Massively http://massively.joystiq.com Massively http://www.blogsmithmedia.com/http://massively.joystiq.com/media/feedlogo.gif Massively http://massively.joystiq.com en-us Copyright 2012 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[The Game Archaeologist: When dead MMOs come back to life]]>http://massively.joystiq.com/2012/05/01/the-game-archaeologist-when-dead-mmos-come-back-to-life/http://massively.joystiq.com/2012/05/01/the-game-archaeologist-when-dead-mmos-come-back-to-life/http://massively.joystiq.com/2012/05/01/the-game-archaeologist-when-dead-mmos-come-back-to-life/#commentsFiled under: , , , , , , , , , , , ,

Hellgate Tokyo
Maybe I'm alone in this, but my jaw just dropped when I came home this past week to see that Massively posted the news that Shadowbane is coming back to life. Granted, it's only going to happen in China, but still, that's pretty incredible. Shadowbane's been in the ground for three years now, and if I had to pick an MMO that deserved resurrection, this particular one would be farthest from my mind (no offense if you liked the game; it's just that there are so many others that are even more worthy).

But how can this not give you hope? Many of us have lost an MMO we loved or at least had a decked-out character populating the character select screen, and the thought of that game coming back against all odds is a goosebump-rising one. It may also smack of justice served, as some MMOs fail not because of faulty gameplay but because of mismanagement by the studio, complex legal wrangling, or bad marketing.

Today let's look at a few examples of dead MMOs that were brought back to life and what this may mean for the future of the industry. Zombie MMOs! Not, you know, MMOs with zombies.

Continue reading The Game Archaeologist: When dead MMOs come back to life

MassivelyThe Game Archaeologist: When dead MMOs come back to life originally appeared on Massively on Tue, 01 May 2012 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>all-points-bulletinall-points-bulletin-reloadedapbapb-reloadedapbrchangyouclassicclassic-mmoclassic-mmosclassicsclone-wars-adventurescrimediablodiablo-clonef2pfallen-earthfantasyfaxion-onlinefeaturedflagshipfree-realmsfree-to-playfrogsterg1galaxiesgame-archaelogistgamersfirsthanbitsofthellgatehellgate-globalhellgate-londonhellgate-tokyojohn-smedleylego-universemythosmythos-europemythos-globalnostalgiaopinionPirates-of-the-Burning-Seapvprebootredbanaresurrectionrevivalsandboxsci-fishadowbanesoesony-online-entertainmentstar-warsstar-wars-galaxiesswgswgot3t3funtabula-rasathe-game-archaeologistthe-matrix-onlinevanguardzombie-mmozombiesTue, 01 May 2012 15:00:00 EST<![CDATA[Ex-MMO devs aim to fund space combat game via Kickstarter]]>http://massively.joystiq.com/2012/04/19/ex-mmo-devs-attempt-to-fund-space-combat-game-via-kickstarter/http://massively.joystiq.com/2012/04/19/ex-mmo-devs-attempt-to-fund-space-combat-game-via-kickstarter/http://massively.joystiq.com/2012/04/19/ex-mmo-devs-attempt-to-fund-space-combat-game-via-kickstarter/#commentsFiled under: , ,

Squad Wars
They were part of the force behind many MMOs you've known and loved, including Jumpgate, Auto Assault, LEGO Universe, RIFT, and League of Legends, and now they're banding together for a new cause funded by crowdsourcing. They're the developers at END Games, and they hope to raise a quarter of a million dollars to create a multiplayer space combat game.

Despite the team's legacy, however, this new title will not be an MMO. Titled Squad Wars, the proposed project will blossom into a frantic starfighter game that will pit squads of players against each other in the deadly vacuum of space. Instead of focusing on a persistent world, Squad Wars will offer packaged scenarios that will "ensure the most fun every time you login."

END Games is also notable in that two of its members were founders of NetDevil: Scott Brown and Ryan Seabury. As of the time of this writing, END Games has $1,430 toward its goal, which must be attained by May 19th for the project to proceed.

