceland, for the three-day convention. If you're one of the travelers who are heading there or are just looking to follow along on livestream, CCP has released the full program with the event's schedule.

Fanfest will have three keynotes about the past, present, and future of CCP's titles, respectively. There will also be several panels, including one discussing EVE Online's inclusion in the New York Museum of Modern Art.

EVE Online also released a new dev blog talking about the team's war on unauthorized client modification and violations of the EULA. Apparently CCP has taken additional steps to beef up detection and prevention, and the team wanted to be clear with players as to what is and is not allowed.

MassivelyMake your EVE Fanfest plans with the official program originally appeared on Massively on Thu, 18 Apr 2013 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesconsoleconventiondustdust-514eveeve-fanfesteve-fanfest-2013eve-onlineeventfanfestfanfest-2013fantasyfpsgothichorrorinternet-spaceshipslivestreammmofpsplaystationplaystation-3ps3real-world-eventsandboxschedulesci-fishooterspreadsheets-onlinesupernaturalvampirevampireswhite-wolfwodworld-of-darknessThu, 18 Apr 2013 15:30:00 EST<![CDATA[CCP revamping DUST 514's skill system]]>http://massively.joystiq.com/2013/04/18/ccp-revamping-dust-514s-skill-system/http://massively.joystiq.com/2013/04/18/ccp-revamping-dust-514s-skill-system/http://massively.joystiq.com/2013/04/18/ccp-revamping-dust-514s-skill-system/#commentsFiled under: , , , , , , , , , , ,

CCP revamping DUST 514's skill system
DUST 514's May 6th Uprising patch will revamp the sci-fi shooter's skill system. Among the changes are the removal of multiple prerequisite skills and a new node-based skill tree view that will replace the current list-based approach.

CCP is also refunding skill points and ISK and AUR for certain items based on their market value at the time of the respec. "You may have committed to a certain play style, and with an overhauled layout and collection of skills, you may find yourself regretting some of your prior choices," explains DUST creative director Atli Mar Sveinsson on the PlayStation Blog. "We have thus decided that it is far better to respec not only the skills but items as well. In short, you will get your skill points back and the ISK and AUR value of any item that is removed from your inventory."

MassivelyCCP revamping DUST 514's skill system originally appeared on Massively on Thu, 18 Apr 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>atli-mar-sveinssonccpccp-gamesccp-praetorianconsoledustdust-514dust-514-uprisingdust-skillsdust-skll-revampeveeve-onlinefpsmmofpsplaystationplaystation-3ps3sandboxsci-fishooterskill-basedskill-systemuprisingThu, 18 Apr 2013 10:00:00 EST<![CDATA[EVE Online collecting player stories, CSM elections halfway over]]>http://massively.joystiq.com/2013/04/17/eve-online-collecting-player-stories-cms-elections-halfway-over/http://massively.joystiq.com/2013/04/17/eve-online-collecting-player-stories-cms-elections-halfway-over/http://massively.joystiq.com/2013/04/17/eve-online-collecting-player-stories-cms-elections-halfway-over/#commentsFiled under: , , , , , , ,

Screenshot -- EVE Online
In a lot of ways, EVE Online players are a lot like vikings. Or so CCP's new promotional video would have you believe. It draws comparisons between early Icelandic settlers carving out their place in the world to players in the galaxy of EVE Online doing much the same. It also makes the fine point that we would know nothing about the settlers of Iceland were it not for the few who took the time to write about the events of the time. The fine scholars at CCP want to preserve the history of EVE Online in a similar way, and they want players' help to do it. Internet spacefarers can go to the EVE True Stories site and submit their favorite tales, which will be voted upon by fellow players. One lucky player will even win a trip to Iceland to visit CCP's studios and take in the splendor of the country.

