Massively http://massively.joystiq.com Massively http://www.blogsmithmedia.com/http://massively.joystiq.com/media/feedlogo.gif Massively http://massively.joystiq.com en-us Copyright 2015 AOL, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[Final Fantasy XIV's Yoshida on housing, test servers, and post-Fanfest]]>http://massively.joystiq.com/2014/11/12/final-fantasy-xivs-yoshida-on-housing-test-servers-and-post-f/http://massively.joystiq.com/2014/11/12/final-fantasy-xivs-yoshida-on-housing-test-servers-and-post-f/http://massively.joystiq.com/2014/11/12/final-fantasy-xivs-yoshida-on-housing-test-servers-and-post-f/#commentsFiled under: , , , , , , , , ,

Two Massively employees in the same game at once? The world is madness. (No, you get no hints about who.)
Final Fantasy XIV has had a busy year, and it looks to be having a busy next year to boot. The game's first expansion is in the works and planned for a release in spring of 2015, along with another major patch to cap off the game's current patch cycle. And director/producer Naoki Yoshida continues steering the ship, working what I can only assume is a 200-hour week.

I had a chance to ask a few questions of Yoshida around the time of the first two fanfests of the year (the final one is scheduled for December in Tokyo), ranging from housing questions to the promise of public test servers to how hard it will be to establish an Eternal Bond. Jump on past the break to read the full interview!

Continue reading Final Fantasy XIV's Yoshida on housing, test servers, and post-Fanfest

MassivelyFinal Fantasy XIV's Yoshida on housing, test servers, and post-Fanfest originally appeared on Massively on Wed, 12 Nov 2014 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>consoleconsolesexpansionfantasyfeaturedffff14ffxivffxiv-heavenswardffxiv-patch-2.4final-fantasyfinal-fantasy-14final-fantasy-xivgame-mechanicshalf-featureheavenswardhousinginterviesinterviewmechanicsnaoki-yoshidanewsnews-itemspatch-2.4player-housingsquaresquare-enixWed, 12 Nov 2014 11:00:00 EST<![CDATA[The Mog Log: Final Fantasy XIV's post-fanfest shakedown]]>http://massively.joystiq.com/2014/10/20/the-mog-log-final-fantasy-xivs-post-fanfest-shakedown/http://massively.joystiq.com/2014/10/20/the-mog-log-final-fantasy-xivs-post-fanfest-shakedown/http://massively.joystiq.com/2014/10/20/the-mog-log-final-fantasy-xivs-post-fanfest-shakedown/#commentsFiled under: , , , , , , , , ,

Honestly, if the existence of the cash shop is the only rude surprise awaiting us, I'll be happy.
So Final Fantasy XIV players like yours truly have a mouthful of fanfest information to chew on. How did it all shake down, in the final assessment?

Well, I'm not going to lie: My aim was mixed at best. A minority of demo stations covering content I hadn't anticipated, patch 2.4 a week after my prediction, and mentions of 2.5 in brief. But we did get gear details and an expansion announcement. I'd call it a mix and a wash, at the end of the day. You tried, gold star, etc.

But enough about what I did and didn't get right; there's plenty more to talk about from the various panels, the Live Letter, and other revelations. So let's start in on it, kicking off with the elephant in the room that I've already been hearing about for the entirety of the past day for obvious reasons. Yes, it's a cash shop.

Continue reading The Mog Log: Final Fantasy XIV's post-fanfest shakedown

MassivelyThe Mog Log: Final Fantasy XIV's post-fanfest shakedown originally appeared on Massively on Mon, 20 Oct 2014 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>business-modelscash-shopclassclassescolumncolumnsexpansionexpansionsfanfestfeaturefeaturedffff14ffxivffxiv-fanfestffxiv-fanfest-2014ffxiv-patch-2.4final-fantasyfinal-fantasy-14final-fantasy-xivjobjobsnaoki-yoshidaopinionpatchpatchespreviewsquaresquare-enixsubscriptionthe-mog-logupdateupdatesMon, 20 Oct 2014 12:00:00 EST<![CDATA[Final Fantasy XIV celebrates a year since its relaunch]]>http://massively.joystiq.com/2014/08/27/final-fantasy-xiv-celebrates-a-year-since-its-relaunch/http://massively.joystiq.com/2014/08/27/final-fantasy-xiv-celebrates-a-year-since-its-relaunch/http://massively.joystiq.com/2014/08/27/final-fantasy-xiv-celebrates-a-year-since-its-relaunch/#commentsFiled under: , , , , , ,

Well this is much more pleasant than what exploded in the night sky at Carteneau.
As of today, Final Fantasy XIV has made it a full year since its successful relaunch. Producer Naoki Yoshida took the time to celebrate with a special letter from the producer, looking back at the past year of operation, both the pitfalls and the highlights. He also thanks the fans and especially the Legacy players for having stood by the game from a rocky inception to the present, and looks forward to upcoming patches, the pending Fan Fest, and the as-yet-unrevealed expansion.

Today also marks the start of a seasonal event to celebrate the anniversary, featuring new minipets, a new emote, and new items for players to enjoy. The event will run until September 8th, giving everyone time to complete the sequence if they so choose. So here's to a year of the resurrected game, and let's hope for many more to come.

MassivelyFinal Fantasy XIV celebrates a year since its relaunch originally appeared on Massively on Wed, 27 Aug 2014 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>anniversaryanniversary-celebrationanniversary-eventconsoleconsoleseventfantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivin-game-eventletter-from-the-producernaoki-yoshidanewsnews-itemssquaresquare-enixWed, 27 Aug 2014 13:00:00 EST<![CDATA[Yoshida: Let's analyze why Final Fantasy XIV's 2010 version failed]]>http://massively.joystiq.com/2014/07/15/yoshida-lets-analyze-why-final-fantasy-xiv-failed/http://massively.joystiq.com/2014/07/15/yoshida-lets-analyze-why-final-fantasy-xiv-failed/http://massively.joystiq.com/2014/07/15/yoshida-lets-analyze-why-final-fantasy-xiv-failed/#commentsFiled under: , , ,

GDC Vault
Final Fantasy XIV's game director, Naoki Yoshida, spoke candidly at his presentation during this year's Game Developer's Conference in March about what went wrong with the popular franchise's newest MMO during its first launch.

As FFXIV fans might remember, the initial launch of the game in 2010 was plagued with problems, but a relaunch in 2013 proved successful. How did the team at Square Enix win back fans? How had the MMO landscape changed in those three years?

The complete one-hour presentation video is available in both English and Japanese versions through the GDC Vault, or you can watch a translated version at Gamasutra.

MassivelyYoshida: Let's analyze why Final Fantasy XIV's 2010 version failed originally appeared on Massively on Tue, 15 Jul 2014 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>consoleconsolesfantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivgdcgdc-vaultnaoki-yoshidapanelpresentationsquaresquare-enixvideoTue, 15 Jul 2014 16:00:00 EST<![CDATA[Final Fantasy XIV offers more details on the Hunt system]]>http://massively.joystiq.com/2014/07/07/final-fantasy-xiv-offers-more-details-on-the-hunt-system/http://massively.joystiq.com/2014/07/07/final-fantasy-xiv-offers-more-details-on-the-hunt-system/http://massively.joystiq.com/2014/07/07/final-fantasy-xiv-offers-more-details-on-the-hunt-system/#commentsFiled under: , , , , , ,

Do you think he can see us? Because... seriously, if I woke up looking like that, I would just... move toward the nearest living thing and kill it.
Are you looking forward to stalking and destroying the rarest beasts across the land of Eorzea? Then you'll want to read the latest Final Fantasy XIV letter from Producer Naoki Yoshida, who takes the time to talk in a little more depth about the Hunt system. The basics have already been established, but how will Elite Marks avoid horror stories of players camping spawns and only one person getting any reward for all of the effort?

Yoshida explains that the Elite Marks are meant to offer rewards to everyone who takes part in killing them, meaning that multiple players or parties taking down the monster will just result in more people getting the rewards. Some of the Marks are even meant to provide a challenge for multiple parties, anot several do not respawn in the same places, providing more incentive to wander, search, and help out. Check out the full letter for more details, and get ready to experience the system yourself when patch 2.3 goes live tomorrow.