MassivelyEx-MMO devs aim to fund space combat game via Kickstarter originally appeared on Massively on Thu, 19 Apr 2012 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>auto-assaultcrowdsourcingend-gamesjumpgatejumpgate-evolutionkickstarterleague-of-legendslego-universenetdevilnew-gamenew-titleriftRyan-Seaburysci-fiscifiScott-Brownspace-combatsquad-warsThu, 19 Apr 2012 16:00:00 EST<![CDATA[Pack up your toys: LEGO Universe is shutting down at midnight]]>http://massively.joystiq.com/2012/01/30/pack-up-your-toys-lego-universe-shutting-down-at-midnight/http://massively.joystiq.com/2012/01/30/pack-up-your-toys-lego-universe-shutting-down-at-midnight/http://massively.joystiq.com/2012/01/30/pack-up-your-toys-lego-universe-shutting-down-at-midnight/#commentsFiled under: , , , , ,

LEGO Universe
The clock is chiming, and kids (and the young at heart) everywhere are asking for just a little more time with LEGO Universe. Unfortunately the struggling MMO has gotten no reprieve from the imaginary video game governor, and its servers will go offline tonight at midnight EST.

The shutdown FAQ encourages LEGO Universe players to share their favorite memories on the forums and ends with a heartfelt message from the team:
"Our decision to end LEGO Universe is similar to decisions we also make with LEGO Product collection, where favourite sets come and go to make space for new sets. It was time for LEGO Universe to end and hopefully new digital LEGO experiences will come in the future."
We first heard of LEGO Universe's closure last November, when the studio announced that the game's freemium model was not bringing in enough paying customers to keep the title afloat. LEGO Universe is a youngling in the MMO genre, having released in October 2010, making the game one year and three months old at the time of its shutdown.

Refunds for those who had a paid subscription on file after December 31st, 2011 will be distributed early next month. Unused LEGO game cards may also be exchanged for LEGO e-gift cards.

MassivelyPack up your toys: LEGO Universe is shutting down at midnight originally appeared on Massively on Mon, 30 Jan 2012 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>closeclosingclosuref2pfree-to-playfreemiumlegolego-grouplego-universeshutdownMon, 30 Jan 2012 13:00:00 EST<![CDATA[MMO Family: LEGO Universe, autism, and heartbreak]]>http://massively.joystiq.com/2011/12/28/mmo-family-lego-universe-autism-and-heartbreak/http://massively.joystiq.com/2011/12/28/mmo-family-lego-universe-autism-and-heartbreak/http://massively.joystiq.com/2011/12/28/mmo-family-lego-universe-autism-and-heartbreak/#commentsFiled under: , , , , , , , , ,

Lego Universe
Often when the topic of video games comes up, it's followed by comments about the negatives, such as violence, antisocial behavior, or inappropriate content. But if they do have harmful effects (and it's arguable how many players really are affected in a negative way), they can also be helpful as well, yet you rarely hear a news story about the good. I've written before about how companies like IBM have studied MMO guilds in order to improve team-building and organization within their company. More recently, MMOWGLI focused on global issues, such as the future of piracy, to study what solutions players could cooperatively generate.

There are also positive benefits to children as well, and while we've touched on a few in recent columns, this week we'll focus on the impact LEGO Universe has had on autistic children. Sadly, the game will be shutting down in a few weeks, and while many parents are thankful for how much it's helped, they're also concerned about what will happen once the game is gone. Read on for a bittersweet look at how this LEGO-based game is leaving behind a legacy.

Continue reading MMO Family: LEGO Universe, autism, and heartbreak

MassivelyMMO Family: LEGO Universe, autism, and heartbreak originally appeared on Massively on Wed, 28 Dec 2011 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>aspergersautismcasualchildrenchildrens-mmosf2pfamilyfamily-friendlyfeaturedfree-to-playkaren-bryankid-friendlykidskids-gameslegolego+gameslego+universelego+universe+game+autismlego-universelegogameslegouniverselegouniversegameautismmmo-closingmmo-familymmo-kidsmmo-shut-downopinionstar-wars-galaxiessunsettabula-rasaWed, 28 Dec 2011 14:00:00 EST<![CDATA[Free-to-play spending poised to become the majority in the US]]>http://massively.joystiq.com/2011/11/09/free-to-play-spending-poised-to-become-the-majority-in-the-us/http://massively.joystiq.com/2011/11/09/free-to-play-spending-poised-to-become-the-majority-in-the-us/http://massively.joystiq.com/2011/11/09/free-to-play-spending-poised-to-become-the-majority-in-the-us/#commentsFiled under: , ,

City of Heroes
Free-to-play is on the rise -- we all knew that, but perhaps we didn't quite grasp how much it's gone up. Gamasutra reports that online players have boosted their F2P spending a whopping 24% this year over last, with F2P revenues cornering 47% -- versus 39% in 2010 -- of the MMO market in the US.