EVE players and politicians may also want to remember that the 8th Council of Stellar Management elections are halfway done, and voting will close on April 17th (that's today!) at 7 p.m. EST (midnight GMT). So if you want to make your voice heard, head on over to the election page and cast your ballot. Also, don't forget to check out the True Stories video after the cut.SM

Continue reading EVE Online collecting player stories, CSM elections halfway over

MassivelyEVE Online collecting player stories, CSM elections halfway over originally appeared on Massively on Wed, 17 Apr 2013 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamescmscms-8contestcontestscouncil-of-stellar-managementcouncil-of-stellar-management-8eveeve-onlineinternet-spaceshipssandboxsci-fispreadsheets-onlinetrue-talesvideovideosWed, 17 Apr 2013 17:00:00 EST<![CDATA[The Stream Team: Stepping on tax edition, April 15 - 21, 2013]]>http://massively.joystiq.com/2013/04/15/the-stream-team-stepping-on-tax-edition-april-15-21-2013/http://massively.joystiq.com/2013/04/15/the-stream-team-stepping-on-tax-edition-april-15-21-2013/http://massively.joystiq.com/2013/04/15/the-stream-team-stepping-on-tax-edition-april-15-21-2013/#commentsFiled under: , , , ,

The Stream Team Stepping on tax edition, April 15 21, 2013
'Tis the season! Just... not that season. This isn't one we really want; it's not a season of joyousness and brotherly kindness. No, this one's more akin to scattering LEGOs and thumbtacks all across the floor then dashing barefoot from wall to wall just to hit your head against them over and over. We understand the pain. Truly, we do. And The Stream Team is here for you.

They say nothing's certain in life except death and taxes, but we disagree! We'd totally add Massively TV to that list. Have we ever left you in your times of need? No! And we know you need us now more than ever. We're here to help you, with a full line-up of shows to help ease the pain and take your mind off the traumas that cannot be avoided. So take a load off and check out this week's schedule, catch a few reruns, see the highlight of the week, and take part in our two polls. Then remember, at least this only happens once a year!

Continue reading The Stream Team: Stepping on tax edition, April 15 - 21, 2013

MassivelyThe Stream Team: Stepping on tax edition, April 15 - 21, 2013 originally appeared on Massively on Mon, 15 Apr 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>activisionage-of-wulinage-of-wushuagotaionanetarenanetarkark-hunterarkfallartplayascensionasiabigpointbiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gameschampionschampions-onlinechampschinachinesechinese-mmococonsoleconsolescrypticcryptic-studiosdefianceeaelectronic-artseq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfamilyfantasyfeaturedfrfree-realmsfree-to-playfuncomgame of thronesgame-of-thrones-ascentgame-of-thrones-mmogame-of-thrones-seven-kingdomsgeorge-martingeorge-rr-martingotgot7kgpotatoguild-warsguild-wars-2gvggwgw2hbohi-rezhi-rez-studioshistoricalhorrorinternet-spaceshipskid-friendlykidnappingkidskids-mmokingsislekingsisle-entertainmentlivestreamlivestreaminglivestreamslucasartsmartial-artsmassively-metamassively-tvmetamight-and-magicmight-and-magic-duel-of-championsming-dynastymmo-shootermobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftperfect-worldperfect-world-entertainmentplaneplanesplaystation-3playstation3pollps3pvppwesandboxsci-fantasysci-fisecret-worldseven-kingdomsshooterskill-basedSmitesnail-gamessnail-games-usasoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorsyfytanktankstelonthe-aurora-worldthe-old-republicthe-secret-worldthe-stream-teamthird-person-shootertortpstransmedia-synergytriontrion-worldstruly-freetswtvtwitchtwitch-tvvanguardvanguard-saga-of-heroesvgvillagers-and-heroeswarwarcraftwargaming.netwarplanewarplaneswesteroswizard101world-of-tanksworld-of-warcraftworld-of-warplaneswotwowwowpwushuwuxiaxboxMon, 15 Apr 2013 09:00:00 EST<![CDATA[EVE Evolved: Massively's plans for EVE Fanfest 2013]]>http://massively.joystiq.com/2013/04/14/eve-evolved-massivelys-plans-for-eve-fanfest-2013/http://massively.joystiq.com/2013/04/14/eve-evolved-massivelys-plans-for-eve-fanfest-2013/http://massively.joystiq.com/2013/04/14/eve-evolved-massivelys-plans-for-eve-fanfest-2013/#commentsFiled under: , , , , , , , , , , , , , , , , ,

EVE Evolved title image
There's just over a week to go until EVE Online's massive tenth anniversary Fanfest, and you'll be pleased to hear that Massively will be there this year to cover the action! CCP is aiming to make this the biggest Fanfest yet, promising huge reveals and announcements about EVE's summer Odyssey expansion and beyond. We can also expect to hear some big news about upcoming console MMOFPS DUST 514, and fans of Vampire: The Masquerade will undoubtedly get to see some of the year's progress toward making the World of Darkness MMO a reality.