MassivelyFinal Fantasy XIV offers more details on the Hunt system originally appeared on Massively on Mon, 07 Jul 2014 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>claimclaimsconsoleconsoleselite-marksfantasyffff14ffxivffxiv-patch-2.3final-fantasyfinal-fantasy-14final-fantasy-xivgame-mechanicshuntmarksnaoki-yoshidanewsnews-itemsnotorious-monsterspatchpatch-2.3patchesspawnsquaresquare-enixupdateupdatesMon, 07 Jul 2014 15:00:00 EST<![CDATA[E3 2014: FFXIV's Yoshida on 2.4, 3.0, new classes, and more]]>http://massively.joystiq.com/2014/06/12/e3-2014-ffxivs-yoshida-on-2-4-3-0-new-classes-and-more/http://massively.joystiq.com/2014/06/12/e3-2014-ffxivs-yoshida-on-2-4-3-0-new-classes-and-more/http://massively.joystiq.com/2014/06/12/e3-2014-ffxivs-yoshida-on-2-4-3-0-new-classes-and-more/#commentsFiled under: , , , ,

After the recent E3 2014 announcement that Final Fantasy XIV was getting a new class and a marriage system, fans have been understandably eager to learn more. And the best way to do that is go to the source! We sat down with producer Naoki Yoshida to discuss the content slated for upcoming patches and expansions.

Before delving into the new, Yoshida spoke about the old. He noted that since last year's expo, FFXIV has enjoyed a successful relaunch, added a couple of major updates, and given millions of gamers around the world the opportunity to play. He then led into the new by saying, "We want to continue to grow the game from here. We have a lot of exciting content building up to 3.0." Part of said growing includes expanding the availability of the game by getting it into even more regions; this summer, for example, FFXIV will launch in China. Another part of the growth process is expanding the content and introducing new features, which is where patch 2.4 and the 3.0 expansion come in.

Continue reading E3 2014: FFXIV's Yoshida on 2.4, 3.0, new classes, and more

MassivelyE3 2014: FFXIV's Yoshida on 2.4, 3.0, new classes, and more originally appeared on Massively on Thu, 12 Jun 2014 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>conconsoleconsolesconventionconvention-coveragee3e3-2014electronic-entertainment-expoevent-coverageexpofantasyfeaturedffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivinterviewinterviewsmassively-event-coveragenaoki-yoshidanaoki-yoshida-interviewsquaresquare-enixyoshi-pYoshidaThu, 12 Jun 2014 09:00:00 EST<![CDATA[E3 2014: Final Fantasy XIV discusses ninjas and same-sex marriage]]>http://massively.joystiq.com/2014/06/10/e3-2014-final-fantasy-xiv-discusses-ninjas-and-same-sex-marriag/http://massively.joystiq.com/2014/06/10/e3-2014-final-fantasy-xiv-discusses-ninjas-and-same-sex-marriag/http://massively.joystiq.com/2014/06/10/e3-2014-final-fantasy-xiv-discusses-ninjas-and-same-sex-marriag/#commentsFiled under: , , , , , , ,

A lot of people have good reason to be happy about this.
The first of two official livestreams for Final Fantasy XIV has just wrapped up at E3. While the stream focused on a variety of questions from the fans, two big points were hit during the discussion. The first was the revelation of a new class slated for introduction in patch 2.4: the Rogue class, which will lead into the Ninja job. This will be a damage-dealing class that dual wields knives and daggers, complete with enhanced movement skills and stealth abilities.

Producer Naoki Yoshida also announced that the game's marriage system will allow any two characters to be joined together, regardless of race, nation, or gender. The translated answer explained that in the world of Eorzea, it seemed inappropriate to restrict the system. Players will be given the options of having their characters pledge eternal love or simply eternal friendship, with the possibility of special mounts for the happy couple.

Massively's on the ground in Los Angeles during the week of June 10-12, bringing you all the best news from E3 2014. We're covering everything from WildStar and Landmark to Skyforge and H1Z1, so stay tuned!

MassivelyE3 2014: Final Fantasy XIV discusses ninjas and same-sex marriage originally appeared on Massively on Tue, 10 Jun 2014 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>classclassesconconsoleconsolesconventionconvention-coveragee3e3-2014electronic-entertainment-expoevent-coverageexpofantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivin-game-marriagemarriagemarriage-systemmassively-event-coveragenaoki-yoshidanewsnews-itemssquaresquare-enixTue, 10 Jun 2014 17:30:00 EST<![CDATA[Final Fantasy XIV's next live letter is on its way]]>http://massively.joystiq.com/2014/05/09/final-fantasy-xivs-next-live-letter-is-on-its-way/http://massively.joystiq.com/2014/05/09/final-fantasy-xivs-next-live-letter-is-on-its-way/http://massively.joystiq.com/2014/05/09/final-fantasy-xivs-next-live-letter-is-on-its-way/#commentsFiled under: , , , , , ,

Yes, I know Isgebind won't be there, but I still like that big ice lizard.
Are you ready to take on the Lord of Levin, the primal Ramuh? To brave the depths of Stone Vigil and Tam-Tara Deepcroft in Hard mode? To see what the deal is with Hullbreaker Isle? Well, then, you're going to want to tune in to the next Final Fantasy XIV Letter from the Producer LIVE, currently scheduled for May 24th at 7 a.m. EDT. Because yes, the topic under discussion is the upcoming patch 2.3 and all that it entails.

As always, a thread is available for players to ask questions for the live letter, and a translated transcript will be made available on the official forums. Aside from the aforementioned topics, the letter will also cover Item Desynthesis, Daily Hunts, and an interview with lead designer Takeo Suzuki regarding gear, monsters, emotes, and hairstyles. If you've got a burning question on any of these topics, you've got a chance to get it answered live when the next letter comes around.

MassivelyFinal Fantasy XIV's next live letter is on its way originally appeared on Massively on Fri, 09 May 2014 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bossesconsoleconsolesdungeonsendgamefantasyffff14ffxivffxiv-patch-2.3final-fantasyfinal-fantasy-14final-fantasy-xivnaoki-yoshidanewsnews-itemspatchpatch-previewpatchesprimalssquaresquare-enixtakeo-suzukiupdateupdatesFri, 09 May 2014 13:00:00 EST<![CDATA[New Final Fantasy XIV producer's letter talks China and 2.25]]>http://massively.joystiq.com/2014/04/23/new-final-fantasy-xiv-producers-letter-talks-china-and-2-25/http://massively.joystiq.com/2014/04/23/new-final-fantasy-xiv-producers-letter-talks-china-and-2-25/http://massively.joystiq.com/2014/04/23/new-final-fantasy-xiv-producers-letter-talks-china-and-2-25/#commentsFiled under: , , , , , , ,

Naoki Yoshida, seen here being a friend to all mankind.
Final Fantasy XIV is doing pretty well for itself at the moment, and it's still expanding. The latest letter from producer Naoki Yoshida discusses preparations for the game's launch in China, with the cooperation of Shanda Games. Service is expected to launch this summer; the game has just recently launched on the PlayStation 4, expanding its range of available platforms.

Yoshida also discusses patch 2.25, which will be live tomorrow. Originally, the patch was slated to include an expansion to the current Zodiac weapon quests; however, Yoshida states in the letter that this system is being pushed back until patch 2.28 goes live in May. The team is hoping to incorporate feedback on the existing quest line and allow players more time to upgrade and receive their Animus weaponry. 2.25 will contain improvements to the Wolves' Den PvP system as well as a new system involving materia, so while further weapon upgrades are on hold, there's still going to be plenty of new things to do.

MassivelyNew Final Fantasy XIV producer's letter talks China and 2.25 originally appeared on Massively on Wed, 23 Apr 2014 14:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>consoleconsolesfantasyffff14ffxivffxiv-patch-2.25final-fantasyfinal-fantasy-14final-fantasy-xivinternational-launchlaunchletter-from-the-producernaoki-yoshidanewsnews-itemspatch-2.25shanda-gamessquaresquare-enixupdatesyoshi-pWed, 23 Apr 2014 14:30:00 EST<![CDATA[FFXIV's Yoshida on successful relaunches, switching from sub to F2P]]>http://massively.joystiq.com/2014/04/18/ffxivs-yoshida-on-successful-relaunches-switching-from-sub-to/http://massively.joystiq.com/2014/04/18/ffxivs-yoshida-on-successful-relaunches-switching-from-sub-to/http://massively.joystiq.com/2014/04/18/ffxivs-yoshida-on-successful-relaunches-switching-from-sub-to/#commentsFiled under: , , , , , , ,

FFXIV NPCs
Final Fantasy XIV producer Naoki Yoshida speaks from a unique position, both because he's responsible for an ultra-rare triple-A MMO relaunch and because Final Fantasy XIV: A Realm Reborn debuted with -- and continues to sport -- a subscription model.