Analysts predict that we're on track to see $1.2 billion spent on free-to-play MMOs in 2011. This surge of F2P spending isn't just confined to North America, however. Europe, Asia, and other emerging countries already see a majority of MMO spending dedicated to F2P versus other business models.

The report states that US players spend 26 million hours daily in MMOs. Your average US player is 84% likely to be enjoying browser-based titles and 50% likely to be invested in a client-based game.

NewZoo CEO Peter Warman thinks 2012 will be a decisive year for F2P in more ways than one: "Recent lay-offs and the sudden death of LEGO Universe are serious warnings for the MMO games industry. Success will also strongly depend on how MMO companies extend their unique gameplay and IP across other game platforms, specifically mobile."

MassivelyFree-to-play spending poised to become the majority in the US originally appeared on Massively on Wed, 09 Nov 2011 11:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>business-modelbusiness-modelsf2pfree-to-playgamasutralego-universenewzoonorth-americaPeter-WarmanrevenuespendingusWed, 09 Nov 2011 11:30:00 EST<![CDATA[LEGO Universe shutting down January 2012]]>http://massively.joystiq.com/2011/11/04/lego-universe-shutting-down-january-2012/http://massively.joystiq.com/2011/11/04/lego-universe-shutting-down-january-2012/http://massively.joystiq.com/2011/11/04/lego-universe-shutting-down-january-2012/#commentsFiled under: , , , , ,

LEGO Universe
Playtime's over, people -- time to pack up your LEGO bricks and move on. The word's come down from the LEGO Group that LEGO Universe is closing its doors on January 31st, 2012 due to a lack of paying customers. While the game has been free-to-play for a while, apparently not enough players were interested in dishing out cash to keep the MMO operational.

The news was posted just moments ago on the official forums along with a more in-depth FAQ:
Hello Adventurer, today we are very sad to announce that LEGO Universe will be closing on January 31, 2012. This was a very difficult decision to make, but unfortunately LEGO Universe has not been able to attract the number of members needed to keep the game open.

We are thankful to have had the opportunity to share this adventure wiith an amazing community of players. We hope you will continue to enjoy LEGO Universe for the last few months. As a thank you, if you are a paying subscriber on December 31, 2011, we will provide you the full game for the final month for free.

Again, we want to thank the fantastic community of players who made LEGO Universe such a vibrant, fun and creative experience.

Sincerely,
The LEGO Universe Team
Unfortunately, this closure means that the associated studios, including one in Colorado and one in Denmark, will be shuttered and 115 employees will be affected. LEGO Universe launched in October 2010 and converted to a free-to-play model this past August. We've included the official press release behind the break.

Continue reading LEGO Universe shutting down January 2012

MassivelyLEGO Universe shutting down January 2012 originally appeared on Massively on Fri, 04 Nov 2011 14:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>closingclosing-downclosuref2pfree-to-playlegolego-grouplego-universeplay-well-studiosshutting-downsunsetsunsettingFri, 04 Nov 2011 14:30:00 EST<![CDATA[LEGO Universe offers $15,000 US in prizes in the Nexus Force Championships]]>http://massively.joystiq.com/2011/10/13/lego-universe-offers-15-000-us-in-prizes-in-the-nexus-force-cha/http://massively.joystiq.com/2011/10/13/lego-universe-offers-15-000-us-in-prizes-in-the-nexus-force-cha/http://massively.joystiq.com/2011/10/13/lego-universe-offers-15-000-us-in-prizes-in-the-nexus-force-cha/#commentsFiled under: , , , ,

LEGO Universe title image
Given the age of the average MMO gamer, it's safe to say most of us grew up with the amazing creative freedom of LEGO. The LEGO franchise has given rise to countless computer games over the years, including kid-friendly MMORPG LEGO Universe. The game recently went free-to-play, and now a huge contest has been released to encourage people to give the game a try.