Tickets to this year's Fanfest sold out in record time, so many players who really wanted to be there for EVE's tenth anniversary celebration weren't able to secure a spot. CCP is running its usual livestream of the main talks for those not in attendance, but only certain parts of the event are being streamed. Here at Massively, we plan to give you an inside look at Fanfest with ongoing news coverage from April 25th to April 27th and in-depth opinion pieces on what each announcement means for players.

In this week's short and sweet EVE Evolved, I lay out Massively's plans for in-depth coverage of EVE Fanfest 2013 and ask what you'd like to see reported on.

Continue reading EVE Evolved: Massively's plans for EVE Fanfest 2013

MassivelyEVE Evolved: Massively's plans for EVE Fanfest 2013 originally appeared on Massively on Sun, 14 Apr 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>10-year-anniversary10-year-oldccpccp-gamesconsoledustdust-514eveeve-evolvedeve-fanfesteve-fanfest-2013eve-onlineeventevent-coverageeventsexpansionfanfestfanfest-2013fantasyfeaturedfpsgothichorroricelandlivestreammassivelymassively-event-coveragemmofpsnewsodysseyopinionplaystationplaystation-3ps3reykjaviksandboxsci-fishooterspeculationsupernaturalten-year-anniversaryten-yearstwittervampirevampire-the-masqueradevampiresvideowhite-wolfwodworld-of-darknessSun, 14 Apr 2013 18:00:00 EST<![CDATA[EVE Online executive producer moving to concentrate on mobile]]>http://massively.joystiq.com/2013/04/13/eve-online-executive-producer-moving-to-concentrate-on-mobile/http://massively.joystiq.com/2013/04/13/eve-online-executive-producer-moving-to-concentrate-on-mobile/http://massively.joystiq.com/2013/04/13/eve-online-executive-producer-moving-to-concentrate-on-mobile/#commentsFiled under: , , , , ,

CCP office screenshot
It looks like EVE Online's Jon Lander, otherwise known as CCP Unifex, will be moving on from his position as executive producer of the 10-year-old single-shard space MMO to concentrate on CCP's "emerging mobile strategy," according to a recent dev blog. Lander helped steer the team through EVE Online expansions Crucible, Inferno, Retribution, and the upcoming Odyssey. Don't worry, though; Senior Producer CCP Seagull and Development Director CCP Ripley will continue on with production of the game. Odyssey's release is still set for June 4th, and CCP promises that the transition will have zero impact on the quality of the upcoming new expansion.

Even more intriguingly, CCP wants to fill the position that Jon vacated with a candidate from outside the company. The dev blog wonders whether you have what it takes to take on the massive responsibility of running the world's biggest collection of pew-pews, or maybe you know someone who does. Good luck!

MassivelyEVE Online executive producer moving to concentrate on mobile originally appeared on Massively on Sat, 13 Apr 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpCCP-Gamesccp-unifexdev-blogeveeve-onlineinternet-spaceshipsjon-landermobilesandboxsci-fispreadsheets-onlineSat, 13 Apr 2013 15:00:00 EST<![CDATA[EVE highlights history in interactive timeline]]>http://massively.joystiq.com/2013/04/11/eve-highlights-history-in-interactive-timeline/http://massively.joystiq.com/2013/04/11/eve-highlights-history-in-interactive-timeline/http://massively.joystiq.com/2013/04/11/eve-highlights-history-in-interactive-timeline/#commentsFiled under: , , , , , , , , ,

EVE introduces interactive timeline
As EVE Online approaches the big 1-0, many can't help but think about how all the events and happenings over the last 10 years had shaped life in this massive space sandbox. But trying to explain a full decade of New Eden's extensive history was no easy task -- until now. CCP has just introduced the EVE timeline, an interactive exploration of the setting and lore of both EVE and its new companion, DUST 514.

