Massively http://massively.joystiq.com Massively http://www.blogsmithmedia.com/http://massively.joystiq.com/media/feedlogo.gif Massively http://massively.joystiq.com en-us Copyright 2013 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[Choose My Adventure: Building on the clan experience in Darkfall]]>http://massively.joystiq.com/2013/05/22/choose-my-adventure-building-on-the-clan-experience-in-darkfall/http://massively.joystiq.com/2013/05/22/choose-my-adventure-building-on-the-clan-experience-in-darkfall/http://massively.joystiq.com/2013/05/22/choose-my-adventure-building-on-the-clan-experience-in-darkfall/#commentsFiled under: , , , , , ,

Choose My Adventure Building on the clan experience in Darkfall
Boy, MJ's Misadventureland is really coming along! Hiring a few more hands sure has sped things up; you wouldn't even recognize the project now compared to even just one week ago. But isn't that the whole point of Choose My Adventure -- to watch the adventure that you're building develop and unfold? Well, that and to snicker at your Massively guinea pigs... we know.

Having gone into this particular adventure knowing that Darkfall Unholy Wars was not a game meant for the solo soul, I knew that it was only a matter of time before I found myself in a clan to experience more of the heart of the game, which just so happens to be clan warfare. And trust me, the clan wasted no time throwing me into the thick of things once you put me in one.

Although I do think starting off solo was important to get the real experience Darkfall any new player would (after all, most find a clan after first logging in), this week really has shown me a whole new game. I'd just scratched the surface before, the skin if you will, and now I've peered into the heart and seen the seedy underbelly as well.

Gallery: Choose My Adventure: Darkfall Unholy Wars

Continue reading Choose My Adventure: Building on the clan experience in Darkfall

MassivelyChoose My Adventure: Building on the clan experience in Darkfall originally appeared on Massively on Wed, 22 May 2013 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinechoose-my-adventurechoose-my-adventure-darkfallchoose-my-adventure-mj-guthrieclanscmadarkfalldarkfall-unholy-warsdffantasyfeaturedguildshands-onopen-pvpopinionpollpollspvpreaders-choicesandboxsiegessiegingunholy-warsvotevotingWed, 22 May 2013 19:00:00 EST<![CDATA[The Stream Team: Monocle Day edition, May 20 - 26, 2013]]>http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/#commentsFiled under: , , ,

The Stream Team Monocle day edition, May 20 26, 2013
Two weeks ago, y'all had the chance to select a new holiday to help add some cheer to the otherwise bland weeks in the middle of May. The choices teased and tantalized you, but you're a discriminating crowd. In a race fraught with nail-biting suspense, only one ultimately prevailed. And so it is with further ado we bring to you: Monocle Day!

This Tuesday, May 21st, has been selected to be the auspicious day of this most storied celebration. Why? Because 5/21 splits into 5 + 2 + 1, which of course = 8, and we all know that 8 is just two monocles stacked on top of each other! And as always, Massively TV is here to help you ring in the new holiday, with special shows throughout the entire week. Check out the full schedule of celebratory events hosted by The Stream Team after the break. Then let us know if you'll be wearing your own monocle in honor of the festivities.

Continue reading The Stream Team: Monocle Day edition, May 20 - 26, 2013

MassivelyThe Stream Team: Monocle Day edition, May 20 - 26, 2013 originally appeared on Massively on Mon, 20 May 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>Achaeaaction-mmoactivisionagonanetAnno-Onlinearenanetaventurinebiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamescity-of-steamconsoleconsolescrypticcryptic-studiosdarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodfdndDotA-2dragonDragonrealmsdragonsdragons-propheteaelectronic-artselswordeq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfrfree-realmsfree-to-playfuncomgoblinguild-warsgwhi-rezhi-rez-studioshistoricalhorrorhousinginfernuminfernum-productionsinternet-spaceshipskid-friendlykidskids-mmolivestreamlivestreaminglivestreamslucasartsmassively-metamassively-tvmechanistmechanist-gamesmetamobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftneverwinteropen-pvpperfect-worldperfect-world-entertainmentplaneplanesplaystation-3playstation3pollps3pvppwerunewakerrunewaker-entertainmentsandboxsci-fantasysci-fisecret-worldskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicsteampunkstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorthe-old-republicthe-secret-worldthe-stream-teamthreshold-rpgtortswtwitchtwitch-tvunholy-warswarwarcraftwargaming.netwarplanewarplanesworld-of-warcraftworld-of-warplaneswowwowpMon, 20 May 2013 09:00:00 EST<![CDATA[Darkfall plans summer content update, suffers DDOS attack [Updated]]]>http://massively.joystiq.com/2013/05/18/aventurine-outlines-darkfalls-summer-content-update-plans/http://massively.joystiq.com/2013/05/18/aventurine-outlines-darkfalls-summer-content-update-plans/http://massively.joystiq.com/2013/05/18/aventurine-outlines-darkfalls-summer-content-update-plans/#commentsFiled under: , , , , , , , , ,

This is a road in Darkfall
Darkfall's long-awaited Unholy Wars makeover launched almost a month ago, and now Aventurine is turning its eyes toward the future of its PvP-focused fantasy sandbox. AV's Tasos Flambouras posted a schedule of planned content updates on the forums earlier this week that stretches all the way into July. Aside from the usual MMO bug fixes and tweaks, there are major additions like the Svartvann, Marthnyr, Hardruk, and Dulguna dungeons, new families of monsters, new ships, and sea fortresses. [Thanks Dengar!]

[Update: Aventurine is reporting that its NA servers are suffering the effects of a DDoS attack. The official blog reads, "In regard to the ping issues on the NA server the past couple of days, this was due to a DDoS attack during NA prime time. We have taken measures in cooperation with our hosting providers to filter this attack, and we're monitoring the situation. We'll keep you updated and we apologize for any inconvenience."]

MassivelyDarkfall plans summer content update, suffers DDOS attack [Updated] originally appeared on Massively on Sat, 18 May 2013 21:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinedarkfalldarkfall-dungeonsdarkfall-unholy-warsdarkfall-updatesdffantasyopen-pvppvpsandboxtasos-flambourasunholy-warsSat, 18 May 2013 21:00:00 EST<![CDATA[Choose My Adventure: Beyond the walls of safety in Darkfall]]>http://massively.joystiq.com/2013/05/15/choose-my-adventure-beyond-the-walls-of-safety-in-darkfall/http://massively.joystiq.com/2013/05/15/choose-my-adventure-beyond-the-walls-of-safety-in-darkfall/http://massively.joystiq.com/2013/05/15/choose-my-adventure-beyond-the-walls-of-safety-in-darkfall/#commentsFiled under: , , , , , ,

Choose My Adventure Beyond the walls of safety in Darkfall
Man up MJ, you said. Forsake the fetters of safety and wander the wilds of the world. Yes, folks, for the next phase of our Choose My Adventure project, you directed me to leave the confines of the starting cities and surrounding lands to explore and harvest in the unprotected areas in Darkfall Unholy Wars. That, and get familiar with the workbench for crafting. So said you all, and so I did.

I ran little Emey Brokenclaw beyond the bounds of the safe zones and introduced her to the vast lands stretching across Agon. I enjoyed some exciting experiences as well as learned quite a few things during that journey, though not necessarily what you'd expect.

Gallery: Choose My Adventure: Darkfall Unholy Wars

Continue reading Choose My Adventure: Beyond the walls of safety in Darkfall

MassivelyChoose My Adventure: Beyond the walls of safety in Darkfall originally appeared on Massively on Wed, 15 May 2013 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinechoose-my-adventureChoose-My-Adventure-Darkfallchoose-my-adventure-mj-guthrieclanscmadarkfalldarkfall-unholy-warsdfexplorationfantasyfeaturedhands-onopen-pvpopinionpollpollspvpreaders-choicesandboxunholy-warsvotevotingWed, 15 May 2013 16:00:00 EST<![CDATA[The Stream Team: MLT edition, May 13 - 19, 2013]]>http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/#commentsFiled under: , , ,

The Stream Team May 13 19, 2013
Nothing beats an MLT, especially when the tomato is nice and ripe! Except maybe Massively TV. MMmm mmmm. Now there's something you can really sink your teeth into -- the wild and crazy antics of your favorite Stream Team hosts! And they've got a menu for all tastes this week, from space adventures to dragons to WWII planes. Of course, it all comes with a side of reruns and a dessert highlight to complete your meal.

So pull up a chair and grab yourself a helping or two... or 10. Hey, there's no limit here; enjoy as much as you like! While you're enjoying the spread, be sure to join in the after-dinner chat in Outtakes.