The eight-week-long Nexus Force Championships start today, challenging players to win as many in-game events and contests as possible before December 8th. Participants will collect points for winning contests and events in a bid to win some truly massive prizes. The single player with the highest number of points at the end of the eight weeks will win around $5,000 US worth of LEGO sets and a new laptop. In total, over $15,000 US of prizes will be given out during the event.

[Source: LEGO Universe Press Release]

MassivelyLEGO Universe offers $15,000 US in prizes in the Nexus Force Championships originally appeared on Massively on Thu, 13 Oct 2011 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>contestcontestseventeventslegolego-universenewsnexus-force-championshipsprizesThu, 13 Oct 2011 20:00:00 EST<![CDATA[LEGO Universe introduces Ninjago expansion]]>http://massively.joystiq.com/2011/09/20/lego-universe-introduces-ninjago-expansion/http://massively.joystiq.com/2011/09/20/lego-universe-introduces-ninjago-expansion/http://massively.joystiq.com/2011/09/20/lego-universe-introduces-ninjago-expansion/#commentsFiled under: , , , , , ,

Red Ninja on lava
Who doesn't like ninjas? Well, except for pirates, I guess. Now LEGO Universe has both, as its newly announced Ninjago expansion brings the world of the Ninjago LEGO toys and the Masters of Spinjitzu film to the MMO.

In addition to inserting over 100 new ninja-themed missions, this "largest expansion to the game yet" will raise the level cap to 45 and introduce new weapons, new enemies, and new gear -- all just in time for next month's first-year anniversary for the game. The expansion is free for all premium members starting today, and you can check out the screenshot gallery below and launch trailer just after the jump.

Gallery: LEGO Universe Main Gallery



[Source: LEGO Universe press release]

Continue reading LEGO Universe introduces Ninjago expansion

MassivelyLEGO Universe introduces Ninjago expansion originally appeared on Massively on Tue, 20 Sep 2011 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>expansionf2pfree-to-playlegolego-bricks-not-legoslego-universelevel-cap-increasemasters-of-spinjitzuninjaninjagoninjaspatchtrailertrailersupdatevideovideoswarner-brothersTue, 20 Sep 2011 10:00:00 EST<![CDATA[Rise and Shiny recap: LEGO Universe]]>http://massively.joystiq.com/2011/08/28/rise-and-shiny-recap-lego-universe/http://massively.joystiq.com/2011/08/28/rise-and-shiny-recap-lego-universe/http://massively.joystiq.com/2011/08/28/rise-and-shiny-recap-lego-universe/#commentsFiled under: , , , , , , , , ,

LEGO screenshot
Ah, LEGO. Who in this world was unfortunate enough to grow up without the wonderful plastic bits of imagination? I remember specific types of LEGO, from the hinged legs of the minifigs to the more advanced gears and pistons of the Technic sets. We used to build great long space battleships, similar to the ones you might see in Star Blazers, and we would run down the hall at each other, smashing them into hundreds of wonderful hard plastic pieces. LEGO built my childhood and was as important to me as destroying wasp's nests and building forts. Of course, girls moved to the top of the list pretty soon after that.

So when I heard about LEGO Universe, I was as excited as any normal person would be. I imagined building anything possible, sort of like a child-friendly Second Life, and spending hours in gleeful, plastic bliss. What I found during the beta greatly disappointed me.

Flash forward to now, and I have to say that my opinion has changed quite a bit. Let me tell you what I found, OK? Click past the cut... but leave the massive battleships behind for now.