In its inaugural form, this timeline sticks with core concepts, discussing how the universe was discovered and colonized. As time progresses, the functionality of the timeline will expand, including the addition of excerpts from the True Stories initiative as well as accounts from other major player events. Check it out on the new EVE.com website, then let CCP know what moments you think warrant mentioning in this easy-to-navigate history via the blog's comment section.

MassivelyEVE highlights history in interactive timeline originally appeared on Massively on Thu, 11 Apr 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>10th-anniversaryccpccp-gamesconsoledev-blogdustdust-514eveeve-onlinefpsinteractive-timelineinternet-spaceshipsmmofpsplaystationplaystation-3ps3PvPsandboxsci-fishooterspreadsheets-onlinetimelinetrue-storiestrue-stories-initiativeThu, 11 Apr 2013 18:00:00 EST<![CDATA[EVE dev blog details overhaul of navy ships in Odyssey]]>http://massively.joystiq.com/2013/04/10/eve-dev-blog-details-overhaul-of-navy-ships-in-odyssey/http://massively.joystiq.com/2013/04/10/eve-dev-blog-details-overhaul-of-navy-ships-in-odyssey/http://massively.joystiq.com/2013/04/10/eve-dev-blog-details-overhaul-of-navy-ships-in-odyssey/#commentsFiled under: , , , ,

EVE dev blog details incoming changes to navy ships
According to the latest dev blog, the last time navy ships saw any real developer attention in EVE Online was way back in 2009. Some ship specs, like the cruisers, haven't been dusted off in even longer. But fans can finally look forward to some of the rebalancing and retrofitting that other groups of ships have enjoyed in recent expansions; with Odyssey, navy vessels are getting an overhaul. The blog details the incoming changes, from a light once-over of the various frigates to a boat-load of changes for the cruisers and battlecruisers. Check out the full blog for specifics on your favorite ships.

MassivelyEVE dev blog details overhaul of navy ships in Odyssey originally appeared on Massively on Wed, 10 Apr 2013 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>battlecruisersccpccp-gamescruisersdev-blogdev-diaryeveeve-onlinefrigatesinternet-spaceshipsnavynavy-shipsOdysseyrebalancingsandboxsci-fiship-rebalancingship-revampspreadsheets-onlineWed, 10 Apr 2013 14:00:00 EST<![CDATA[Using EVE Online to predict the recession]]>http://massively.joystiq.com/2013/04/08/using-eve-online-to-predict-the-recession/http://massively.joystiq.com/2013/04/08/using-eve-online-to-predict-the-recession/http://massively.joystiq.com/2013/04/08/using-eve-online-to-predict-the-recession/#commentsFiled under: , , ,

Using EVE Online to predict the recession
A new blog post at Gamasutra gives an interesting perspective on EVE Online's economic trends and how they translate to real life. Virtual World Economist Ramin Shokrizade writes about his time helping CCP build the game's economy in the early days and how land tax and real estate bubbles can (and can't) work both in and out of a virtual environment.

Most notably, Shokrizade elaborates on a prediction he made in 2006 regarding the failed global banking system and how EVE Online taught him the warning signs. Now Shokrizade is an economic consultant to three international gaming companies, and he owes it all to EVE Online.