Gamasutra recently interviewed Yoshida about FFXIV's success, whether or not he feels any sort of vindication, and his thoughts on the future of future subscription-based MMOs. While Yoshida says that there are pros and cons to both subs and F2P, he ultimately prefers subs, and he believes that most other MMO developers do as well.

"Some titles have to make the hard decision to switch over to free-to-play and try to gain a quick buck, pretty much, and raise their ARPU, and try to gain revenue in that manner," Yoshida explains. "I feel that they're not flipping over because they want to; sometimes, they're forced to go into that because they need to update."

MassivelyFFXIV's Yoshida on successful relaunches, switching from sub to F2P originally appeared on Massively on Fri, 18 Apr 2014 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>consoleconsolesf2pfantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivinterviewnaoki-yoshidasquaresquare-enixsubscriptionFri, 18 Apr 2014 11:00:00 EST<![CDATA[FFXIV's Yoshida on the business benefits of the subscription model]]>http://massively.joystiq.com/2014/03/28/ffxivs-yoshida-on-the-business-benefits-of-the-subscription-mod/http://massively.joystiq.com/2014/03/28/ffxivs-yoshida-on-the-business-benefits-of-the-subscription-mod/http://massively.joystiq.com/2014/03/28/ffxivs-yoshida-on-the-business-benefits-of-the-subscription-mod/#commentsFiled under: , , , , , ,

Final Fantasy XIV beholder mount
Final Fantasy XIV producer Naoki Yoshida recently expounded on the benefits of the subscription model in an interview with GamesIndustry.biz.

While he acknowledges the popularity of F2P, he also says that it's not necessarily the best choice for every MMO. "With the subscription model, you have that constant flow of revenue. As game developers, creators of games, we want to be able to continue providing the best gameplay experience and sustain that," Yoshida explained.

"Of course, the initial subscriber numbers might not be as many as the free-to-play model, but we have that constant stream. We're not thinking just about the business of the moment. We want to think about the long term and being able to have the funding to continue making updates. Some people might be focused on quickly gaining revenue, but you have to think about the long term."

MassivelyFFXIV's Yoshida on the business benefits of the subscription model originally appeared on Massively on Fri, 28 Mar 2014 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>business-modelsconsoleconsolesfantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivnaoki-yoshidasquaresquare-enixsubscriptionFri, 28 Mar 2014 11:00:00 EST<![CDATA[GDC 2014: Final Fantasy XIV's Naoki Yoshida explains what tanked it and what saved it]]>http://massively.joystiq.com/2014/03/20/gdc-2014-final-fantasy-xivs-naoki-yoshida-explains-what-tanked/http://massively.joystiq.com/2014/03/20/gdc-2014-final-fantasy-xivs-naoki-yoshida-explains-what-tanked/http://massively.joystiq.com/2014/03/20/gdc-2014-final-fantasy-xivs-naoki-yoshida-explains-what-tanked/#commentsFiled under: , , , , , ,

FF14
There are many theories about what contributed to the spectacular crash-and-burn of the original Final Fantasy XIV, but perhaps the most insightful is the one from current Executive Producer Naoki Yoshida, who pinpointed the critical flaws that proved Square Enix's undoing.

At GDC this week, Yoshida said that the team had an "unhealthy obsession" with graphical fidelity above anything else and was stuck in the development mindset of Final Fantasy XI even as the genre had progressed. He said that A Realm Reborn's saving grace was the team's effort to establish an "optimal design flow" allowing for a rapid overhaul of the title.

It's also notable that Final Fantasy XIV has a new dev diary out today covering new gear and visual customizations called glamours that are coming with Patch 2.2.

MassivelyGDC 2014: Final Fantasy XIV's Naoki Yoshida explains what tanked it and what saved it originally appeared on Massively on Thu, 20 Mar 2014 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>a-realm-rebornconsoleconsolesfantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivgdcgdc-2014gear-customizationglamourglamoursinterviewnaoki-yoshidapatchpatch-2.2previewsquaresquare-enixThu, 20 Mar 2014 16:00:00 EST<![CDATA[Final Fantasy producers talk player numbers, what makes an MMO fun]]>http://massively.joystiq.com/2014/03/10/final-fantasy-producers-talk-player-numbers-what-makes-an-mmo-f/http://massively.joystiq.com/2014/03/10/final-fantasy-producers-talk-player-numbers-what-makes-an-mmo-f/http://massively.joystiq.com/2014/03/10/final-fantasy-producers-talk-player-numbers-what-makes-an-mmo-f/#commentsFiled under: , , , , , , , ,

Final Fantasy XIV finger wag
An enterprising user on the Square-Enix forums has translated a lengthy interview with Final Fantasy XIV producer Naoki Yoshida, Final Fantasy XI producer Akihiko Matsui, and Dragon Quest X producer Yousuke Saito. The piece originally ran on 4gamer.net, and it focuses on everything from the three developers' backgrounds to what makes an MMORPG fun.

Yoshida also drops a few hints about A Realm Reborn's player numbers, which include approximately 1.8 million accounts and 500,000 daily active users worldwide.

[Thanks Rohan!]

MassivelyFinal Fantasy producers talk player numbers, what makes an MMO fun originally appeared on Massively on Mon, 10 Mar 2014 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>Akihiko-Matsuiconsoleconsolesfantasyffff11ff14ffxiffxivfinal-fantasyfinal-fantasy-11final-fantasy-14final-fantasy-interviewfinal-fantasy-xifinal-fantasy-xivinterviewnaoki-yoshidanaoki-yoshida-interviewsquaresquare-enixyousuke-saitoMon, 10 Mar 2014 10:00:00 EST<![CDATA[Check out FFXIV on the PS4 through new screenshots, trailer, and dev video]]>http://massively.joystiq.com/2014/02/12/check-out-ffxiv-on-the-ps4-through-new-screenshots-trailer-and/http://massively.joystiq.com/2014/02/12/check-out-ffxiv-on-the-ps4-through-new-screenshots-trailer-and/http://massively.joystiq.com/2014/02/12/check-out-ffxiv-on-the-ps4-through-new-screenshots-trailer-and/#commentsFiled under: , , , , , ,

Final Fantasy XIV: A Realm Reborn is hitting the PlayStation 4 on April 14, 2014, but you don't have to wait until then to get a glimpse of the fantasy game on the console. Square Enix has released a number of new screenshots highlighting this version along with the official PS4 trailer. Additionally, Producer Naoki Yoshida shares his experience with developing the console version in another video entitled "PS4 Conversations with Creators." And we've got them all right here for you.

If you own a PS4 and you'd like to test the game out, you can join A Realm Reborn's beta for free. The first phase is currently scheduled for February 22nd through March 3, 2014, and the second test will be April 4 though April 7, 2014. On April 11th, all players who own the game on PS3 will be able to transfer their accounts for free.

[Source: Square Enix press release]

Continue reading Check out FFXIV on the PS4 through new screenshots, trailer, and dev video

MassivelyCheck out FFXIV on the PS4 through new screenshots, trailer, and dev video originally appeared on Massively on Wed, 12 Feb 2014 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>a-realm-rebornbetaconsoleconsole-betaconsolesfantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivgalleriesgallerynaoki-yoshidaplaystation-4ps4screenshotscreenshotssquaresquare-enixtrailertrailersvideovideosWed, 12 Feb 2014 11:00:00 EST<![CDATA[AbleGamers names Final Fantasy XIV accessible mainstream game of the year]]>http://massively.joystiq.com/2014/01/28/ablegamers-names-final-fantasy-xiv-accessible-mainstream-game-of/http://massively.joystiq.com/2014/01/28/ablegamers-names-final-fantasy-xiv-accessible-mainstream-game-of/http://massively.joystiq.com/2014/01/28/ablegamers-names-final-fantasy-xiv-accessible-mainstream-game-of/#commentsFiled under: , , , , , , ,

Final Fantasy XIV
AbleGamers is the "largest community of gamers with disabilities on the web,"along with being a non-profit organization that works to help folks with disabilities enjoy video games. AbleGamers reviews games as they come out, but not in the traditional way. Instead, games are rated based on their accessibility and the options available to disabled gamers who may need to customize their gaming experiences.

This year, Square Enix's Final Fantasy XIV: A Realm Reborn has taken top honors as AbleGamers's accessible mainstream game of 2013. The organization cited FFIXV's customizable control scheme, adjustable UI elements, and use of text-based story text that moves at the player's pace as strengths for gamers playing with disabilities.