Continue reading Rise and Shiny recap: LEGO Universe

MassivelyRise and Shiny recap: LEGO Universe originally appeared on Massively on Sun, 28 Aug 2011 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>beau-hindmanf2pfeaturedfree-to-playftpLEGOLEGO-UniverseLiveStreamnetdevilrise-and-shinytoysvideovideosSun, 28 Aug 2011 14:00:00 EST<![CDATA[MV Guide: August 22-28, 2011]]>http://massively.joystiq.com/2011/08/22/mv-guide-august-22-28-2011/http://massively.joystiq.com/2011/08/22/mv-guide-august-22-28-2011/http://massively.joystiq.com/2011/08/22/mv-guide-august-22-28-2011/#commentsFiled under: , , ,

MV Guide, Hellgate
MV Guide is a weekly rundown of the MMO gaming events planned on Massively's Livestream channel.

Every week, the Massively staff logs in to play various MMOs live and in person, and we'd love for you to drop by the channel and visit. We have a combination of regular weekly games and new surprises, so you'll find a variety of titles to take a look at. During livestream events, you can participate in the live chat, ask questions to learn about the game, and simply spend some time with Massively staff and readers. (Of course, livestream events are subject to the whims of outside forces like server-side gremlins once in a while.)

Follow along after the jump to see what's scheduled for this week!

Continue reading MV Guide: August 22-28, 2011

MassivelyMV Guide: August 22-28, 2011 originally appeared on Massively on Mon, 22 Aug 2011 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>champions-onlinechoose-my-adventurefusion-fallguild-warshellgatelego-universelivestreammv-guidemv-tvpoptropicapuzzle-piratesrunescapeMon, 22 Aug 2011 09:00:00 EST<![CDATA[Rise and Shiny recap: Nadirim]]>http://massively.joystiq.com/2011/08/21/rise-and-shiny-recap-nadirim/http://massively.joystiq.com/2011/08/21/rise-and-shiny-recap-nadirim/http://massively.joystiq.com/2011/08/21/rise-and-shiny-recap-nadirim/#commentsFiled under: , , , , , , , ,

Nadirim cutscene
Ah, the desert. Great sand dunes, long shadows, and the sun burning hot all day. It's no place for the weak of heart. Designing an entire game that takes place in that setting isn't easy, either. Sure, many MMOs feature a desert zone or area and might feature a desert people whom we can choose to play. Generally, though, MMOs are lush and full of green. Perhaps gamers just prefer elves, forests, and wet weather effects?

Nadirim has pulled players into a great expanse of desert and asked them to find adventure. I have to admit that desert area in games like Vanguard: Saga of Heroes are usually not my favorite, but I can understand their appeal. The desert is one of the last alien landscapes in our lives. Most of us have trees around us or a local swimming pool or at the least a green lawn to trim. Then we imagine an area devoid of anything leafy and it feels surreal.

Luckily, Nadirim does a good job in many areas, so it was a pleasure to step into the sand. Click past the cut and I'll tell you more.

Continue reading Rise and Shiny recap: Nadirim

MassivelyRise and Shiny recap: Nadirim originally appeared on Massively on Sun, 21 Aug 2011 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>beau-hindmanbrowserbrowser-baseddesertfeaturedLEGO-UniverseLiveStreamingnadirimrise-and-shinyTurn-basedtwisted-tribevideoSun, 21 Aug 2011 14:00:00 EST<![CDATA[The MMO Report: What is this I don't even edition]]>http://massively.joystiq.com/2011/08/19/the-mmo-report-what-is-this-i-dont-even-edition/http://massively.joystiq.com/2011/08/19/the-mmo-report-what-is-this-i-dont-even-edition/http://massively.joystiq.com/2011/08/19/the-mmo-report-what-is-this-i-dont-even-edition/#commentsFiled under: , , , , , , ,

Screencap -- The MMO Report
Welcome once again to Massively's coverage of The MMO report, where we get to imagine that this entire article is read by a 1930s radio announcer.

The first order of business today is the record-breaking scam perpetrated in EVE Online, followed by the energy and weapon ability changes in the most recent test build of Guild Wars 2. Then we've got The Old Republic's first show of endgame content in the form of the Eternity Vault being showcased at Gamescom. Meanwhile, The Secret World announces a release date, slating the game for April 2012 with beta signups beginning on August 26th. LEGO Universe's transition to a free-to-play model rounds out the selections before a trip into Uncle Casey's Mailbag for some schmemes and other goodness.