MassivelyUsing EVE Online to predict the recession originally appeared on Massively on Mon, 08 Apr 2013 20:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gameseconomyeveeve-onlinegamasutraguest-bloginternet-spaceshipssandboxsci-fispreadsheets-onlineMon, 08 Apr 2013 20:30:00 EST<![CDATA[The Stream Team: Bleepity bleep edition, April 8 - 14, 2013]]>http://massively.joystiq.com/2013/04/08/the-stream-team-bleepity-bleep-edition-april-8-14-2013/http://massively.joystiq.com/2013/04/08/the-stream-team-bleepity-bleep-edition-april-8-14-2013/http://massively.joystiq.com/2013/04/08/the-stream-team-bleepity-bleep-edition-april-8-14-2013/#commentsFiled under: , , ,

The Stream Team Bleepity bleep edition, April 8 14, 2013

It's definitely not a new thing. Throughout the ages, when intense frustration strikes, a colorful epithet can slip past the lips of even the most soft-spoken. Heck, at particularly annoying times, a full string of them has been known fly forth from the most unexpected sources. And we all know that there are plenty of frustration-inducing situations in gaming. So it's not hard to equate swearing with gaming, right?

Of course, we at Massively TV advocate a responsible use of language during our adventures. While there could be a time or a place for the universally known curses, we prefer bursts of creative language skills. And if there's one thing The Stream Team has, it's an abundance of creativity! We've learned it is possible to express frustration while avoiding the censors because censors are mean and carry big, painful sticks! Ouch.

Need proof? Pop into any of the shows scheduled this week or the reruns from last; watch how deftly (or not) our intrepid streamers react to curse-creating incidents. Hope as they might, nothing can go smoothly all the time... or for the very unlucky, at all! A perfect demonstration of this is highlighted in our newest section, a place devoted to showcasing a stream of the week. Catch MJ's colorful repurposing of the English language first-hand in Highlight Reels, then offer your most creative expression in the Outtakes.

Continue reading The Stream Team: Bleepity bleep edition, April 8 - 14, 2013

MassivelyThe Stream Team: Bleepity bleep edition, April 8 - 14, 2013 originally appeared on Massively on Mon, 08 Apr 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2la-mystical-landactionaction-mmoactivisionage-of-wulinage-of-wushuaionanetarenanetarkark-hunterarkfallascensionasiabiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gameschampionschampions-onlinechampschinachinesechinese-mmococonquestconsoleconsolescrypticcryptic-studiosdc-universedc-universe-onlinedcuodefianceDinostormdotadota-2e-sporteaelectronic-artseq-2eq-iieq2eqiiesporteveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfrfree-realmsfree-to-playfuncomgpotatoguild-warsguild-wars-2gvggwgw2heroes-of-newerthhi-rezhi-rez-studioshistoricalhonhorrorinternet-spaceshipskid-friendlykidnappingkidskids-mmolindenlinden-lablivestreamlivestreaminglivestreamslucasartsmartial-artsmassively-metamassively-tvmetaming-dynastymmo-shootermobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftperfect-worldperfect-world-entertainmentplaystation-3playstation3pollps3pvppweraiderzreal-liferiftrift-literift-planes-of-telararvrs2s2-gamessandboxScarlet-Bladesci-fantasysci-fisecond-lifesecret-worldshooterskill-basedslSmitesnail-gamessnail-games-usasoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorsyfytanktanksthe-old-republicthe-secret-worldthe-stream-teamthird-person-shooterthree-faction-pvpthree-way-pvptortpstransmedia-synergytriontrion-worldstruly-freetswtvtwitchtwitch-tvVillagers-andheroesvirtual-worldvirtual-worldswarwarcraftwargaming.networld-of-tanksworld-of-warcraftwotwowwushuwuxiaxboxMon, 08 Apr 2013 09:00:00 EST<![CDATA[EVE Evolved: Temporarily fixing starbases]]>http://massively.joystiq.com/2013/04/07/eve-evolved-temporarily-fixing-starbases/http://massively.joystiq.com/2013/04/07/eve-evolved-temporarily-fixing-starbases/http://massively.joystiq.com/2013/04/07/eve-evolved-temporarily-fixing-starbases/#commentsFiled under: , , , , , , , , , , , , ,

EVE Evolved title image
With its exploration-focused Odyssey expansion on the way, EVE Online is about to be hit with a deluge of players (new and old) venturing into the unknown. The expansion will introduce the yet-to-be-revealed Discovery Scanner and will add a ton of new exploration content all across New Eden. Odyssey aims to follow the lead of 2009's Apocrypha expansion, which saw hundreds of corporations lead lucrative expeditions into uncharted wormhole systems. We don't yet know whether the expansion will open new systems for exploration, but when Odyssey goes live, the race will be on to find and lay claim to all the goodies hidden in deep space.