Continue reading The Stream Team: MLT edition, May 13 - 19, 2013

MassivelyThe Stream Team: MLT edition, May 13 - 19, 2013 originally appeared on Massively on Mon, 13 May 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmoactivisionage-of-conanage-of-conan-unchainedagonanetaocaoc-unchainedarenanetarkark-hunterarkfallaventurinebiowareblizzardblizzard-entertainmentbuy-to-playccpccp-gamescity-of-steamconanconsoleconsolescrypticcryptic-studiosdarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodefiancedfdnddota-2Dragonrealmseaelectronic-artselswordeq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfree-to-playfuncomgoblinguild-warsgwhi-rezhi-rez-studioshistoricalhorrorhyboriainternet-spaceshipslivestreamlivestreaminglivestreamslucasartsmabinogimassively-metamassively-tvmechmechanistmechanist-gamesmechsmechwarriormechwarrior-mmomechwarrior-onlinemetammo-shootermobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmwomythologyncsoftneverwinternexonnexon-americaopen-pvpperfect-worldperfect-world-entertainmentpiranhapiranha-gamesplaneplanesplaystation-3playstation3pollps3pvppwesandboxsci-fantasysci-fisecret-worldshooterskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicsteampunkstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorsyfythe-old-republicthe-secret-worldthe-stream-teamthird-person-shootertortpstransmedia-synergytriontrion-worldstswtvtwitchtwitch-tvunchainedunholy-warswarwarcraftwargaming.netwarplanewarplanesworld-of-warcraftworld-of-warplaneswowwowpxboxMon, 13 May 2013 09:00:00 EST<![CDATA[Choose My Adventure: Framing my first foray in Darkfall]]>http://massively.joystiq.com/2013/05/08/choose-my-adventure-framing-my-first-foray-in-darkfall/http://massively.joystiq.com/2013/05/08/choose-my-adventure-framing-my-first-foray-in-darkfall/http://massively.joystiq.com/2013/05/08/choose-my-adventure-framing-my-first-foray-in-darkfall/#commentsFiled under: , , , , , , ,

Choose My Adventure Framing my first foray in Darkfall
Break time's over! Now it's time to roll up our sleeves and get back to work building our latest Choose My Adventure. The first order of business is to establish the framework for the rest of our Darkfall Unholy Wars (mis)adventures.

Of course, we can't just build willy-nilly; we need to follow a plan. And as with any major construction project, we couldn't really move forward until said plan was OKed by the planning commission. So while we waited for the foundation to set, we sought approval for which type of structure to base our continuing adventures on. And as is wont to happen with committees, there was trouble coming to a consensus; even though the proposed models were all pretty similar, disagreement arose as to which to pick.

However, after some debate (one proposal won by only one vote!), we finally got the go ahead: The final word was to build a Mahirim Deadeye. I'm on it, boss!

Gallery: Choose My Adventure: Darkfall Unholy Wars

Continue reading Choose My Adventure: Framing my first foray in Darkfall

MassivelyChoose My Adventure: Framing my first foray in Darkfall originally appeared on Massively on Wed, 08 May 2013 13:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinecharacter-creationcharacter-customizationchoose-my-adventurechoose-my-adventure-darkfallchoose-my-adventure-mj-guthriecmadarkfalldarkfall-unholy-warsdffantasyfeaturedfirst-impressiongalleryhands-onopen-pvpopinionpollpollspvpreaders-choicesandboxscreenshotstutorialtutorialsunholy-warsvotevotingWed, 08 May 2013 13:30:00 EST<![CDATA[The Stream Team: Seis de Mayo edition, May 6 - 12, 2013]]>http://massively.joystiq.com/2013/05/06/the-stream-team-seis-de-mayo-edition-may-6-12-2013/http://massively.joystiq.com/2013/05/06/the-stream-team-seis-de-mayo-edition-may-6-12-2013/http://massively.joystiq.com/2013/05/06/the-stream-team-seis-de-mayo-edition-may-6-12-2013/#commentsFiled under: , , ,

The Stream Team Seis de Mayo edition, May 6 12, 2013
You have to agree, May is one month that's full of holidays. The first week alone contains May Day, (unofficial) Star Wars Day, and Cinco de Mayo. But the party doesn't stop there! Following quickly on the heels of these is perhaps one you are less familiar with: Seis de Mayo.

Not unlike its cousin the day before, Seis de Mayo is a day of celebration; however, this celebration centers on freedom from boredom via visual entertainment. No, really! And to commemorate the day, we're releasing an all-new Massively TV schedule, giving you the means to celebrate the whole week through with The Stream Team. If you can't celebrate live, just tune into a rerun and party whenever.

Well, even if you don't believe us, you can still commemorate the occasion with us. Just check out the past the cut for a heaping helping of daily festivities.

Continue reading The Stream Team: Seis de Mayo edition, May 6 - 12, 2013

MassivelyThe Stream Team: Seis de Mayo edition, May 6 - 12, 2013 originally appeared on Massively on Mon, 06 May 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmoactivisionage-of-conanage-of-conan-unchainedagonaionanetaocaoc-unchainedarenanetarkark-hunterarkfallascensionaventurinebiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamesclone-warsclone-wars-adventuresconanconsoleconsolescrypticcryptic-studioscwadarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodefiancedfdnddota-2dragondragonsdragons-propheteaelectronic-artseq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfamilyfantasyfeaturedfpsfree-to-playfuncomguild-warsguild-wars-2gwgw2heroes-and-generalshi-rezhi-rez-studioshousinghyboriainfernuminfernum-productionsinternet-spaceshipskid-friendlykidskids-mmokingsislekingsisle-entertainmentlivestreamlivestreaminglivestreamslobbylucasartsmabinogimassively-metamassively-tvmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemetaminigamemmo-shootermmofpsmobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmwoncsoftneverwinternexonnexon-americaopen-pvpperfect-worldperfect-world-entertainmentpiranhapiranha-gamesplanetsideplanetside-2playstation-3playstation3pollps2ps3pvppwerunewakerrunewaker-entertainmentsandboxsci-fantasysci-fishooterSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsuperherosuperheroesswtorsyfythe-old-republicthe-stream-teamthird-person-shootertorTorchlight-2torchlight-iitpstransmedia-synergytriontrion-worldstruly-freetvtwitchtwitch-tvunchainedunholy-warswarcraftwarmage-battlegroundswizard101world-of-warcraftwowxboxMon, 06 May 2013 09:00:00 EST<![CDATA[Darkfall Unholy Wars interview talks sandboxes, mounts, and content updates]]>http://massively.joystiq.com/2013/05/03/darkfall-unholy-wars-interview-talks-sandboxes-mounts-and-cont/http://massively.joystiq.com/2013/05/03/darkfall-unholy-wars-interview-talks-sandboxes-mounts-and-cont/http://massively.joystiq.com/2013/05/03/darkfall-unholy-wars-interview-talks-sandboxes-mounts-and-cont/#commentsFiled under: , , , , , ,

Darkfall DUN DUN DUN
The fine folks behind Darkfall Unholy Wars recently sat down with an Italian fansite to chat a bit about the game. They talked about how the new game stemmed from their desire to push the original Darkfall beyond the limits of its systems. There's no reason to scrap a good thing, though, so the developers have brought over a lot of the sandbox features from the original. The Demi-God bosses, naval combat, and mounted combat systems are all making a reappearance in some form, although the team has been trying to improve upon their original implementation. Additionally, the game is meant to support player-generated events, crafting without artificial barriers, a new dye system, and city vendor hubs.

Presently, the team is putting in frequent patches with bug fixes while working on adding in features. Once the developers' current wishlist of features has been implemented, the team can focus on planning bigger patches and expansions for the future.

You can read the interview for yourself here, but be prepared to scroll to get down to the English bit. Unless you're super pro and read Italian.

[Thanks to moxious internetter Festano for the tip!]

MassivelyDarkfall Unholy Wars interview talks sandboxes, mounts, and content updates originally appeared on Massively on Fri, 03 May 2013 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinedarkfalldarkfall-unholy-warsdffantasyinterviewopen-pvppvpsandboxunholy-warsworlds-factoryFri, 03 May 2013 16:00:00 EST<![CDATA[Choose My Adventure: Pouring the foundation in Darkfall]]>http://massively.joystiq.com/2013/05/01/choose-my-adventure-pouring-the-foundation-in-darkfall/http://massively.joystiq.com/2013/05/01/choose-my-adventure-pouring-the-foundation-in-darkfall/http://massively.joystiq.com/2013/05/01/choose-my-adventure-pouring-the-foundation-in-darkfall/#commentsFiled under: , , , , , ,

Choose My Adventure Pouring the foundation in Darkfall
It's relocation time! Although there were plenty of tempting properties spread around various locales to choose from, once the bidding wars began, Darkfall Unholy Wars grabbed the lead and refused to let go. So we're packing up our tools and moving to Agon to get this Choose My Adventure project started. And considering the whole neighborhood just went through a recent renovation, I'm sure we'll fit right in building our new retreat. Now, we just need... hm, where did we put those blueprints? Do we even have blueprints? No? Well, no matter; you can just give me the instructions as we go. Rome wasn't built in a day, and we've got five more weeks to work together to create this new retreat.