So jump on past the cut and check it out. Oh, and don't ask about the beginning. We don't know either.

Continue reading The MMO Report: What is this I don't even edition

MassivelyThe MMO Report: What is this I don't even edition originally appeared on Massively on Fri, 19 Aug 2011 10:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>eveeve-onlinegamescomgamescom-2011guild-wars-2gw2lego-universemmo-reportscamstar-wars-the-old-republicthe-mmo-reportthe-old-republicthe-secret-worldtortswvideovideosFri, 19 Aug 2011 10:30:00 EST<![CDATA[LEGO Universe goes F2P today]]>http://massively.joystiq.com/2011/08/15/lego-universe-goes-f2p-today/http://massively.joystiq.com/2011/08/15/lego-universe-goes-f2p-today/http://massively.joystiq.com/2011/08/15/lego-universe-goes-f2p-today/#commentsFiled under: , , , , , , , , , ,

LEGO Universe - F2P
Free-to-play conversions have been in the news a lot lately, with games as diverse as Age of Conan and Champions Online throwing open their doors with various flavors of free access. LEGO Universe is the latest freemium convert, and today is the official kickoff for the brick-building MMORPG's new membership tier.

So what can you do for free in LEGO Universe?

Two adventure zones and one player property area are available for starters, and the game also offers up a decent selection of free mini-games, build options, and basic functionality (including the ability to sample faction gear and collect up to 10,000 coins). The LEGO Group is clearly looking to entice gamers to upgrade to a full membership, though, as it only costs $10 a month and it unlocks the full game including over 15 adventuring zones, access to upcoming expansion content, and the ability to join in competitions and community events. Head to the official LEGO Universe website for a full listing of free-to-play offerings and subscriber benefits. You can also click past the cut to see a new free-to-play trailer featuring gameplay and world-building highlights.

Continue reading LEGO Universe goes F2P today

MassivelyLEGO Universe goes F2P today originally appeared on Massively on Mon, 15 Aug 2011 11:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>brick-buildingbricksbuildingbusiness-modelsf2pfamilyfree-to-playkidsLEGOlego-grouplego-universelego-universe-mmolegospress-releasesandboxsubscriber-benefitsthe-lego-grouptrailervideoMon, 15 Aug 2011 11:30:00 EST<![CDATA[LEGO Universe update adds progression system]]>http://massively.joystiq.com/2011/08/08/lego-universe-update-adds-progression-system/http://massively.joystiq.com/2011/08/08/lego-universe-update-adds-progression-system/http://massively.joystiq.com/2011/08/08/lego-universe-update-adds-progression-system/#commentsFiled under: , , , , , , ,

LEGO Universe has the creative aspects of MMOs and online gaming down pat. After all, we're talking LEGOs (edit: LEGO BRICKS OMG, LEGO BRICKS) here, and if there's one word that's synonymous with the long-running Danish toy line, that word is build.

What's there to do in LEGO Universe when your creativity runs dry, though? Thanks to the game's latest content update, traditional MMO character-building is now a viable option. Player minifigures may progress through 40 levels of content, unlocking points, achievements, and equipment along the way.

That's not all, as the latest LEGO Universe patch also features four new faction kits (Specialized Adventurer, Shinobi, Inventor, and Space Ranger), each of them aligned with one of the game's four Nexus Force factions and each offering players the opportunity to rank up and explore "new gear, powers, and abilities." Last but not least, the new LEGO Universe update brings a new instance challenge in the form of the Avant Gardens, and a big nasty known as the Spider Queen awaits players who are creative enough to make it through to the final battle.