With no stations to dock at in wormhole space, corps currently have to store everything in destructible starbases that aren't really up to the task. Player-owned starbases were released in 2004 as sandbox-style tools for tech 2 industry and alliance territorial warfare. They were never intended to be the sole base of operations for an entire corporation, so they suffer from some pretty severe security and usability flaws as a result. Theft from ship and item hangars in wormhole space is commonplace, setting up corp roles for them is a nightmare, and living exclusively in a starbase provides a daily dose of frustration players could seriously do without. CCP has been planning to completely overhaul player-owned starbases for years, but some of today's issues can't afford to wait any longer.

In this week's EVE Evolved, I look at some of the chronic problems faced by starbase-dwelling explorers and how CCP plans to temporarily fix some of them for Odyssey.

Continue reading EVE Evolved: Temporarily fixing starbases

MassivelyEVE Evolved: Temporarily fixing starbases originally appeared on Massively on Sun, 07 Apr 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>apocryphaccpccp-fozzieccp-gamescontrol-towercorpcorp-rolescorp-thiefcorporatecorporate-goalscorporate-infiltrationeveeve-evolvedeve-onlineexpansionexplorationfeaturedfixhangarindustryminingodysseypatchplayer-ownedplayer-owned-starbaseplayer-owned-stationpospos-fuelpvepvprefiningrefining-arrayresearchrolessandboxsci-fistarbasestarbase-fuelstrategic-cruisersstructuretech-3temporarywormholewormhole-explorationwormhole-heistwormholesSun, 07 Apr 2013 18:00:00 EST<![CDATA[EVE Online starts Council of Stellar Management elections]]>http://massively.joystiq.com/2013/04/05/eve-online-starts-council-of-stellar-management-elections/http://massively.joystiq.com/2013/04/05/eve-online-starts-council-of-stellar-management-elections/http://massively.joystiq.com/2013/04/05/eve-online-starts-council-of-stellar-management-elections/#commentsFiled under: , , , ,

EVE Online starts Council of Stellar Management elections
Elections are live for EVE Online's Council of Stellar Management 8, and players are invited to wade through the nominations to choose their ideal candidates to represent them to CCP. The full list of candidates along with their campaign promises are now posted for all to see.

The 28 31 32 candidates listed have all managed to gather enough endorsements to be put on the ballot. Instead of voting for just one candidate apiece, players will pick and rank their top 14 choices. These votes will be tallied and weighed accordingly, and 14 members of CSM 8 will emerge as the player delegates.

A player can vote for CSM given that he or she has an active account that's older than 30 days.

But if your taste for drama leans more on events than politics, then this link's for you: CCP has also just posted the details on streaming for the upcoming EVE Fanfest.

MassivelyEVE Online starts Council of Stellar Management elections originally appeared on Massively on Fri, 05 Apr 2013 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>candidatesccpccp-gamescouncil-of-stellar-managementcouncil-of-stellar-management-8csmcsm-8electionelectionseveeve-onlineinternet-spaceshipsplayer-councilsandboxsci-fispreadsheets-onlinevotevotesvotingFri, 05 Apr 2013 17:30:00 EST<![CDATA[CCP launches True Stories, eyes possible EVE film or TV series]]>http://massively.joystiq.com/2013/04/04/ccp-launches-true-stories-eyes-possible-eve-film-or-tv-series/http://massively.joystiq.com/2013/04/04/ccp-launches-true-stories-eyes-possible-eve-film-or-tv-series/http://massively.joystiq.com/2013/04/04/ccp-launches-true-stories-eyes-possible-eve-film-or-tv-series/#commentsFiled under: , , , , , , , , ,

CCP launches True Stories, eyes possible EVE film or TV series
CCP has announced a new EVE Online initiative called True Stories that aims to collect and preserve noteworthy New Eden events in an archive powered by the game's players. Creative director Torfi Frans Olafsson explains, via a new dev blog, that CCP has set up a submission system for paying players that includes the ability to upvote, downvote, and debate.