I've got to tell you, I'm quite excited for this venture. One of the greatest things about the CMA series is that it forces us to finally dive in and check out games we've been wanting to but never quite "found the time." Once it becomes a part of your daily job, you have no choice but to make the time! Darkfall was always one of those games for me, and my curiosity and interest was piqued even more with Unholy Wars. So let's get this started. First, we need a foundation.

Continue reading Choose My Adventure: Pouring the foundation in Darkfall

MassivelyChoose My Adventure: Pouring the foundation in Darkfall originally appeared on Massively on Wed, 01 May 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinechoose-my-adventurechoose-my-adventure-mj-guthriecmadarkfalldarkfall-unholy-warsdfElementalistfantasyfeaturedhands-onopen-pvpopinionpollpollsPrimalistpvpracesreaders-choicerolessandboxSkirmisherunholy-warsvotevotingWarriorWed, 01 May 2013 15:00:00 EST<![CDATA[Darkfall Unholy Wars hits Steam as Valve introduces new subscription service]]>http://massively.joystiq.com/2013/04/25/darkfall-unholy-wars-hits-steam-as-valve-introduces-new-subscrip/http://massively.joystiq.com/2013/04/25/darkfall-unholy-wars-hits-steam-as-valve-introduces-new-subscrip/http://massively.joystiq.com/2013/04/25/darkfall-unholy-wars-hits-steam-as-valve-introduces-new-subscrip/#commentsFiled under: , , , , , , , ,

Darkfall
In a press release issued on Steam today, Valve announced that it now offers something of particular value to MMOs on the platform: subscription plans. Gamers can now subscribe to MMOs on Steam and manage recurring payments to those games using Steam itself.
With Subscription Plans, Steam offers gamers the ability to sign up and manage payments for subscription-based games on Steam. [...] Steam customers may now sign-up for, manage, cancel or renew game Subscription Plans at any time, online directly through Steam.
On the front lines of this new Steam feature is none other than subscription-based sandbox MMO Darkfall Unholy Wars, which relaunched just last week.

Valve promises that "additional subscription-based games [will] follow" and posted a lengthy FAQ to ward off the tinfoil hat crowd.

MassivelyDarkfall Unholy Wars hits Steam as Valve introduces new subscription service originally appeared on Massively on Thu, 25 Apr 2013 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinedarkfalldarkfall-unholy-warsdffantasyopen-pvppvpsandboxsteamsubsubscriptionsubscriptionsunholy-warsvalveThu, 25 Apr 2013 14:00:00 EST<![CDATA[Choose My Adventure: Extreme DIY makeover edition]]>http://massively.joystiq.com/2013/04/24/choose-my-adventure-extreme-diy-makeover-edition/http://massively.joystiq.com/2013/04/24/choose-my-adventure-extreme-diy-makeover-edition/http://massively.joystiq.com/2013/04/24/choose-my-adventure-extreme-diy-makeover-edition/#commentsFiled under: , , ,

Choose My Adventure Extreme DIY makeover edition
Life may be like a box of chocolates, but gaming is like a Do-It-Yourself project. It may not be as mouth-watering an analogy, but it is certainly fitting: MMOs are a giant construction zone where players build their own experiences in a virtual world using tools from the game and their own imagination.

Each project is a unique undertaking, bearing the personal touches of the builder, whether the builder is an individual or a group like a guild. Some players prefer to build a single residence and settle in, while others enjoy moving from project to project, exploring new territory and testing new tools. Me? I tend toward the former; I'm the kind who tinkers around in one place over a long period of time. But all that's about to change. Again.

That's right, folks; it's my turn to break ground on yet another Choose My Adventure! For the next six weeks I am leaving the comfy confines of my familiar surroundings and allowing you to direct my next MMO project. Yes, my dear Massively friends, you will be the foreman of this endeavor, determining every step of the construction, from where I'll build my newest experience to what tools I'll get to use.

Continue reading Choose My Adventure: Extreme DIY makeover edition

MassivelyChoose My Adventure: Extreme DIY makeover edition originally appeared on Massively on Wed, 24 Apr 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmoage-of-conanage-of-conan-unchainedage-of-wulinage-of-wushuagonallodsallods-onlineaocaoc-unchainedarkark-hunterarkfallasiaastrum-nivalaventurinebrowserbrowser-basedchinachinesechinese-mmochoose-my-adventurechoose-my-adventure-mj-guthrieclone-warsclone-wars-adventurescmaconanconsoleconsolescrypticcryptic-studioscwadarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodefiancedfdndf2pfamilyfantasyfeaturedfree-to-playfuncomgala-netgpotatogvghands-onhistoricalhyboriakid-friendlykidnappingkidskids-mmokingsislekingsisle-entertainmentlobbylord-of-the-ringslord-of-the-rings-onlinelotromail-ru-gamesmail.ru-gamesmailru-gamesmartial-artsming-dynastyminigamemmo-shooterneverwinteropen-pvpopinionperfect-worldperfect-world-entertainmentpiratepirate101piratesplaneplanesplaystation-3playstation3pollpollsps3pvppwereaders-choicesandboxsci-fantasysci-fishootersnail-gamessnail-games-usasoesony-online-entertainmentstar-warssuperherosuperheroessyfythird-person-shootertpstransmedia-synergytriontrion-worldsturbineturbine-entertainmenttvunchainedunholy-warsVendetta-Onlinevotevotingwarwargaming.netwarplanewarplanesworld-of-warplaneswowpwushuwuxiaxboxWed, 24 Apr 2013 11:00:00 EST<![CDATA[Massively's Darkfall launch week diary: Day three and recap]]>http://massively.joystiq.com/2013/04/19/massivelys-darkfall-launch-week-diary-day-three-and-recap/http://massively.joystiq.com/2013/04/19/massivelys-darkfall-launch-week-diary-day-three-and-recap/http://massively.joystiq.com/2013/04/19/massivelys-darkfall-launch-week-diary-day-three-and-recap/#commentsFiled under: , , , , , , , , , , , , ,

Massively's Darkfall launch week diary: Day three and recap
So yesterday I kinda rambled on at length about why I'm loving Darkfall Unholy Wars. I'm not really apologizing; after all, this is my launch week diary! Today, though, I figured I might tone it down a bit and just hit the highlights of my day three play experience. After that, I'll recap and give you some final thoughts on Darkfall as it stands in April 2013.

Continue reading Massively's Darkfall launch week diary: Day three and recap

MassivelyMassively's Darkfall launch week diary: Day three and recap originally appeared on Massively on Fri, 19 Apr 2013 12:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinedarkfalldarkfall-craftingdarkfall-impressionsdarkfall-launch-diarydarkfall-launch-weekdarkfall-pvedarkfall-reviewdarkfall-unholy-warsdffantasyfeaturedopen-pvppvepvpsandboxsmartphoneunholy-warsunholy-wars-launchFri, 19 Apr 2013 12:30:00 EST<![CDATA[Massively's Darkfall launch week diary: Day two]]>http://massively.joystiq.com/2013/04/18/massivelys-darkfall-launch-week-diary-day-two/http://massively.joystiq.com/2013/04/18/massivelys-darkfall-launch-week-diary-day-two/http://massively.joystiq.com/2013/04/18/massivelys-darkfall-launch-week-diary-day-two/#commentsFiled under: , , , , , , , , , , ,

Massively's Darkfall launch week diary Day two
I'm doing Darkfall Unholy Wars wrong.

See, I'm one of those sandbox carebears who could not care less about PvP. I'll attempt to defend myself if attacked, and I'll add another body to the zerg if I'm in a clan or whatever, but I don't seek out conflict with other players. I mention this because that attitude obviously informs everything I write about Darkfall, which, at its core, is a great big high fantasy murder simulator.

Yes, the game has crafting, harvesting, player housing, and better PvE than it's given credit for, but on some level all of this stuff exists to power the FFA PvP meatgrinder that in turn attempts to satiate the bloodlust of Aventurine's target demographic.

And would you believe that despite that, Darkfall is still one of this carebear's favorite MMORPGs?

Continue reading Massively's Darkfall launch week diary: Day two

MassivelyMassively's Darkfall launch week diary: Day two originally appeared on Massively on Thu, 18 Apr 2013 12:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinecarebeardarkfalldarkfall-launchdarkfall-launch-diarydarkfall-unholy-warsdffantasyfeaturedhands-onimmersionlaunch-diaryopen-pvppvepvpsandboxunholy-warsunholy-wars-launchThu, 18 Apr 2013 12:30:00 EST<![CDATA[The Daily Grind: Do launch day hassles make you quit a game?]]>http://massively.joystiq.com/2013/04/18/the-daily-grind-do-launch-day-hassles-make-you-quit-a-game/http://massively.joystiq.com/2013/04/18/the-daily-grind-do-launch-day-hassles-make-you-quit-a-game/http://massively.joystiq.com/2013/04/18/the-daily-grind-do-launch-day-hassles-make-you-quit-a-game/#commentsFiled under: , , , , , ,

Darkfall Unholy Wars patcher
MMO launches have come a long way. While no MMO is bug-free, developers have made substantial strides in this department over the past decade. Similarly and for the most part, gone are the days when mile-long queues prevent you from playing on day one.