Producer and director Naoki Yoshida accepted the award, taking a moment to highlight the Square Enix team's work toward making the game accessible and stating, "I would like to formally express my gratitude to AbleGamers for recognizing our efforts."

MassivelyAbleGamers names Final Fantasy XIV accessible mainstream game of the year originally appeared on Massively on Tue, 28 Jan 2014 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ablegamersaccessibilityawardsconsoleconsolesfantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivnaoki-yoshidasquaresquare-enixsubscriptionTue, 28 Jan 2014 17:30:00 EST<![CDATA[Final Fantasy XIV PS4 launch coming April 14th, details on patch 2.2 revealed]]>http://massively.joystiq.com/2014/01/26/final-fantasy-xivs-letter-to-the-producer-live-part-xii-delves/http://massively.joystiq.com/2014/01/26/final-fantasy-xivs-letter-to-the-producer-live-part-xii-delves/http://massively.joystiq.com/2014/01/26/final-fantasy-xivs-letter-to-the-producer-live-part-xii-delves/#commentsFiled under: , , , , ,

Final Fantasy XIV -- Letter to the Producer Live banner
Yesterday, Final Fantasy XIV players had a field day with the 12th installment of the Letter to the Producer Live stream, during which they launched a bevy of questions at the game's producer and director, Naoki Yoshida, and received a slew of answers in return. For starters, the game will launch on the PS4 on April 14th and include a collector's edition. The beta will begin on February 22nd as previously reported.

Patch 2.2, aka Through the Maelstrom, which Yoshida revealed will go live sometime in March, will bring with it an array of new content such as the Ruins of Amdapor dungeon, an expansion to the Binding Coil of Bahamut instance, and last but certainly not least, a new Primal to fight: the aquatic Leviathan.

While the most die-hard of fans likely saw the livestream when it was... well, live, those who missed out need not despair because the entirety of the question-and-answer session has been transcribed in its own thread on the game's official forums.

MassivelyFinal Fantasy XIV PS4 launch coming April 14th, details on patch 2.2 revealed originally appeared on Massively on Sun, 26 Jan 2014 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>consoleconsolesfantasyffff14ffxivffxiv-patch-2.2final-fantasyfinal-fantasy-14final-fantasy-xivletter-from-the-producerletter-from-the-producer-liveleviathannaoki-yoshidapatch-2.2q-and-aquestion-and-answerruins-of-amdaporsquaresquare-enixthrough-the-maelstromyoshi-pyoshidaSun, 26 Jan 2014 12:00:00 EST<![CDATA[Final Fantasy XIV executive producer defends expensive housing costs]]>http://massively.joystiq.com/2013/12/17/final-fantasy-xiv-executive-producer-defends-expensive-housing-c/http://massively.joystiq.com/2013/12/17/final-fantasy-xiv-executive-producer-defends-expensive-housing-c/http://massively.joystiq.com/2013/12/17/final-fantasy-xiv-executive-producer-defends-expensive-housing-c/#commentsFiled under: , , ,

FFXIV
Those following the recent housing fiasco in Final Fantasy XIV have been waiting on the official word from Square-Enix concerning the exorbitant costs for free company plots. Executive Producer Naoki Yoshida finally did just that, delivering a lengthy defense of the studio's decision while promising that upcoming personal housing will be much less expensive.

Yoshida said that the high cost in intended to prevent wealthy players from snapping up all of the plots and that all players will be earning more money with patch 2.1. "I understand that, in taking these measures to ensure even distribution of land, we are asking for considerable patience from those players who are eager to enjoy housing right away," he said. "While I sympathize with players concerns, we believe that this is in the best long-term interests of the game."

Yoshida's team forecasts that 80% of current free companies will be able to buy a small plot of land within three months of the patch going live. He also said that prices will begin to fall on unpurchased plots of land every six hours and that the team is looking into expanding servers and housing areas.

MassivelyFinal Fantasy XIV executive producer defends expensive housing costs originally appeared on Massively on Tue, 17 Dec 2013 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2.1consoleconsolesfantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivfree-company-housingguild-housinghousinghousing-fiasconaoki-yoshidapatch-2.1squaresquare-enixTue, 17 Dec 2013 16:30:00 EST<![CDATA[FFXIV: A Realm Reborn will launch on PS4 in April]]>http://massively.joystiq.com/2013/12/03/ffxiv-a-realm-reborn-nabs-new-award-at-playstation-ceremony/http://massively.joystiq.com/2013/12/03/ffxiv-a-realm-reborn-nabs-new-award-at-playstation-ceremony/http://massively.joystiq.com/2013/12/03/ffxiv-a-realm-reborn-nabs-new-award-at-playstation-ceremony/#commentsFiled under: , , , , , ,

Final Fantasy XIV: A Realm Reborn can truly be called a special game, and it has a "Special Award" to prove it! The fantasy game was recognized at the PlayStation Awards 2013 ceremony for its originality, buzz-worthiness, influence, and performance, taking home the "Special Award" that was created to honor those exact qualities. Currently playable on the PS3, FFXIV: ARR will start beta on the PS4 February 22nd, 2014 and launch officially on that platform in April.

Players who want to see the game in action on the new console before the beta can tune into the next Producers Letter Live on December 14th at 7:00 a.m. EST. At that time, Producer Naoki Yoshida will demonstrate the PS4 version as well as highlight The Wolves' Den, Treasure Hunting, and Daily Beast Tribe Quests, three aspects of the new 2.1 content that launches three days later.

[Source: Square Enix press release]

MassivelyFFXIV: A Realm Reborn will launch on PS4 in April originally appeared on Massively on Tue, 03 Dec 2013 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>a-realm-rebornconsoleconsolesfantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivfinal-fantasy-xiv-a-realm-rebornNaoki-YoshidaPlayStation-AwardPlayStation-Awards-2013producers-letter-live-dateSpecial-Awardsquaresquare-enixTue, 03 Dec 2013 12:00:00 EST<![CDATA[Final Fantasy XIV livestream details upcoming changes and the Crystal Tower]]>http://massively.joystiq.com/2013/12/02/final-fantasy-xiv-livestream-details-upcoming-changes-and-the-cr/http://massively.joystiq.com/2013/12/02/final-fantasy-xiv-livestream-details-upcoming-changes-and-the-cr/http://massively.joystiq.com/2013/12/02/final-fantasy-xiv-livestream-details-upcoming-changes-and-the-cr/#commentsFiled under: , , , , , ,

Screencap -- Final Fantasy XIV Letter from the Producer livestream
Final Fantasy XIV recently hosted its tenth Letter from the Producer livestream, in which producer Naoki Yoshida (or as the fans call him, Yoshi-P) tackles a number of questions regarding the game's upcoming changes and new content. The livestream itself is available for viewing in all of its two-and-a-half hour glory, but if you're just interested in the juicy questions and answers (or if you don't happen to speak Japanese), they're all transcribed in the official post.

The questions run the gamut from planned changes for some classes such as Dragoon and Bard to details on the upcoming aesthetician, which will allow players to change their character's hairstyle for 2,000 gil. The majority of the questions, however, are on the topic of the upcoming 24-player Crystal Tower dungeon. Yoshida provides details on the dungeon's planned difficulty (it will have an average item level requirement of 55), how loot will be distributed (each boss will drop one loot chest for each party participating), the quality of gear players will receive (item level 80, slightly weaker than gear from Binding Coil of Bahamut), and much more. For the full Q&A transcript, head on over to the game's official forums, or click past the cut to watch the livestream in its entirety.

Continue reading Final Fantasy XIV livestream details upcoming changes and the Crystal Tower

MassivelyFinal Fantasy XIV livestream details upcoming changes and the Crystal Tower originally appeared on Massively on Mon, 02 Dec 2013 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>consoleconsolescrystal-towerfantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivletter-from-the-producerlivestreamlivestreamsnaoki-yoshidaq-and-aqaquestion-and-answersquaresquare-enixtrailertrailersvideovideosyoshi-pMon, 02 Dec 2013 17:00:00 EST<![CDATA[Final Fantasy XIV's 2.1 patch coming December 17th]]>http://massively.joystiq.com/2013/11/22/final-fantasy-xivs-2-1-patch-coming-december-17th/http://massively.joystiq.com/2013/11/22/final-fantasy-xivs-2-1-patch-coming-december-17th/http://massively.joystiq.com/2013/11/22/final-fantasy-xivs-2-1-patch-coming-december-17th/#commentsFiled under: , , , , , , , , , ,

During Final Fantasy XIV's live producer's letter that aired this morning, Naoki Yoshida offered players a look at a variety of new features coming in 2.1 and dropped the date and name for the patch. A Realm Awoken will hit servers on December 17th in Japan (which could translate to December 16th in the West, depending on the time of day).