The submission phase ends on May 1st, with a voting period to follow that concludes on May 15th.

There are prizes including a trip to CCP headquarters in Iceland as well as 10-year subscriptions to EVE. Olafsson also mentions that CCP is looking to expand EVE with additional books, comics, and a possible film or TV series. "Our prospective media partners have shown great interest in adapting or using as inspiration actual events from the game itself," Olafsson says.

MassivelyCCP launches True Stories, eyes possible EVE film or TV series originally appeared on Massively on Thu, 04 Apr 2013 08:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesconsoledustdust-514eveeve-onlineeve-storieseve-true-storiesfpsinternet-spaceshipsmmofpsplaystationplaystation-3ps3sandboxsci-fishooterspreadsheets-onlinetorfi-frans-olafssontrue-storiesThu, 04 Apr 2013 08:30:00 EST<![CDATA[EVE Online shining up its starbases for Odyssey]]>http://massively.joystiq.com/2013/04/02/eve-online-shining-up-its-starbases-for-odyssey/http://massively.joystiq.com/2013/04/02/eve-online-shining-up-its-starbases-for-odyssey/http://massively.joystiq.com/2013/04/02/eve-online-shining-up-its-starbases-for-odyssey/#commentsFiled under: , , , , ,

No words yet on making your starbase party central, but we can hope that it's coming.
In theory, player-owned starbases are a major component of EVE Online's gameplay. In practice, the acronym for these structures is seen as being unintentionally appropriate. But if you're an owner of a POS and hoping for some love from the development team, you can take heart that Odyssey is aiming to incorporate several new features to make these bases more desirable and worthwhile. Even if not all of these features are certain inclusions just yet, they're still enticing additions.

Among the major changes coming to starbases are the inclusion of private hangars, repackaging modules within starbase arrays, and the removal of sovereignty requirements from capital ship maintenance arrays. The UI will also be tweaked and improved, and players will be able to swap Strategic Cruiser subsystems from a starbase while accessing any of the starbase's arrays from within the facility's shield. For full details on the hard work being done to improve these structures, check out the full development blog.

MassivelyEVE Online shining up its starbases for Odyssey originally appeared on Massively on Tue, 02 Apr 2013 19:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ccpccp-gamesdevelopment-blogeveeve-onlineexpansioninternet-spaceshipslarge-patchesnewsodysseypatchesplayer-owned-starbasespospreviewsandboxsci-fispreadsheets-onlineTue, 02 Apr 2013 19:30:00 EST<![CDATA[The Stream Team: Fools vs. floppy ears edition, April 1 - 7, 2013]]>http://massively.joystiq.com/2013/04/01/the-stream-team-fools-vs-floppy-ears-edition-april-1-7-201/http://massively.joystiq.com/2013/04/01/the-stream-team-fools-vs-floppy-ears-edition-april-1-7-201/http://massively.joystiq.com/2013/04/01/the-stream-team-fools-vs-floppy-ears-edition-april-1-7-201/#commentsFiled under: , , ,

The Stream Team Fools vs floppy ears edition, April 1 7, 2013
Though infrequent, it does happen: Once in a while two holidays go toe to toe on the calendar. This year, it just so happens that April Fools' Day rides in on the tail of the Easter Bunny. So what do you do when these very different holidays bump up against each other? You do what any self-respecting Stream Team fan does: You watch more Massively TV! Of course, that's pretty much the answer to everything, isn't it?

Some day these two holidays might actually overlap. If that were the case, who do you think would come out on top in a brawl over celebration rights -- that floppy-eared frolicking rabbit known for leaving chocolate or the fool (with or without a bell-tipped hat) who delights in pranking and tricking? After watching Rise of the Guardians, I think my money is on the bunny. Worst case scenario is they team up together and we end up with trick chocolate.

While contemplating this match-up, join us for a week of intense livestreams with your favorite hosts, playing such classics as Fruit Ninja and Fruity Loops Studio.