And then there's Darkfall.

Or more accurately Darkfall Unholy Wars. To Aventurine's credit, I can at least purchase and log in to the game unlike the catastrophe that passed for the original 2009 launch (and also to be fair, I'm a big fan of the game). It still took forever and a day to patch, though, and that was after I had to leave the client torrent download on overnight.

So, how about it Massively readers? Do launch-day hiccups irritate you enough to move on to other games, or do you generally stick it out?

Every morning, the Massively bloggers probe the minds of their readers with deep, thought-provoking questions about that most serious of topics: massively online gaming. We crave your opinions, so grab your caffeinated beverage of choice and chime in on today's Daily Grind!

MassivelyThe Daily Grind: Do launch day hassles make you quit a game? originally appeared on Massively on Thu, 18 Apr 2013 08:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinedaily-grinddarkfalldarkfall-unholy-warsdffantasyopen-pvpopinionpvpsandboxtdgthe-daily-grindunholy-warsThu, 18 Apr 2013 08:00:00 EST<![CDATA[Massively's Darkfall launch week diary: Day one]]>http://massively.joystiq.com/2013/04/17/massivelys-darkfall-launch-week-diary-day-one/http://massively.joystiq.com/2013/04/17/massivelys-darkfall-launch-week-diary-day-one/http://massively.joystiq.com/2013/04/17/massivelys-darkfall-launch-week-diary-day-one/#commentsFiled under: , , , , , , , , , , ,

Darkfall Unholy Wars loading screen art
Darkfall Unholy Wars' April 2013 launch was quite a bit like Darkfall's February 2009 launch. For me, at any rate. One crucial difference was that this time I was actually able to purchase Aventurine's fantasy sandbox title even though I wasn't able to log into it.

Four years ago, finding a digital copy of Darkfall was damn near impossible. Fast forward to the present and AV has improved its billing apparatus but certainly not its delivery mechanism. After nearly three hours, DFUW's patcher managed to pull down 90 MB out of 6487. I switched to the torrent download, and while it was faster, I still had to leave it overnight. So technically this is day two impressions even though it's day one for yours truly.

Continue reading Massively's Darkfall launch week diary: Day one

MassivelyMassively's Darkfall launch week diary: Day one originally appeared on Massively on Wed, 17 Apr 2013 12:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinedarkfalldarkfall-diarydarkfall-first-impressionsdarkfall-hands-ondarkfall-impressionsdarkfall-launchdarkfall-launch-diarydarkfall-launch-weekdarkfall-unholy-warsdarkfall-unholy-wars-launchdfexpansionfantasyfeaturedhands-oninventorylaunchlaunch-daylaunchesopen-pvppvpsandboxunholy-warsWed, 17 Apr 2013 12:30:00 EST<![CDATA[Darkfall Unholy Wars finally launches]]>http://massively.joystiq.com/2013/04/16/darkfall-unholy-wars-finally-launches/http://massively.joystiq.com/2013/04/16/darkfall-unholy-wars-finally-launches/http://massively.joystiq.com/2013/04/16/darkfall-unholy-wars-finally-launches/#commentsFiled under: , , , , , ,

Darkfall Unholy Wars finally launches
The next iteration of Darkfall is underway! Aventurine today announced that Darkfalls Unholy Wars has finally released after several delays and a lengthy beta. The sandbox MMO is a complete revamp of the original Darkfall with several new features, and it requires the purchase of a client and a subscription fee to play.

Aventurine General Manager Tasos Flambouras seems relieved to have reached this stage: "After five months of beta we are happy to launch Darkfall Unholy Wars. We are grateful to our playtesters for their contribution to the game and we're happy to have them with us as players today. Darkfall Unholy Wars is the best combat MMORPG experience and our pledge is that it will continue evolving and pushing the PvP envelope."

MassivelyDarkfall Unholy Wars finally launches originally appeared on Massively on Tue, 16 Apr 2013 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinedarkfalldarkfall-unholy-warsdffantasylaunchopen-pvpoverhaulpvpreleaserevampsandboxtasos-flambourasupdateTue, 16 Apr 2013 15:30:00 EST<![CDATA[Some Assembly Required: Your guide to MMO sandboxes in 2013 and beyond]]>http://massively.joystiq.com/2013/04/12/some-assembly-required-your-guide-to-mmo-sandboxes-in-2013-and/http://massively.joystiq.com/2013/04/12/some-assembly-required-your-guide-to-mmo-sandboxes-in-2013-and/http://massively.joystiq.com/2013/04/12/some-assembly-required-your-guide-to-mmo-sandboxes-in-2013-and/#commentsFiled under: , , , , , , , , , , , , , , , , , , , , , , , ,

Some Assembly Required - Massively's guide to sandboxes
Welcome to Massively's guide to MMO sandboxes in 2013 and beyond. I've collected the essential details on all the major sandbox titles releasing this year and in the near future in one easy-to-reference article. If you're wondering whether ArcheAge forces you to PvP, or if you can't tell The Repopulation from Origins of Malu, this is your post.

I'll be updating it as game features are added, removed, or revealed, so be sure to use the comments to let me know if I've overlooked a particularly noteworthy item. Finally, I want to point out that this isn't an exhaustive list because of the sheer number of sandbox projects ongoing. For now, I'm choosing to focus on the ones that will be playable in 2013/2014 as well as the projects that have a big-name developer attached.

Continue reading Some Assembly Required: Your guide to MMO sandboxes in 2013 and beyond

MassivelySome Assembly Required: Your guide to MMO sandboxes in 2013 and beyond originally appeared on Massively on Fri, 12 Apr 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2013-sandbox-guide2013-sandboxesaaabove-and-beyondabove-and-beyond-technologiesaction-mmoage-of-wulinage-of-wushuagonarche-agearcheageasiaavataraventurinecarbinecarbine-studioschinachinesechinese-mmochris-robertscloud-imperiumcloud-imperium-gamescrowdfundingcrypticcryptic-studiosdangerousdarkfalldavid-brabendfdndeliteelite-dangerouseqeq-nexteqneverquesteverquest-nextf2pfantasyfeaturedfree-to-playfrontierfrontier-developmentsgame-mechanicsgpotatogvginternet-spaceshipinternet-spaceshipskickstarterkidnappinglord-britishmartial-artsmassivelys-sandbox-guideming-dynastyncsoftneverwinteropen-pvpopinionperfect-worldperfect-world-entertainmentpgcplayer-contentplayer-generated-contentpvppwerepopulationrichard-garriottsandboxsandbox-guidesandparksarsci-fantasysci-fishroudshroud-of-the-avatarsnail-gamessnail-games-usasoesome-assembly-requiredsony-online-entertainmentSOTAspacespaceshipspaceshipsstar-citizenthe-repopulationwildstarwswushuwuxiaxl-gamesxlgamesFri, 12 Apr 2013 10:00:00 EST<![CDATA[Darkfall Unholy Wars to launch April 16]]>http://massively.joystiq.com/2013/04/03/darkfall-unholy-wars-to-launch-april-16/http://massively.joystiq.com/2013/04/03/darkfall-unholy-wars-to-launch-april-16/http://massively.joystiq.com/2013/04/03/darkfall-unholy-wars-to-launch-april-16/#commentsFiled under: , , , , ,

Darkfall Unholy Wars to launch April 16
Any Darkfall fan can tell you that it's been quite a wild ride from the launch of the original game in 2009 through the waiting period for Unholy Wars to release. Just do a search on this site for the keywords "Darkfall" and "delay" and you'll feel their pain. But the wait is almost over as Aventurine has announced a final release date of April 16. That's 2013, folks!

Sardonics aside, we imagine the dev team wants to make sure the game is done right this time, which is the whole point of Unholy Wars in the first place. New features like salvaging, Prowess Points, the Primalist role, and Steam integration will make for a fuller experience, and fans of the game can then judge if Aventurine's claim of creating the "best PvP MMORPG experience" will hold true.

[Thanks to Robert for the tip!]