Throughout the stream, Yoshida fielded player questions while discussing the upcoming content, which includes, but is not limited to, new gear, the Crystal Tower content, new hard-mode dungeons, extreme primal battles, veteran rewards, and Dragoon adjustments. You can read up on the answers in the Q&A thread available on the forums. An additional look at 2.1, including the PlayStation 4 version, is coming in the next live producer's letter on December 14th. We'll update you with the full recording as soon as the official Q&A summary goes live!

MassivelyFinal Fantasy XIV's 2.1 patch coming December 17th originally appeared on Massively on Fri, 22 Nov 2013 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2.1-A-Realm-Awoken2.1-patchA-Realm-Awokenconsoleconsolesfantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivNaoki-Yoshidanew-contentpatch-2.1PlayStation-4producers-letterproducers-letter-livePS4squaresquare-enixFri, 22 Nov 2013 12:00:00 EST<![CDATA[Square's financial outlook improves thanks to FFXIV]]>http://massively.joystiq.com/2013/11/05/squares-financial-outlook-improves-thanks-to-ffxiv/http://massively.joystiq.com/2013/11/05/squares-financial-outlook-improves-thanks-to-ffxiv/http://massively.joystiq.com/2013/11/05/squares-financial-outlook-improves-thanks-to-ffxiv/#commentsFiled under: , , , , ,

Square's financial outlook improves thanks to FFXIV
Square-Enix has revised its financial outlook and now expects to finish the current quarter with a $47.6 million profit, The Escapist reports. Most of the credit goes to Final Fantasy XIV and its 1.5 million users, of course, but the piece also mentions Square's "company-wide cost cutting efforts" as part of the winning formula.

Final Fantasy XIV originally launched in 2010 before closing down and undergoing a radical redesign presided over by producer Naoki Yoshida.

MassivelySquare's financial outlook improves thanks to FFXIV originally appeared on Massively on Tue, 05 Nov 2013 21:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>consoleconsolesfantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivnaoki-yoshidasquaresquare-enixTue, 05 Nov 2013 21:00:00 EST<![CDATA[Final Fantasy XIV producer letter talks classes, cheating, and housing]]>http://massively.joystiq.com/2013/10/31/final-fantasy-xiv-producer-letter-talks-classes-cheating-and-h/http://massively.joystiq.com/2013/10/31/final-fantasy-xiv-producer-letter-talks-classes-cheating-and-h/http://massively.joystiq.com/2013/10/31/final-fantasy-xiv-producer-letter-talks-classes-cheating-and-h/#commentsFiled under: , , , , , ,

Final Fantasy XIV producer letter talks classes, cheating, and housing
A hefty two-and-a-half hour live Final Fantasy XIV producer's letter has tackled a wide range of questions from the community, including issues regarding class balance, anti-cheating efforts, and housing details. While free company housing is coming soon, the producer said that it will be another half-year or so before individual housing arrives.

One of the big topics of the day was how the team is dealing with the disagreeable elements arising from the use of the duty finder. Square-Enix is considering changes to add a bulletin board-style system for more specific groups, better communication options for group participants, and an MVP voting system that will allow players to give points to good teammates that can be later spent on rewards.

Executive Producer Naoki Yoshida also addressed the question of whether the game's subscriber numbers are decreasing: "As FFXIV:ARR is a subscription-based business model, naturally there will be players who will not play anymore once they finish the main scenario. MMORPGs that launched after 2008 with a subscription based model retained a maximum of 35% of their users during the first month of subscriptions. However, FFXIV:ARR has surpassed this number by a wide margin."

There's a lot covered for Final Fantasy XIV players who want to be in the know, so check it out!

MassivelyFinal Fantasy XIV producer letter talks classes, cheating, and housing originally appeared on Massively on Thu, 31 Oct 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>cheatingcommunity-q-and-aconsoleconsolesduty-finderfantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivhousinglive-q-and-anaoki-yoshidaproducers-letterq-and-asquaresquare-enixsubscribersThu, 31 Oct 2013 15:00:00 EST<![CDATA[Final Fantasy XIV promises 'fairly substantial' first update]]>http://massively.joystiq.com/2013/10/17/final-fantasy-xiv-promises-fairly-substantial-first-update/http://massively.joystiq.com/2013/10/17/final-fantasy-xiv-promises-fairly-substantial-first-update/http://massively.joystiq.com/2013/10/17/final-fantasy-xiv-promises-fairly-substantial-first-update/#commentsFiled under: , , , , ,

Final Fantasy XIV promises 'fairly substantial' first update
Final Fantasy XIV Executive Producer Naoki Yoshida wrote that the upcoming first update for the relaunched title will be "fairly substantial" in several categories. He said that the update will contain more activities for players to do, including daily quests, treasure hunts, new dungeons, primal battles, housing, and the return of the Good King Moggle Mog.

Update 2.1 will go on to introduce a character salon, a party search function, changes based on player feedback, an item-sort function, and the return of a character from the old version of the game.

Yoshida said that before the update hits, the team will tweak tomestone drop rates to make them easier for players to obtain and fix an issue with the Binding Coil of Bahamut that's keeping players from completing it.

MassivelyFinal Fantasy XIV promises 'fairly substantial' first update originally appeared on Massively on Thu, 17 Oct 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>a-realm-rebornconsoleconsolesfantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivGood-King-Moggle-MogNaoki-Yoshidapatchproducers-lettersquaresquare-enixupdateupdate-2.1Thu, 17 Oct 2013 15:00:00 EST<![CDATA[Final Fantasy XIV sums up its Tokyo Game Show letters]]>http://massively.joystiq.com/2013/10/07/final-fantasy-xiv-sums-up-its-tokyo-game-show-letters/http://massively.joystiq.com/2013/10/07/final-fantasy-xiv-sums-up-its-tokyo-game-show-letters/http://massively.joystiq.com/2013/10/07/final-fantasy-xiv-sums-up-its-tokyo-game-show-letters/#commentsFiled under: , , , , , , ,

Holding out for the Tower of Fanatics, really.
Final Fantasy XIV has been playable for just about a month. Gamers being what we are, a lot of us are already asking about what comes next for the game, because there's slightly less unexplored content than there was before. But fear not; the official live letters from producer and director Naoki Yoshida have been translated and the highlights recapped on the official site, giving everyone a closer look at what's coming from housing, PvP, and the new Crystal Tower.

Yoshida explains that Crystal Tower is meant to be easier than the Binding Coil of Bahamut currently accessible, although it is still inteded to be high-end content (he mentions the possibility of requiring relic weapons). Housing will be launched for Free Companies first, with the team closely examining the strain caused by these before putting in individual houses. Players can also expect every craft to be involved in providing decorations for housing rather than just a few, helping to make everyone's contributions relevant. Take a look at the full roundup for all the details, although the team remains mum on the price of houses.

MassivelyFinal Fantasy XIV sums up its Tokyo Game Show letters originally appeared on Massively on Mon, 07 Oct 2013 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>challengeconsoleconsolescrystal-towerdifficultydungeondungeonsendgameendgame-contentfantasyffff14ffxivffxiv-patch-2.1final-fantasyfinal-fantasy-14final-fantasy-xivhouseshousingnaoki-yoshidasquaresquare-enixMon, 07 Oct 2013 16:00:00 EST<![CDATA[Final Fantasy XIV tops 1 million unique logins, previews first patch]]>http://massively.joystiq.com/2013/09/21/final-fantasy-xiv-tops-1-million-unique-logins-and-looks-to-the/http://massively.joystiq.com/2013/09/21/final-fantasy-xiv-tops-1-million-unique-logins-and-looks-to-the/http://massively.joystiq.com/2013/09/21/final-fantasy-xiv-tops-1-million-unique-logins-and-looks-to-the/#commentsFiled under: , , , , ,

You will live here.
It might seem as if everyone is playing Final Fantasy XIV these days. In the most recent live Producer's Letter, Naoki Yoshida made it clear that while it's not everyone, the game has certainly attracted sizable numbers. Over one million unique logins have taken place since the launch, with an average of 617,000 unique daily logins and a concurrency peak of 344,000 users, which is pretty good when you take into account the game's troubled launch history.

But the development team isn't focusing just on the past. The game's first patch is in the works; it's due to hit the live servers this year, and it contains a lot of extra content. Housing will be included, as will the game's first PvP arena and new extreme difficulty fights for each of the Primals. The patch will also include a new Primal fight against Good King Moogle Mog, hard modes for two dungeons, a new dungeon, daily quests, random matching rewards, a treasure hunting system... a lot of stuff, in other words. So maybe those million unique players are on to something.