Continue reading The Stream Team: Fools vs. floppy ears edition, April 1 - 7, 2013

MassivelyThe Stream Team: Fools vs. floppy ears edition, April 1 - 7, 2013 originally appeared on Massively on Mon, 01 Apr 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2lactionaction-mmoactivisionallodsallods-onlineanetApril-Foolsarcane-legendsarenanetastrum-nivalbiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamesconquestconsoleconsolesdc-universedc-universe-onlinedcuodotadota-2e-sporteaEasterelectronic-artseq-2eq-iieq2eqiiesporteveeve-onlineeverquest-2everquest-iif2pfactionfamilyfantasyfeaturedfrfree-realmsfree-to-playFruity-Loops-Studiofuncomgala-netgpotatoguild-warsguild-wars-2gwgw2heroes-of-newerthhi-rezhi-rez-studioshistoricalhonhorrorinternet-spaceshipskid-friendlykidskids-mmokingsislekingsisle-entertainmentlindenlinden-lablivestreamlivestreaminglivestreamslucasartsmail-ru-gamesmail.ru-gamesmailru-gamesmassively-metamassively-tvmetamobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftnew-englandparadoxparadox-interactiveperfect-worldperfect-world-entertainmentpermadeathplaystation-3playstation3pollps3pvppweraiderzreal-liferiftrift-literift-planes-of-telararvrs2s2-gamessalemsandboxscarlet-bladesci-fantasysci-fisecond-lifesecret-worldsegaskill-basedslSmitesoesonysony-online-entertainmentspiral-knightsspreadsheets-onlinestar-warsstar-wars-the-old-republicsteamstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorthe-old-republicthe-secret-worldthe-stream-teamthree-faction-pvpthree-ringsthree-rings-designthree-way-pvptortriontrion-worldstswtwitchtwitch-tvvirtual-worldvirtual-worldswarcraftwizard101world-of-warcraftwowMon, 01 Apr 2013 09:00:00 EST<![CDATA[EVE Evolved: EVE's Odyssey expansion could be incredible]]>http://massively.joystiq.com/2013/03/31/eve-evolved-eves-odyssey-expansion-could-be-incredible/http://massively.joystiq.com/2013/03/31/eve-evolved-eves-odyssey-expansion-could-be-incredible/http://massively.joystiq.com/2013/03/31/eve-evolved-eves-odyssey-expansion-could-be-incredible/#commentsFiled under: , , , , , , , , , , , , , ,

EVE Evolved title image
When EVE Online's upcoming Odyssey expansion was officially announced last week at PAX East, the anticipation from players was almost palpable. Odyssey aims to follow in the footsteps of 2009's blockbuster Apocrypha expansion by revamping the exploration system and filling the void of space with thousands of new hidden treasures. We've been promised new ships, a new scanner mechanic with sleek new UI and additional functionality, and a rebalancing of industrial resources across the game.

Though CCP is saving most of the expansion reveals for next month's EVE Fanfest and beyond, we can make some fairly educated guesses on what the expansion will contain from the press release and teaser site. It's pretty much a given that we'll get some kind of new exploration ship, and there's pretty strong evidence that moon minerals will be changing somehow. We're also almost guaranteed to get new faction battlecruisers, and the evidence is mounting that Jove space may finally be about to open for exploration.

In this week's EVE Evolved, I look at the evidence for Jove space finally opening, explain why we desperately need a new scanning system, and make some educated guesses on what else the Odyssey expansion might contain.

Continue reading EVE Evolved: EVE's Odyssey expansion could be incredible

MassivelyEVE Evolved: EVE's Odyssey expansion could be incredible originally appeared on Massively on Sun, 31 Mar 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alliancesapocryphabattlecruiserbattlecruisersccpccp-gamesdirectional-scannerdiscovery-scannereveeve-evolvedeve-fanfesteve-fanfest-2013eve-onlineexpansionexpansionsexplorationfactionfaction-shipsfeaturedGnosisjovejove-directoratejoviannavynavy-shipsnullsecodysseyopinionPAXPAX-eastpax-east-2013probingpvepvpsandboxscannerscanningsci-fiten-yearswormholewormholesSun, 31 Mar 2013 18:00:00 EST