MassivelyDarkfall Unholy Wars to launch April 16 originally appeared on Massively on Wed, 03 Apr 2013 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinedarkfalldffantasylaunchopen-pvppvpreleasesandboxunholy-warsWed, 03 Apr 2013 17:00:00 EST<![CDATA[The Game Archaeologist: When sequels attack!]]>http://massively.joystiq.com/2013/03/23/the-game-archaeologist-when-sequels-attack/http://massively.joystiq.com/2013/03/23/the-game-archaeologist-when-sequels-attack/http://massively.joystiq.com/2013/03/23/the-game-archaeologist-when-sequels-attack/#commentsFiled under: , , , , , , , , , , , , , , ,

The Game Archaeologist When sequels attack!
Sequels are both the bane of and a fact of life for movies and video games. Well, "bane" is a strong word, and you're probably thinking of Batman right now anyway, but personally, I'm always willing to give the benefit of doubt to any continuation of a favorite franchise. While we don't see sequels pop up as often in MMOs, they do exist and have significant effects upon the original title that bears the same name.

It's here that MMOs diverge from movies and other video games. With those, the original is not in any sort of danger, other than the perception of having its legacy dragged down into the muck (Caddyshack II, anyone?) and perhaps overstaying its welcome. An MMO sequel, on the other hand, can cause serious consequences to its ancestor.

Here at Game Archaeologist, we look at classic games that have often seen their time come and go. But what happens to one of these titles when a sequel attacks? Almost anything, it turns out.

Continue reading The Game Archaeologist: When sequels attack!

MassivelyThe Game Archaeologist: When sequels attack! originally appeared on Massively on Sat, 23 Mar 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>acac2agonanetarenanetasherons-callasherons-call-2aventurinebrowserbrowser-basedbuy-to-playclassicclassic-mmoclassic-mmosclassicsconsoleconsolesdarkfalldfeqeq-2eq-iieq1eq2eqiieverquesteverquest-2everquest-iif2pfantasyfeaturedffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivfpsfree-to-playgagame-archaelogistglobal agendaguild-warsguild-wars-2gwgw2hi-rezhi-rez-studiosjagexjagex-games-studiojumpgatejumpgate-evolutionl1lineagelineage-1lineage-2lineage-iimmofpsncsoftneocronneocron-2nostalgiaopen-pvpopinionpvprsrunescapesandboxsci-fishootersoesonysony-online-entertainmentspy-fisquaresquare-enixthe-game-archaeologistthird-person-shootertpsturbineturbine-entertainmentultima-online-2ultima-x-odysseySat, 23 Mar 2013 18:00:00 EST<![CDATA[Aventurine details Darkfall's Primalist role]]>http://massively.joystiq.com/2013/03/21/aventurine-details-darkfalls-primalist-role/http://massively.joystiq.com/2013/03/21/aventurine-details-darkfalls-primalist-role/http://massively.joystiq.com/2013/03/21/aventurine-details-darkfalls-primalist-role/#commentsFiled under: , , , , , , , ,

Darkfall Unholy Wars starting area, because AV couldn't be arsed to release a Primalist screenshot with its Primalist dev blog
Aventurine has released a smidgeon of info on the Primalist, one of four new roles in Darkfall Unholy Wars' rebooted character progression system. The Primalist is "the healer and protector of his group and can help turn the tide of any battle with his interventions," according to the company's latest dev blog.

The posting lists various Primalist skills that fall under the Life and Law schools, and you can read all about it on the official Darkfall website.

MassivelyAventurine details Darkfall's Primalist role originally appeared on Massively on Thu, 21 Mar 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinedarkfalldarkfall-classesdarkfall-rolesdarkfall-unholy-warsdffantasyopen-pvpprimalistpvpsandboxunholy-warsThu, 21 Mar 2013 09:00:00 EST<![CDATA[Darkfall adds salvaging, prowess point progression]]>http://massively.joystiq.com/2013/03/06/darkfall-adds-salvaging-prowess-point-progression/http://massively.joystiq.com/2013/03/06/darkfall-adds-salvaging-prowess-point-progression/http://massively.joystiq.com/2013/03/06/darkfall-adds-salvaging-prowess-point-progression/#commentsFiled under: , , , , , , , , ,

Two guys fighting in Darkfall, neither of whom care about salvaging, I'd imagine
Aventurine has broken a bit of its silence relating to the Darkfall Unholy Wars reboot. While the FFA PvP sandbox has been in beta for a while now, it's still not in open beta, and thus news of all the changes has been slow to reach fans who are watching from the sidelines.

Fear not, though, because it's Tasos Flambouras to the rescue with a pair of forum posts detailing the new game's salvaging and prowess point character progression systems.

Salvaging is basically the reverse of the crafting process, and players may salvage crafted equippable gear and broken items which drop from Agon's monsters. Prowess, on the other hand, is gained from all "meaningful interactions" with the game, which includes harvesting, crafting, PvE, and PvP. Skills and attributes are then raised via the prowess system. Aventurine notes that crafting skills are not raised via prowess. "Due to the effect crafting skills have on the economy we felt we should exclude them from the prowess-based system," Flambouras writes. "All crafting skills can be raised by creating items."

MassivelyDarkfall adds salvaging, prowess point progression originally appeared on Massively on Wed, 06 Mar 2013 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinedarkfalldarkfall-prowessdarkfall-salvagingdarkfall-unholy-warsdffantasyopen-pvpprowessprowess-pointspvpsalvagingsandboxtasos-flambourasunholy-warsWed, 06 Mar 2013 15:30:00 EST<![CDATA[Darkfall's fourth anniversary arrives, Unholy Wars doesn't]]>http://massively.joystiq.com/2013/02/26/darkfalls-fourth-anniversary-arrives-unholy-wars-doesnt/http://massively.joystiq.com/2013/02/26/darkfalls-fourth-anniversary-arrives-unholy-wars-doesnt/http://massively.joystiq.com/2013/02/26/darkfalls-fourth-anniversary-arrives-unholy-wars-doesnt/#commentsFiled under: , , , , , , , ,

Darkfall skull keep
Several months ago, when the Massively braintrust asked me to pen an anniversary piece for Darkfall, I said, "Sure, that sounds like a great excuse to jump in and see what's changed since I played last."

Little did I know that I'd still be stuck looking at Darkfall: Unholy Wars from afar on the game's anniversary date because Aventurine still hasn't gotten around to launching its sandbox reboot just yet. Huge delays are par for the course with this game, and I suppose the latest pales in comparison to the decade-long development cycle and the interminable Forumfall buffoonery that fans of the game suffered through prior to its original 2009 release.

And yeah, I could link my old account and my new account and go beta Unholy Wars, but 15 years as an MMO fan has cured me of any impulse to test these games, particularly ones that I'm likely to enjoy post-release. Anyhow, that's a pretty long-winded intro that essentially boils down to "join me after the cut for an anniversary recap of Darkfall's past 12 months."

Continue reading Darkfall's fourth anniversary arrives, Unholy Wars doesn't

MassivelyDarkfall's fourth anniversary arrives, Unholy Wars doesn't originally appeared on Massively on Tue, 26 Feb 2013 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonanniversaryaventurinedarkfalldarkfall-anniversarydarkfall-rebootdarkfall-unholy-warsdffantasyfeaturedopen-pvppvpsandboxunholy-warsTue, 26 Feb 2013 16:30:00 EST<![CDATA[Darkfall shows off its mad crafting skills]]>http://massively.joystiq.com/2013/02/14/darkfall-shows-off-its-mad-crafting-skills/http://massively.joystiq.com/2013/02/14/darkfall-shows-off-its-mad-crafting-skills/http://massively.joystiq.com/2013/02/14/darkfall-shows-off-its-mad-crafting-skills/#commentsFiled under: , , ,

Darkfall shows off its mad crafting skills
When Darkfall eventually relaunches as Unholy Wars, it's bringing with it a robust crafting system that apparently deserves a preview video set to a stirring theme.

The video throws out plenty of tantalizing numbers to demonstrate Darkfall's crafting diversity: 98 different harvestable materials, 17 crafting skills, 12 crafting masteries, 75 unique crafted materials, 410 unique crafting recipes, and 626 unique craftable items. And it ends with a player casually tossing out a fully crafted boat from his inventory for him and his friends to sail.

Give the video a look after the jump and let us know: How important is crafting to you in a PvP-centric MMO?

Continue reading Darkfall shows off its mad crafting skills

MassivelyDarkfall shows off its mad crafting skills originally appeared on Massively on Thu, 14 Feb 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinecraftingdarkfalldffantasygatheringharvestingopen-pvppvpsandboxtrailervideoThu, 14 Feb 2013 15:00:00 EST<![CDATA[Link your Darkfall and Unholy Wars accounts for discount, beta access]]>http://massively.joystiq.com/2013/02/12/link-your-darkfall-and-unholy-wars-accounts-for-discounts-beta/http://massively.joystiq.com/2013/02/12/link-your-darkfall-and-unholy-wars-accounts-for-discounts-beta/http://massively.joystiq.com/2013/02/12/link-your-darkfall-and-unholy-wars-accounts-for-discounts-beta/#commentsFiled under: , , , , , , ,

Darkfall - Yssam
Got questions about linking your old Darkfall account with your spiffy new Darkfall: Unholy Wars account? Aventurine's got answers, and you'll find them in a new customer support video published yesterday on the game's official website.