[Thanks to Scott for the tip]

MassivelyFinal Fantasy XIV tops 1 million unique logins, previews first patch originally appeared on Massively on Sat, 21 Sep 2013 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>consoleconsolesfantasyffff14ffxivffxiv-patch-2.1final-fantasyfinal-fantasy-14final-fantasy-xivloginsnaoki-yoshidapatchpatchesplayer-numberssquaresquare-enixstatsusersSat, 21 Sep 2013 20:00:00 EST<![CDATA[Final Fantasy XIV combats server congestion]]>http://massively.joystiq.com/2013/09/12/final-fantasy-xiv-combats-server-congestion/http://massively.joystiq.com/2013/09/12/final-fantasy-xiv-combats-server-congestion/http://massively.joystiq.com/2013/09/12/final-fantasy-xiv-combats-server-congestion/#commentsFiled under: , , ,

Final Fantasy XIV combats server congestion
Square Enix Producer Naoki Yoshida wants to assure players suffering from the heartbreak of server congestion that sunny days are indeed ahead for Final Fantasy XIV. To lessen the crush that players have put upon the game, the studio has added new worlds, instance servers, and a third duty finder group.

"Even with the previously discussed measures in place," he wrote, "there remain several overpopulated worlds that may still be subject to peak-time login and character creation restrictions."

Yoshida said that if all goes well through the weekend, Final Fantasy XIV's digital sales will resume. Future plans include relaxing restrictions on simultaneous logins and going forward with world transfers.

MassivelyFinal Fantasy XIV combats server congestion originally appeared on Massively on Thu, 12 Sep 2013 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>consoleconsolesdigital-salesfantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivnaoki-yoshidanew-serverssalesserverserver-congestionsquaresquare-enixtransfertransfersworld-transferThu, 12 Sep 2013 15:30:00 EST<![CDATA[PAX Prime 2013: FFXIV's Yoshida on rebuilding trust and expanding functionality]]>http://massively.joystiq.com/2013/09/01/pax-prime-ffxivs-yoshida-on-rebuilding-trust-and-expanding-fun/http://massively.joystiq.com/2013/09/01/pax-prime-ffxivs-yoshida-on-rebuilding-trust-and-expanding-fun/http://massively.joystiq.com/2013/09/01/pax-prime-ffxivs-yoshida-on-rebuilding-trust-and-expanding-fun/#commentsFiled under: , , , , , , , , ,

Pax Prime FFXIV yoshida part deux
Apart from Square's public presentation, which was open to both media types and fans at this year's PAX Prime, we were also able to sit down with Final Fantasy XIV producer Naoki Yoshida for a more intimate interview session.

Join us after the cut as we talk about classes, jobs, consoles vs. PCs, and a boatload of other Eorzean tidbits.

Continue reading PAX Prime 2013: FFXIV's Yoshida on rebuilding trust and expanding functionality

MassivelyPAX Prime 2013: FFXIV's Yoshida on rebuilding trust and expanding functionality originally appeared on Massively on Sun, 01 Sep 2013 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>conconsoleconsolesconventioneventevent-coverageeventsexpofantasyfeaturedffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivinterviewmassively-event-coveragenaoki-yoshidapaxpax-2013pax-primepax-prime-2013penny-arcade-exposquaresquare-enixSun, 01 Sep 2013 17:00:00 EST<![CDATA[PAX Prime 2013: Final Fantasy XIV's presentation apologizes for a 'rocky' launch]]>http://massively.joystiq.com/2013/09/01/pax-prime-2013-final-fantasy-xivs-presentation-apologizes-for/http://massively.joystiq.com/2013/09/01/pax-prime-2013-final-fantasy-xivs-presentation-apologizes-for/http://massively.joystiq.com/2013/09/01/pax-prime-2013-final-fantasy-xivs-presentation-apologizes-for/#commentsFiled under: , , , , , , , , ,

PAX 2013 - Yoshida talks Final Fantasy XIV's 21, 22, 23, and more
Final Fantasy XIV had a sizable presence at PAX Prime this year. Massively sat in on Square's presentation and group interview, and we also managed a separate session with producer Naoki Yoshida apart from all the hustle and bustle.

In this recap, we'll walk you through the highlights from the first session, which also featured sound director Masayoshi Soken and localization lead Michael-Christopher Koji Fox, who handled translation duties.

Continue reading PAX Prime 2013: Final Fantasy XIV's presentation apologizes for a 'rocky' launch

MassivelyPAX Prime 2013: Final Fantasy XIV's presentation apologizes for a 'rocky' launch originally appeared on Massively on Sun, 01 Sep 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>conconsoleconsolesconventioneventevent-coverageeventsexpofantasyfeaturedffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivmasayoshi-sokenmassively-event-coveragemichael-christopher-koji-foxnaoki-yoshidapaxpax-2013pax-final-fantasypax-primepax-prime-2013penny-arcade-exposquaresquare-enixSun, 01 Sep 2013 15:00:00 EST<![CDATA[Final Fantasy XIV dev talks new servers and access restrictions]]>http://massively.joystiq.com/2013/08/30/final-fantasy-xiv-dev-talks-new-servers-and-access-restrictions/http://massively.joystiq.com/2013/08/30/final-fantasy-xiv-dev-talks-new-servers-and-access-restrictions/http://massively.joystiq.com/2013/08/30/final-fantasy-xiv-dev-talks-new-servers-and-access-restrictions/#commentsFiled under: , , , , ,

Final Fantasy XIV
It's no secret that the long-awaited re-launch of Final Fantasy XIV hasn't gone very smoothly. In fact, the servers are taking such a beating that Square Enix has temporarily shut down online sales of the game. Despite the game's current woes, the FFIXV team wants fans to know that it is working overtime to get things running smoothly.

In a lengthy forum post, producer and director Naoki Yoshida (aka Yoshi-P) outlined what steps have been taken to stabilize FFXIV's game world. Yoshida noted that all Final Fantasy XIV servers now have login restrictions to prevent a flood of logs and re-logs from causing them to crash. Login restrictions are most likely to be implemented during peak times, which Yoshida says are between 9:00 p.m. and midnight. Each server can support a theoretical maximum of 5,000 concurrent players.

Continue reading Final Fantasy XIV dev talks new servers and access restrictions

MassivelyFinal Fantasy XIV dev talks new servers and access restrictions originally appeared on Massively on Fri, 30 Aug 2013 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>access-restrictionafkcharacter-creationconcurrencyconsoleconsolesCrashfantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivfinal-fantasy-xiv-a-realm-rebornforumslaunch-woesloginlogin-problemnaoki-yoshidaserver-issuesserverssquaresquare-enixyoshi-pFri, 30 Aug 2013 17:30:00 EST<![CDATA[Hear the latest FFXIV news in next Producer's Letter Live]]>http://massively.joystiq.com/2013/07/26/hear-the-latest-ffxiv-news-in-next-producers-letter-live/http://massively.joystiq.com/2013/07/26/hear-the-latest-ffxiv-news-in-next-producers-letter-live/http://massively.joystiq.com/2013/07/26/hear-the-latest-ffxiv-news-in-next-producers-letter-live/#commentsFiled under: , , , , ,

Hear the latest FFXIV news in next Producer's Letter Live
Sometimes words on a page (or screen, obviously) just can't convey the spirit and feeling behind a message. Even all caps or a series of !!1!1 can't adequately express some sentiments -- for that, you need visual cues and tone of voice. Final Fantasy XIV fans will be treated to those when Producer Naoki Yoshida livestreams the next Producer's Letter on August 8th at 8:00 a.m. EDT. The topic: beta and the official release.

Questions for the show can be submitted to the designated thread before airing and via the game's official Twitter account during the stream; just be sure to attach #XIV to all tweeted inquiries. If you miss the stream live -- or don't understand Japanese -- you can still catch the answers to all the questions addressed in both real time on Twitter and a Q&A summary to be posted on the site shortly afterward.