Why would you want to link your accounts? Firstly you'll get the new UW client for half price ($14.95). You'll also get access to beta and the ability to reserve your character's name. You can view the video after the cut.

Continue reading Link your Darkfall and Unholy Wars accounts for discount, beta access

MassivelyLink your Darkfall and Unholy Wars accounts for discount, beta access originally appeared on Massively on Tue, 12 Feb 2013 09:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinedarkfalldarkfall-accountdarkfall-account-linkingdarkfall-customer-service-videodarkfall-unholy-warsdffantasyopen-pvppvpsandboxunholy-warsTue, 12 Feb 2013 09:30:00 EST<![CDATA[Darkfall dev diary video details the world of Agon]]>http://massively.joystiq.com/2013/01/28/darkfall-dev-diary-video-details-the-world-of-agon/http://massively.joystiq.com/2013/01/28/darkfall-dev-diary-video-details-the-world-of-agon/http://massively.joystiq.com/2013/01/28/darkfall-dev-diary-video-details-the-world-of-agon/#commentsFiled under: , , ,

darkfall dev diary video
Darkfall Holy Wars' new world of Agon is front and center in today's developer diary video hosted by World Lead Nikos Kasolos. In it, he describes the intense graphics update that was required to bring Agon to life, including textures, lighting, and even the ability to hide in the shadows now, thanks to a new darkness improvement.

As for new content, Agon launches 50 holdings, 30 cities, and 20 hamlets all "built from scratch." You can find out much more about this new update through the six-minute video embedded after the cut.

Continue reading Darkfall dev diary video details the world of Agon

MassivelyDarkfall dev diary video details the world of Agon originally appeared on Massively on Mon, 28 Jan 2013 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinedarkfalldev-diarydffantasynikos-kasolosopen-pvppvpsandboxvideoMon, 28 Jan 2013 16:00:00 EST<![CDATA[Some Assembly Required: Six reasons to love sandboxes in 2013]]>http://massively.joystiq.com/2012/12/21/some-assembly-required-six-reasons-to-love-sandboxes-in-2013/http://massively.joystiq.com/2012/12/21/some-assembly-required-six-reasons-to-love-sandboxes-in-2013/http://massively.joystiq.com/2012/12/21/some-assembly-required-six-reasons-to-love-sandboxes-in-2013/#commentsFiled under: , , , , , , , , , , , , , ,

Some Assembly Required - Architectual plans
What a difference a year makes, amirite? This time twelve months ago, I was licking the wounds brought on by Star Wars Galaxies' unceremonious and premature departure from the MMO scene. It was bad enough that a profitable title was sacrificed in order to clear a path for one of 2012's biggest disappointments, but it was worse that said title was the premier sandbox in the genre's history.

Frankly, the last few years have been abysmal for fans of non-linear MMOs and player-generated content, but thankfully, 2012 righted the ship and gave us more than a bit of hope for 2013.

Continue reading Some Assembly Required: Six reasons to love sandboxes in 2013

MassivelySome Assembly Required: Six reasons to love sandboxes in 2013 originally appeared on Massively on Fri, 21 Dec 2012 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2013-sandboxaaage-of-wulinage-of-wushuagonarche-agearcheageasiaaventurinechinachinesechinese-mmodarkfalldfeqeq-nexteqneverquesteverquest-nextfantasyfeaturedgame-mechanicsgpotatogvgjet-lijohn-smedleykidnappingmartial-artsming-dynastyopen-pvpopinionpgcplayer-contentplayer-generated-contentpvpsandboxsandbox-2013sandboxes-in-2013sandparksarsix-reasons-to-love-sandboxes-in-2013snail-gamessnail-games-usasoesome-assembly-requiredsony-online-entertainmentstar-citizenthe-repopulationwushuwuxiaxl-gamesxlgamesFri, 21 Dec 2012 14:00:00 EST<![CDATA[Massively Speaking Episode 229: SexyTime]]>http://massively.joystiq.com/2012/12/18/massively-speaking-episode-229-sexytime/http://massively.joystiq.com/2012/12/18/massively-speaking-episode-229-sexytime/http://massively.joystiq.com/2012/12/18/massively-speaking-episode-229-sexytime/#commentsFiled under: , , , , , , ,

Massively Speaking Episode 229 Blast from the past
December was supposed to be a quiet, tame month, but has turned into a poop-flinging monkey madhouse! Co-hosts Bree and Justin dissect the craziest news from this past week, including a long-dead MMO come back from the grave, a major title going buy-to-play, and winter holidays springing up all over the place.

Have a comment for the podcasters? Shoot an email to podcast@massively.com. We may just read your email on the air!

Get the podcast:
[iTunes] Subscribe to Massively Speaking directly in iTunes.
[RSS] Add Massively Speaking to your RSS aggregator.
[MP3] Download the MP3 directly.
Listen here on the page:



Read below the cut for the full show notes.

Continue reading Massively Speaking Episode 229: SexyTime

MassivelyMassively Speaking Episode 229: SexyTime originally appeared on Massively on Tue, 18 Dec 2012 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ac2age-of-conanage-of-conan-unchainedagonaocaoc-unchainedasherons-call-2aventurinebrantbrianna-roycebuy-to-playchristmaschristmas-2012conandarkfalldff2pfactionfantasyfeaturedfree-to-playfuncomholidayholiday-2012horrorhumorhyboriajustin-olivettimassively-speakingmythologyopen-pvpopinionpodcastpodcastingpodcastspvpsandboxsci-fantasysecret-worldskill-basedsubscriptionlessthe-secret-worldtriontrion-worldstswunchainedTue, 18 Dec 2012 10:00:00 ESTMassively Speaking Episode 229Massively.com Staff01:10:57podcast<![CDATA[Darkfall delays beta due to loot-eating bug]]>http://massively.joystiq.com/2012/12/17/darkfall-delays-beta-due-to-loot-eating-bug/http://massively.joystiq.com/2012/12/17/darkfall-delays-beta-due-to-loot-eating-bug/http://massively.joystiq.com/2012/12/17/darkfall-delays-beta-due-to-loot-eating-bug/#commentsFiled under: , , ,

Darkfall delays beta due to looteating bug
When you've repeatedly delayed the launch of the new version of the game, what's there left to do? You know you shouldn't have asked that because now you made the Darkfall beta go back in hiding. It was just waiting for someone foolish enough to ask that question.

While Darkfall Unholy Wars' beta was scheduled to begin today, Aventurine decided to hold back on starting it for the time being. What's the hold-up? According to Producer Tasos Flambouras, a nasty bug's floating around that can, well, have an adverse affect on gameplay: "To simply describe the bug in question: It's a persistence bug. Some players, sometimes, will lose all their stuff."

The team is attempting to reproduce and eliminate the bug but said that it will go ahead with the beta after a "few hours" whether or not it's found.

MassivelyDarkfall delays beta due to loot-eating bug originally appeared on Massively on Mon, 17 Dec 2012 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinebetabugdarkfalldelaydffantasyglitchlootopen-pvppvpsandboxtasos-flambourasunholy-warsMon, 17 Dec 2012 16:00:00 EST<![CDATA[Darkfall video offers walkthrough for clan management system]]>http://massively.joystiq.com/2012/12/14/darkfall-video-offers-walkthrough-for-clan-management-system/http://massively.joystiq.com/2012/12/14/darkfall-video-offers-walkthrough-for-clan-management-system/http://massively.joystiq.com/2012/12/14/darkfall-video-offers-walkthrough-for-clan-management-system/#commentsFiled under: , , , , , , ,

Darkfall video offers walkthrough for clan management system
Darkfall: Unholy Wars is one of those games that can be described as best enjoyed with a clan, so clan management is an important topic. In that vein, Darkfall is giving clans a consolidated interface with a variety of features to find, create, and manage clans.

Players searching for a clan are given access to information about possible choices such as how much dominion the clan has accrued, leader names, the charter, and how many members are in it. Once you find a match, you can apply directly from the interface. Can't find what you want? Clans can also be created on the spot from this window, as long as the player has 2,000 gold in his or her backpack.

Other features available through this interface are an accounting of clan members' PvP kills ranking, and dominion earned for the clan. Leaders also have the ability to grant clan permissions on an individual basis as well as review and accept or decline applicants. There is also a special politics tab that includes a clan kill-on-site list. Take a look at all these details and more in the video after the break.

[Thanks to Bartillo for the tip!]