MassivelyHear the latest FFXIV news in next Producer's Letter Live originally appeared on Massively on Fri, 26 Jul 2013 12:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>consoleconsolesfantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivlivestreamNaoki-Yoshidaproducers-letterproducers-letter-livereal-world-eventreal-world-eventssquaresquare-enixFri, 26 Jul 2013 12:30:00 EST<![CDATA[New FFXIV videos continue the tour of Eorzea, demo group finder]]>http://massively.joystiq.com/2013/07/04/new-ffxiv-videos-continue-the-tour-of-eorzea-demo-group-finder/http://massively.joystiq.com/2013/07/04/new-ffxiv-videos-continue-the-tour-of-eorzea-demo-group-finder/http://massively.joystiq.com/2013/07/04/new-ffxiv-videos-continue-the-tour-of-eorzea-demo-group-finder/#commentsFiled under: , , , , , , ,

New FFXIV videos continue the tour of Eorzea, highlight group finder
Back in February, Final Fantasy XIV fans were treated to a whole slew of great stuff, including a video tour -- composed of both PC and PS3 footage -- of A Realm Reborn's refurbished land of Eorzea. Come May, a second part of this series showed off even more. But not even two videos could cover all there is to see, so today's third installment continues the journey, allowing players to to travel through various areas in La Noscea, The Black Shroud, Thanalan, Coerthas, and Mor Dhona.

Square Enix also released its fourth developers' commentary video. In it, Producer Naoki Yoshida and community team member Toshio Murouchi discuss and demonstrate the "Duty Finder," a feature that helps players to find and form balanced dungeon groups even while on different worlds. Once formed, the group will be automatically transported into the instance and then back to each member's original spot once completed.

Before you run off to watch fireworks (if that's your thing), watch both the latest installment of the Eorzea tour and the devs' group-finding demo after the cut.

Continue reading New FFXIV videos continue the tour of Eorzea, demo group finder

MassivelyNew FFXIV videos continue the tour of Eorzea, demo group finder originally appeared on Massively on Thu, 04 Jul 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>a-realm-rebornbetaconsoleconsolesdev-diaryEorzeafantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivfinal-fantasy-xiv-a-realm-rebornNaoki-Yoshidasquaresquare-enixToshio-Murouchitrailertrailersvideovideo-tourvideosThu, 04 Jul 2013 15:00:00 EST<![CDATA[Final Fantasy XIV surpasses one million beta registrations]]>http://massively.joystiq.com/2013/07/02/final-fantasy-xiv-surpasses-1m-beta-registrations/http://massively.joystiq.com/2013/07/02/final-fantasy-xiv-surpasses-1m-beta-registrations/http://massively.joystiq.com/2013/07/02/final-fantasy-xiv-surpasses-1m-beta-registrations/#commentsFiled under: , , ,

Final Fantasy XIV hits 1M beta registrations
Square Enix sure is working hard to rejuvenate Final Fantasy XIV: A Realm Reborn in the eyes of fans. After a promising showing at E3 this year and plenty of revamped content for the upcoming rebirth, Square says that over one million people have registered for the MMO's beta.

The August 27th launch date is right around the corner, and these beta numbers could mean that the desired trust has been regained after the original launch failure in 2010. "In the 25-year history of the Final Fantasy series, there hasn't been a Final Fantasy that has failed. We can't -- we just can't -- let this game end in failure," game director Naoki Yoshida said last year in an interview with Eurogamer.

If you'd like to find out more about the FFXIV beta and our impressions so far, check out Eliot's continuing coverage.

MassivelyFinal Fantasy XIV surpasses one million beta registrations originally appeared on Massively on Tue, 02 Jul 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>consoleconsolesfantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivnaoki-yoshidasquaresquare-enixTue, 02 Jul 2013 10:00:00 EST<![CDATA[The Mog Log: Final Fantasy XIV beta phase (E)3]]>http://massively.joystiq.com/2013/06/15/the-mog-log-final-fantasy-xiv-beta-phase-e-3/http://massively.joystiq.com/2013/06/15/the-mog-log-final-fantasy-xiv-beta-phase-e-3/http://massively.joystiq.com/2013/06/15/the-mog-log-final-fantasy-xiv-beta-phase-e-3/#commentsFiled under: , , , , , , , ,

u see wat i did thar
The third phase of Final Fantasy XIV's beta is here, and with it, the NDA is summarily gone. Images from phase 3 can be posted; video and audio cannot. This is the fast track to finally being back in the game for real, to play your old characters once again, to enjoy the game again.

Am I excited? Of course I am because I haven't been able to play yet. I'm writing this from the past, and by the time you read this, I will be awash in Eorzea.

There was also a major industry event this week, one that's known officially as the Electronic Entertainment Expo and known more colloquially to everyone in the world as E3. Final Fantasy XIV was there making an impression, revealing jobs at long last, and generally carrying on as if it owned the place. So let's talk a little bit about what we saw from E3 if you can tear yourself away from the beta client for, like, five minutes.

Continue reading The Mog Log: Final Fantasy XIV beta phase (E)3

MassivelyThe Mog Log: Final Fantasy XIV beta phase (E)3 originally appeared on Massively on Sat, 15 Jun 2013 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>conconsoleconsolesconventionconvention-coveragee3e3-2013electronic-entertainment-expoevent-coverageexpofantasyfeaturedffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivmassively-event-coveragemog-lognaoki-yoshidaopinionsquaresquare-enixsquenixthe-mog-logSat, 15 Jun 2013 14:00:00 EST<![CDATA[E3 2013: Final Fantasy XIV gets PlayStation 4 berth]]>http://massively.joystiq.com/2013/06/11/e3-2013-final-fantasy-xiv-gets-playstation-4-berth/http://massively.joystiq.com/2013/06/11/e3-2013-final-fantasy-xiv-gets-playstation-4-berth/http://massively.joystiq.com/2013/06/11/e3-2013-final-fantasy-xiv-gets-playstation-4-berth/#commentsFiled under: , , , , , , , ,

Final Fantasy XIV gets PlayStation 4 berth
While we've known for some time that Final Fantasy XIV: A Realm Reborn will be coming out on the PlayStation 3 later this year, we have new confirmation that the title will be making the jump to the console's baby brother. FFXIV was announced as one of PlayStation 4's upcoming games in 2014 at the Sony E3 keynote address, as Sony has the exclusive rights to the title.

While there isn't a set date for the PS4 release, Square-Enix Producer Naoki Yoshida encouraged console fans to start playing on the PS3 and make the switch later, as character data will be transferrable between the versions. "While waiting for PlayStation 4 there is no reason not to start your adventure on the PlayStation 3," he said.

The release of the updated Final Fantasy XIV for the PC and PS3 will happen on August 27th. You can watch the new E3 trailer for FFXIV after the jump.

[Thanks to William for the tip!]

Continue reading E3 2013: Final Fantasy XIV gets PlayStation 4 berth

MassivelyE3 2013: Final Fantasy XIV gets PlayStation 4 berth originally appeared on Massively on Tue, 11 Jun 2013 14:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>conconsoleconsolesconventionconvention-coveragee3e3-2013electronic-entertainment-expoevent-coverageexpofantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivlaunchmassively-event-coveragenaoki-yoshidaplaystationplaystation-4ps4releasesquaresquare-enixtrailervideoTue, 11 Jun 2013 14:30:00 EST<![CDATA[Final Fantasy XIV coming this summer, next beta phase starting in June]]>http://massively.joystiq.com/2013/05/10/final-fantasy-xiv-coming-this-summer-next-beta-phase-starting-i/http://massively.joystiq.com/2013/05/10/final-fantasy-xiv-coming-this-summer-next-beta-phase-starting-i/http://massively.joystiq.com/2013/05/10/final-fantasy-xiv-coming-this-summer-next-beta-phase-starting-i/#commentsFiled under: , , , ,

Final Fantasy XIV coming this summer, next beta phase starting in June
Executive Producer Naoki Yoshida has a couple of significant announcements concerning the testing and release of Final Fantasy XIV: A Realm Reborn. He's excited to announce that the relaunch of the title will be happening in "summer 2013," with a more specific date to be announced by the end of May. He also said that details and pre-orders for the collector's edition will be coming this month as well.

"The whole team has been working at full throttle to ensure the game will be ready for a summer release," Yoshida said. "It won't be long before you can mark your calendars and begin the final countdown!"

Before the launch happens, however, phase 3 of beta testing needs to happen. This will start at the beginning of June, according to Yoshida. Phase 3 is notable in that it will be the first time that the PlayStation 3 version of FFXIV will be included in the beta testing.