Continue reading Darkfall video offers walkthrough for clan management system

MassivelyDarkfall video offers walkthrough for clan management system originally appeared on Massively on Fri, 14 Dec 2012 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurineclan-formationclan-managementdarkfalldffantasyKill-on-sight-listKill-on-site listKOS-listopen-pvppvpsandboxvideoFri, 14 Dec 2012 11:00:00 EST<![CDATA[Darkfall Unholy Wars pre-orders available tomorrow]]>http://massively.joystiq.com/2012/12/13/darkfall-unholy-wars-pre-orders-available-tomorrow/http://massively.joystiq.com/2012/12/13/darkfall-unholy-wars-pre-orders-available-tomorrow/http://massively.joystiq.com/2012/12/13/darkfall-unholy-wars-pre-orders-available-tomorrow/#commentsFiled under: , , , , ,

Darkfall Unholy Wars starter area
Aventurine has posted a brief update on the state of Darkfall's Unholy Wars reboot. The firm is "currently working on putting together the beta build," and there will also be some beta forums launched on Friday, December 14th.

Pre-orders will also be available beginning tomorrow, and they'll set you back $14.95 if you're a former Darkfall customer. If not, you'll need to part with $29.95. In either case, you get automatic beta access and 30 days of free game time when Unholy Wars finally goes live.

MassivelyDarkfall Unholy Wars pre-orders available tomorrow originally appeared on Massively on Thu, 13 Dec 2012 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinebetadarkfalldarkfall-pre-orderdarkfall-preorderdarkfall-unholy-wars-preorderdffantasyopen-pvppvpsandboxunholy-warsunholy-wars-betaThu, 13 Dec 2012 18:30:00 EST<![CDATA[Ask Massively: Why isn't this news?]]>http://massively.joystiq.com/2012/12/13/ask-massively-why-isnt-this-news/http://massively.joystiq.com/2012/12/13/ask-massively-why-isnt-this-news/http://massively.joystiq.com/2012/12/13/ask-massively-why-isnt-this-news/#commentsFiled under: , , , , ,

Remember back when people read newspapers?
Welcome back to Ask Massively, the part of Massively where you ask us random things, we give you answers, and you yell incomprehensibly at us.

natecantbefound asked: Why are you guys reporting this crap [a League of Legends video] when Darkfall has a new video out?

Short answer: Perspective.

Continue reading Ask Massively: Why isn't this news?

MassivelyAsk Massively: Why isn't this news? originally appeared on Massively on Thu, 13 Dec 2012 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>adviceadvice-columnask-massivelyaventurineBlizzardBlizzard-Entertainmentbrianna-royce-ask-massivelydarkfallfeaturedhumorleague-of-legendslolmassively-metametanewsnewsworthinessnewsworthyopinionriot-gamesWorld-of-Warcraftwowwow-insiderThu, 13 Dec 2012 16:00:00 EST<![CDATA[Aventurine apologizes for Darkfall delay]]>http://massively.joystiq.com/2012/12/12/aventurine-apologizes-for-darkfall-delay/http://massively.joystiq.com/2012/12/12/aventurine-apologizes-for-darkfall-delay/http://massively.joystiq.com/2012/12/12/aventurine-apologizes-for-darkfall-delay/#commentsFiled under: , , , ,

Aventurine explains Darkfall Unholy Wars delays
Darkfall fans have good reason to be disgruntled at the news yesterday that Aventurine announced a major delay in the relaunch of the game. The studio has posted a brief explanation as to why the announcement cut it so close to the anticipated release date.

"We want you to know that 55 people fought until the last minute to make that announcement unnecessary," Tasos Flambouras wrote. "This is not a matter of lack of respect towards the community; it's a matter of unfortunate timing."

Flambouras apologized, saying that the delay allows his team "to do what's best for the game and for [its] players" and that Aventurine is not using Darkfall's transition onto Steam as an excuse.

MassivelyAventurine apologizes for Darkfall delay originally appeared on Massively on Wed, 12 Dec 2012 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonapologyaventurinedarkfalldelaydfexplainationfantasyim-sorrymea-culpaopen-pvppvpsandboxsteamtasos-flambourasWed, 12 Dec 2012 15:30:00 EST<![CDATA[Darkfall Unholy Wars delays release and opts for pre-order testing]]>http://massively.joystiq.com/2012/12/11/darkfall-unholy-wars-delays-release-and-opts-for-pre-order-testi/http://massively.joystiq.com/2012/12/11/darkfall-unholy-wars-delays-release-and-opts-for-pre-order-testi/http://massively.joystiq.com/2012/12/11/darkfall-unholy-wars-delays-release-and-opts-for-pre-order-testi/#commentsFiled under: , , , ,

We'll be back again in January.
Darkfall Unholy Wars developer Aventurine is notorious for running a bit long on projects, so it's probably not going to surprise longtime fans that the game is missing its revised release target tomorrow. Developer Tasos Flambouras informed players that the launch will be delayed most likely until January, although a firm date has not yet been established. He also apologizes for the last-minute announcement, citing a need for several different bits of cross-communication before the decision was final.

To mollify those who just can't wait to start the game, a beta will be kicking off on December 17th for any pre-order customers. Returning players can pick up the game at the normal subscription price, while new players will still be able to get a discount by ordering. Flambouras promises that all pre-order players will receive a full 30 days of free time when the game goes live, as well as access to the beta during its duration. If it sounds like something you can't wait to jump on, keep your eyes peeled on Friday for purchasing details.

[Thanks to everyone who sent this in!]

MassivelyDarkfall Unholy Wars delays release and opts for pre-order testing originally appeared on Massively on Tue, 11 Dec 2012 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinebetadarkfalldarkfall-unholy-warsdelaydffantasylaunch-delaynewsopen-pvppaid-testingpvprelaunchsandboxtasostestingunholy-warsTue, 11 Dec 2012 18:30:00 EST<![CDATA[Darkfall Unholy Wars dev diary addresses changes to the clan system]]>http://massively.joystiq.com/2012/12/07/darkfall-unholy-wars-dev-diary-addresses-changes-to-the-clan-sys/http://massively.joystiq.com/2012/12/07/darkfall-unholy-wars-dev-diary-addresses-changes-to-the-clan-sys/http://massively.joystiq.com/2012/12/07/darkfall-unholy-wars-dev-diary-addresses-changes-to-the-clan-sys/#commentsFiled under: , , , , , ,

Screenshot -- Darkfall
Another Darkfall Unholy Wars dev blog hit the interwebs today, this one focusing on the many changes to the clan system that will be coming with the game's reboot. One of the largest tweaks to the system is in the way that clan ranks will operate. Previously, a player's clan rank (and corresponding clan privileges) was determined by the number of enemy clan members killed. This will no longer be the case in Unholy Wars, which will instead allow clan leaders to set the ranks and privileges of each member, therefore allowing more control over who has the ability to invite new members, access the clan vault, and so on.

The old clan rank system will still exist but will be known as military rank and will have no bearing on a player's privileges. In addition, the founder and leader of the clan are no longer tied together, so the clan's creator can easily transfer leadership to another member.

Aventurine also wants to "give clans a greater sense of ownership over the world," so the studio is implementing a system that will "link villages to nearby clan holdings." By improving the rewards for village ownership, the team hopes that clans will consolidate their power thus creating more border conflicts as clans attempt to extend their reach. Aventurine realizes that villages "have always been hot-spots for PvP activities," however, so a resource-stealing mechanic is also being added. This will allow any player to steal resource rewards from a clan-controlled village, which means that clans will have to keep close watch over their domain to ensure that they receive all of their rightfully earned resources.

For further details, check out the video below.

Continue reading Darkfall Unholy Wars dev diary addresses changes to the clan system

MassivelyDarkfall Unholy Wars dev diary addresses changes to the clan system originally appeared on Massively on Fri, 07 Dec 2012 22:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurineclanclan-rankclan-ranksclan-systemclansdarkfalldev-blogdev-diarydeveloper-blogdeveloper-diarydffantasyopen-pvppvpsandboxvideovideosFri, 07 Dec 2012 22:00:00 EST<![CDATA[New Darkfall video previews the Elementalist role]]>http://massively.joystiq.com/2012/11/30/new-darkfall-video-previews-the-elementalist-role/http://massively.joystiq.com/2012/11/30/new-darkfall-video-previews-the-elementalist-role/http://massively.joystiq.com/2012/11/30/new-darkfall-video-previews-the-elementalist-role/#commentsFiled under: , , , , , , , ,

New Darkfall video previews the Elementalist role
Aventurine has unveiled another teaser video for its Darkfall Unholy Wars reboot. This time we're treated to a look at the Elementalist role, which features the Air School staples of wind and lightning. The clip is narrated by Al Stellakis, who also serves as Darkfall's lead writer. Stellakis has two and a half minutes' worth of class information to disseminate, so click past the cut to get started.

Don't forget that you can look forward to downloading Darkfall on Steam in the near future, as the game has been greenlit by Valve's community.