MassivelyFinal Fantasy XIV coming this summer, next beta phase starting in June originally appeared on Massively on Fri, 10 May 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>a-realm-rebornbetaconsoleconsolesfantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivlaunchlaunch-dateNaoki-Yoshidaphase-3playstation-3releaserelease-datesquaresquare-enixsummer-2013Fri, 10 May 2013 15:00:00 EST<![CDATA[The Mog Log: Pushing back on Final Fantasy XIV]]>http://massively.joystiq.com/2013/04/20/the-mog-log-pushing-back-on-final-fantasy-xiv/http://massively.joystiq.com/2013/04/20/the-mog-log-pushing-back-on-final-fantasy-xiv/http://massively.joystiq.com/2013/04/20/the-mog-log-pushing-back-on-final-fantasy-xiv/#commentsFiled under: , , , , , ,

Push the tempo up.
Among the things I'm reluctant to talk about early when it comes to Final Fantasy XIV are the live letters from Naoki Yoshida. There's always a thread rapidly updating players on what is said during those letters, but that thread is filled with quick translations that may or may not be accurate, and I'd prefer not to analyze and speculate on information that may have been misconstrued. The man speaks in dense blocks of information.

To my surprise, this week we got the full translation of the latest live letter, and something that struck me was how much of the game we're still being told is just over the horizon. This is not to say that I don't believe in Yoshi-P; Final Fantasy XIV 1.0 showed that if he promises something, it will be delivered. But there are a lot of things being held back for later, and honestly it's a little disconcerting for someone waiting eagerly for the game to come out.

Continue reading The Mog Log: Pushing back on Final Fantasy XIV

MassivelyThe Mog Log: Pushing back on Final Fantasy XIV originally appeared on Massively on Sat, 20 Apr 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>a-realm-rebornconsoleconsolesfantasyfeaturedffff14ffxivffxiv-version-2.0final-fantasyfinal-fantasy-14final-fantasy-xivlive-lettermog-lognaoki-yoshidaopinionrelaunchsquaresquare-enixsquenixthe-mog-logupcoming-featuresupdatesSat, 20 Apr 2013 18:00:00 EST<![CDATA[Checking out the 44th Final Fantasy XIV producer's letter]]>http://massively.joystiq.com/2013/03/20/checking-out-the-44th-final-fantasy-xiv-producers-letter/http://massively.joystiq.com/2013/03/20/checking-out-the-44th-final-fantasy-xiv-producers-letter/http://massively.joystiq.com/2013/03/20/checking-out-the-44th-final-fantasy-xiv-producers-letter/#commentsFiled under: , , , , ,

A Final Fantasy XIV guildhest screenshot
Final Fantasy XIV has been ramping up to A Realm Reborn, the massive reboot that has fans excited and nervous at the same time. In the hopes of whetting fan appetites even further, Naoki Yoshida is letting players know just what's cooking via a new producer's letter. It turns out that gamepad users have reason to be excited for phase two beta testing.

It might be standing room only, though, as 100,000 testers have joined up so far. It's caused some issues on the servers but a weekend of tweaks to FATE-related performance issues might help loosen things up a bit. That is until phase two kicks in and even more testers are welcomed. After all, how else can you stress test a server? Phase two testing should begin in early April, so grab your controller and jump in if you can.

There's also news about phase three testing! Guildhests, which are based on behests from version 1.0, will welcome groups of players even from early levels. They are supposed to be a great way to party with friends before going out and tackling the big stuff.

MassivelyChecking out the 44th Final Fantasy XIV producer's letter originally appeared on Massively on Wed, 20 Mar 2013 11:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>a-realm-rebornconsoleconsolesff14ff14-betaffxivFinal-Fantasyfinal-fantasy-14final-fantasy-xivnaoki-yoshidaproducers-lettersquareSquare-EnixtestingWed, 20 Mar 2013 11:30:00 EST<![CDATA[Massively Exclusive: A dinner with Final Fantasy XIV's Naoki Yoshida]]>http://massively.joystiq.com/2013/02/21/massively-exclusive-a-dinner-with-final-fantasy-xivs-naoki-yos/http://massively.joystiq.com/2013/02/21/massively-exclusive-a-dinner-with-final-fantasy-xivs-naoki-yos/http://massively.joystiq.com/2013/02/21/massively-exclusive-a-dinner-with-final-fantasy-xivs-naoki-yos/#commentsFiled under: , , , , , , , , ,

I would not be surprised if Yoshida actually had hunted a giant snake with a bow and arrow. It seems plausible.
Having a conversation with Naoki Yoshida can be a very intimidating exercise. It's not because of his demeanor; he's friendly, genial, and has an obvious sense of humor. No, it's because there's an unmistakable level of energy to him, a huge amount of passion and ambition that drives everything he talks about.

He's exactly the sort of person who would try something completely insane like remaking a game from the ground up after burning the first version to the ground, for example.

I had the opportunity to sit down for a one-on-one dinner with Yoshida at the Final Fantasy XIV preview event, during which we talked a great deal both about the upcoming relaunch of the game as well as his own experiences in remaking everything. For those of us who play Final Fantasy XIV, it's obviously an exciting time, but for Yoshida, what's happening now is the culmination of work that started only a month after he took over control of a game that he had to revitalize after a horrible flop on launch.

Continue reading Massively Exclusive: A dinner with Final Fantasy XIV's Naoki Yoshida

MassivelyMassively Exclusive: A dinner with Final Fantasy XIV's Naoki Yoshida originally appeared on Massively on Thu, 21 Feb 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>a-realm-rebornburn-it-all-downconsoleconsolesdevelopment-retrospectivedirectorend-of-an-erafantasyfeaturedffff14ffxivffxiv-version-2.0final-fantasyfinal-fantasy-14final-fantasy-xivgame-developmentinterviewinterviewsmajor-changesnaoki-yoshidapersons-of-interestproducersquaresquare-enixThu, 21 Feb 2013 09:00:00 EST<![CDATA[43rd FFXIV producer's letter announces A Realm Reborn's first beta phase]]>http://massively.joystiq.com/2013/02/15/43rd-ffxiv-producers-letter-announces-a-realm-reborns-first-be/http://massively.joystiq.com/2013/02/15/43rd-ffxiv-producers-letter-announces-a-realm-reborns-first-be/http://massively.joystiq.com/2013/02/15/43rd-ffxiv-producers-letter-announces-a-realm-reborns-first-be/#commentsFiled under: , , , , ,

43rd FFXIV producer's letter announces A Realm Reborn's first beta phase
Final Fantasy XIV fans who have been eagerly awaiting beta for A Realm Reborn only have a little longer to wait. In the 43rd producer's letter Naoki Yoshida announced that phase one of the beta will begin on February 25th -- barring any cataclysmic bugs, of course!

Yoshida admitted that the testing is actually one week later than the roadmap originally indicated. He informed fans that the extra time allows for more system features and character options to be included in this test, such as the random public quest-type Full Active Time Events (FATE). He also noted that while phase one focuses on the areas around Gridania, a level 30 dungeon will be ready for testing. Players can also look forward to the new guildhest (previously behest) system.

Beta invitations for this phase are already on their way, but folks can still apply on the official site.

[Thanks to everyone who tipped us!]

Massively43rd FFXIV producer's letter announces A Realm Reborn's first beta phase originally appeared on Massively on Fri, 15 Feb 2013 10:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>a-realm-rebornbetabeta-testbeta-testingconsoleconsolesfantasyFATEffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivFull-Active-Time-Eventsnaoki-yoshidasquaresquare-enixFri, 15 Feb 2013 10:30:00 EST<![CDATA[Fifth live FFXIV producer letter to air next week]]>http://massively.joystiq.com/2013/02/12/fifth-live-ffxiv-producer-letter-to-air-next-week/http://massively.joystiq.com/2013/02/12/fifth-live-ffxiv-producer-letter-to-air-next-week/http://massively.joystiq.com/2013/02/12/fifth-live-ffxiv-producer-letter-to-air-next-week/#commentsFiled under: , , , , , , ,

Fifth live FFXIV producer letter to air next week
If you are fluent in Japanese and happen to be awake early on February 22nd, you can watch Naoki Yoshida answer fans' questions about Final Fantasy XIV in the the fifth live letter from the producer. The broadcast begins at 6:00 a.m. EST. For those who can't tune in (or who don't know the language), all questions and answers will be posted as they are addressed on the official Twitter account, and a full summary will also be posted on the forums afterward.

Folks who want to ask Yoshida questions about the game's beta and official release can submit them either ahead of time on the official thread or during the livestream via Twitter using #XIVLive.

MassivelyFifth live FFXIV producer letter to air next week originally appeared on Massively on Tue, 12 Feb 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>community-q-and-aconsoleconsolesfantasyffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivlive-producers-letternaoki-yoshidaproducer-letterproducers-letterQ-and-Asquaresquare-enixTue, 12 Feb 2013 11:00:00 EST