Continue reading New Darkfall video previews the Elementalist role

MassivelyNew Darkfall video previews the Elementalist role originally appeared on Massively on Fri, 30 Nov 2012 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonal-stellakisaventurinedarkfalldarkfall-elementalistdarkfall-unholy-warsdarkfall-videodfelementalistfantasyopen-pvppvpsandboxunholy-warsvideoFri, 30 Nov 2012 16:00:00 EST<![CDATA[Darkfall Unholy Wars hits Steam Greenlight, debuts shiny new video]]>http://massively.joystiq.com/2012/11/28/darkfall-unholy-wars-hits-steam-greenlight-debuts-shiny-new-vid/http://massively.joystiq.com/2012/11/28/darkfall-unholy-wars-hits-steam-greenlight-debuts-shiny-new-vid/http://massively.joystiq.com/2012/11/28/darkfall-unholy-wars-hits-steam-greenlight-debuts-shiny-new-vid/#commentsFiled under: , , , , , , ,

Darkfall Unholy Wars hits Steam Greenlight, debuts shiny new video
Aventurine is making a bid to get Darkfall Unholy Wars on Steam, by way of Steam Greenlight. You can now vote (provided you have a Steam account) for the game to be a part of the ever-growing Steam stable.

Because just one blog post a day is for the weak, the Aventurine team also put out a new video, which takes a good look at the Brawler School. Brawlers are part of the Skirmisher role and are equipped with skills to increase their efficiency, sprint speed, leap, evade, and reflexes. If covering dizzying amounts of ground and controlling battle through movement sounds like your thing, you might consider checking out the video. We've included it below the cut because we're just that nice.

[Thanks to savvy webizen Bartillo for the tip!]

Continue reading Darkfall Unholy Wars hits Steam Greenlight, debuts shiny new video

MassivelyDarkfall Unholy Wars hits Steam Greenlight, debuts shiny new video originally appeared on Massively on Wed, 28 Nov 2012 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinebrawlerdarkfalldarkfall-unholy-warsdev-diariesdev-diarydfdfuwfantasyopen-pvppvpsandboxsteamsteam-greenlightunholy-warsvideovideosWed, 28 Nov 2012 15:00:00 EST<![CDATA[Newest Darkfall dev blog shows off Unholy Wars' streamlined UI]]>http://massively.joystiq.com/2012/11/24/newest-darkfall-dev-blog-shows-off-unholy-wars-streamlined-ui/http://massively.joystiq.com/2012/11/24/newest-darkfall-dev-blog-shows-off-unholy-wars-streamlined-ui/http://massively.joystiq.com/2012/11/24/newest-darkfall-dev-blog-shows-off-unholy-wars-streamlined-ui/#commentsFiled under: , , , , , , , ,

Newest Darkfall dev blog shows off Unholy Wars' streamlined GUI
In any game, a clunky, unintuitive UI can hamper players' ability to enjoy a game. But in a game like Darkfall where mere moments can be the difference between life and death, a bad interface can be a deal-breaker. In the latest dev blog, Coordinating Designer Tork Shaw explained some of the changes coming to Unholy Wars to give the game a fast-paced UI that won't impede combat.

The video portion of the blog demonstrated some of the new features, including the new radial menu, which Shaw called "a whole new way to interact with the game." He said, "It allows for much more action-based combat, so players who are familiar with FPS games or action-combat games will be much more at home playing Darkfall." The new UI will allow also players to switch between the different roles, such as from warrior to caster, at will.

The dev blog also offers more details on the feat system (which rewards players for acts of bravery, skill, exploration, or development) as well as the new personal and clan currencies. You can read more on these changes in the dev blog and preview the new UI in the video after the break.

[Thanks to Bartillo for the tip!]

MassivelyNewest Darkfall dev blog shows off Unholy Wars' streamlined UI originally appeared on Massively on Sat, 24 Nov 2012 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinedarkfalldarkfall-unholy-warsdev-blogdeveloper-diarydffantasyGUInew-UInew-ui-featuresopen-pvppvpsandboxtork-shawUIUnholy-Warsvideo-dev-diaryvideo-developer-blogvideo-developer-diarySat, 24 Nov 2012 19:00:00 EST<![CDATA[Darkfall posts a new preview of the Battle-Brand role]]>http://massively.joystiq.com/2012/11/21/darkfall-posts-a-new-preview-of-the-battle-brand-role/http://massively.joystiq.com/2012/11/21/darkfall-posts-a-new-preview-of-the-battle-brand-role/http://massively.joystiq.com/2012/11/21/darkfall-posts-a-new-preview-of-the-battle-brand-role/#commentsFiled under: , , , , ,

Darkfall rejects your idea about bandages being a physical thing.
You should know your role in Darkfall Unholy Wars. After all, your role determines a lot of what you're capable of doing at any given time, so it's pretty important. The newest development blog on the game gives a preview of one of the updated re-release's new roles for the Warrior, the defensive school known as the Battle-Brand. This is not a role for going out and making people miserable; this is a role for ruining the days of those trying to make you miserable.

The Battle-Brand's abilities include two self-buffs to reduce magical damage taken and reflect a portion of damage taken back to the source. It also features Foebringer, an AoE pull for all nearby enemies, and Bandage, a self-healing spell to keep the Warrior up longer. Last but not least is the ultimate ability, Stoic Defense, which makes the Warrior entirely immune to damage for a short time while consuming mana and stamina. Take a look at the role's abilities in action in a preview video just past the cut.

[Thanks to bartillo for the tip!]

Continue reading Darkfall posts a new preview of the Battle-Brand role

MassivelyDarkfall posts a new preview of the Battle-Brand role originally appeared on Massively on Wed, 21 Nov 2012 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>abilitiesability-previewagonaventurinebattle-brandclassclassesdarkfalldarkfall-unholy-warsdefensedefensivedfdfuwfantasyopen-pvppreviewpvpre-releaserolerolessandboxunholy-warsvideovideosWed, 21 Nov 2012 18:30:00 EST<![CDATA[Darkfall Unholy Wars video details the Fire Mage]]>http://massively.joystiq.com/2012/11/19/darkfall-unholy-wars-video-details-the-fire-mage/http://massively.joystiq.com/2012/11/19/darkfall-unholy-wars-video-details-the-fire-mage/http://massively.joystiq.com/2012/11/19/darkfall-unholy-wars-video-details-the-fire-mage/#commentsFiled under: , , , , , ,

Darkfall Unholy Wars video details the Fire Mage
Fire School is in session! Aventurine has released a new video that shows off the skills of one aspect of Darkfall Unholy Wars' Elementalist role, and casters and and pyros-at-heart will enjoy a look into the Fire Mage. Feel like swimming through a bubbling lake of lava? Cast a self-buff and dive right in! Like to lob flaming balls at others and watch them catch fire? Then Fire Mage is the class for you!

Like its name implies, this particular mage uses an arsenal of fiery tricks to best opponents. The class focuses on medium- to long-range combat and incorporates knockbacks and area effects into many of the spells. For a demonstration of Dragonbreath, Magma Bomb, Heat Stroke, and other skills, check out the sizzling video after the break.

Continue reading Darkfall Unholy Wars video details the Fire Mage

MassivelyDarkfall Unholy Wars video details the Fire Mage originally appeared on Massively on Mon, 19 Nov 2012 10:15:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agonaventurinedarkfalldfElementalist-RolefantasyFire-MageFire-Schoolopen-pvppvpsandboxunholy-warsvideoMon, 19 Nov 2012 10:15:00 EST<![CDATA[New Darkfall dev diary vid talks art direction, Unholy Wars changes]]>http://massively.joystiq.com/2012/11/15/new-darkfall-dev-diary-vid-talks-art-direction-unholy-wars-chan/http://massively.joystiq.com/2012/11/15/new-darkfall-dev-diary-vid-talks-art-direction-unholy-wars-chan/http://massively.joystiq.com/2012/11/15/new-darkfall-dev-diary-vid-talks-art-direction-unholy-wars-chan/#commentsFiled under: , , , , ,

New Darkfall dev diary vid talks art direction, Unholy Wars changes
So Darkfall 1.0 has come and gone, as Aventurine has officially closed the servers in preparation for the Unholy Wars reboot. The firm has also released a five-minute dev diary video featuring creative lead Adam Oikonomopoulos, who talks at length about the game's art direction updates and AV's expanded creative vision.

The video boasts a bunch of fly-through shots that show off Agon's new textures, higher polygon counts, and improved shaders, many of which are a marked improvement over the originals (that date back to the game's genesis in 2002 in some cases).

Oikonomopoulos also mentions that Unholy Wars and the original Darkfall are set "several hundred years apart," which accounts for some of the changes in both the landscape and the game's architecture.

Continue reading New Darkfall dev diary vid talks art direction, Unholy Wars changes

MassivelyNew Darkfall dev diary vid talks art direction, Unholy Wars changes originally appeared on Massively on Thu, 15 Nov 2012 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>adam-oikonomopoulosagonart-directionaventurinedarkfalldarkfall-art-directiondarkfall-unholy-warsdffantasyopen-pvppvpsandboxunholy-warsvideoThu, 15 Nov 2012 11:00:00 EST