MassivelyLEGO Universe update adds progression system originally appeared on Massively on Mon, 08 Aug 2011 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>avant-gardensbuildingcreativityequipmentf2pfamilyfree-to-playgame-updategeargrindinventorkidslegolego-universelegoslevel-upleveling-systemlevelsminifigure-levelspatchpress-releaseprogressionshinobispace-rangerspecialized-adventurerspider-queenMon, 08 Aug 2011 12:00:00 EST<![CDATA[Ex-NetDevil programmer talks LEGO Universe and getting an industry job]]>http://massively.joystiq.com/2011/07/25/ex-netdevil-programmer-talks-lego-universe-and-getting-an-indust/http://massively.joystiq.com/2011/07/25/ex-netdevil-programmer-talks-lego-universe-and-getting-an-indust/http://massively.joystiq.com/2011/07/25/ex-netdevil-programmer-talks-lego-universe-and-getting-an-indust/#commentsFiled under: , , ,

Fan site MMO Fallout has an interesting interview with Stephen Calender that's worth a read. Who's Stephen Calender? He's a Flash developer who was front and center for the brouhaha that went down when The LEGO Group acquired the LEGO Universe MMO from NetDevil (putting many NetDevil programmers out of work in the process).

The interview is a wide-ranging and lengthy affair, and it features discussion on Gazillion's relationship with NetDevil, a blurb about the ill-fated Auto Assault, and of course, the bulk of the piece that focuses on the past and future of LEGO Universe. For all of the aspiring game devs in the audience, Calender also spends quite a bit of time talking about selling yourself in an increasingly competitive industry.

MassivelyEx-NetDevil programmer talks LEGO Universe and getting an industry job originally appeared on Massively on Mon, 25 Jul 2011 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dev-interviewsf2pfamilyfree-to-playgazillioninterviewkidslegolego-grouplego-universemmo-industrynetdevilprogrammingstephen-calenderthe-lego-groupMon, 25 Jul 2011 10:00:00 EST<![CDATA[LEGO Universe dares you to make a 'Brickbuster']]>http://massively.joystiq.com/2011/07/21/lego-universe-dares-you-to-make-a-brickbuster/http://massively.joystiq.com/2011/07/21/lego-universe-dares-you-to-make-a-brickbuster/http://massively.joystiq.com/2011/07/21/lego-universe-dares-you-to-make-a-brickbuster/#commentsFiled under: , , , , ,

Have an itching desire to be an amateur filmmaker, but all you have to work with is a video camera and your toys? No problem -- LEGO Universe and The Ones and Zeros Pixelshow think that's all you need to become the next hit director!

From now until August 5th, you can film and submit your very own LEGO "Brickbuster" in the Build-a-Brickbuster Animated Film Contest. The best of the best stop-motion machinima will be awarded prizes, showcased at Pixelfest in Broomfield, Colorado on August 13th and 14th, and included in a special DVD later this year.

Pixelfest Producer Dylan Krider sees this as a perfect cross-over between the MMO and real world: "When players aren't busy battling to save imagination in LEGO Universe, they can bring their wildest creations to life with virtual building and behavior tools that make it simple for anyone to make their own machinima creations."

MassivelyLEGO Universe dares you to make a 'Brickbuster' originally appeared on Massively on Thu, 21 Jul 2011 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>brickbusterbuild-a-brickbustercontestdvddylan-kriderlegolego-universemachinimapixelfestprizesstop-motionthe-ones-and-zeroes-pixelshowThu, 21 Jul 2011 10:00:00 EST<![CDATA[LEGO Universe going freemium this August]]>http://massively.joystiq.com/2011/06/21/lego-universe-going-freemium-this-august/http://massively.joystiq.com/2011/06/21/lego-universe-going-freemium-this-august/http://massively.joystiq.com/2011/06/21/lego-universe-going-freemium-this-august/#commentsFiled under: , , , , , , ,

Fallen Earth? Check. City of Heroes? Check. Which AAA MMORPG act is warming up to take the stage next on the free-to-play 2011 world tour? That would be LEGO Universe, and the LEGO Group has announced via press release that the kid-friendly building-block title will be joining its formerly subscription-based brethren in the freemium ranks as early as this August.

Interestingly, LEGO Universe will continue to make its money via paid memberships, with no microtransactions planned at this time. Free players will have access to a limited selection of game content for an unlimited period of time. If the trial content tickles their fancy, tire-kickers are then free to pony up $10 per month for full access.

LEGO Universe is also doing away with its physical media, as new users will find that the game is transitioning to a download-only model for both paid and free players. Full details on the content available to free players isn't yet available, but check back with us frequently as we bring you all the latest updates.

MassivelyLEGO Universe going freemium this August originally appeared on Massively on Tue, 21 Jun 2011 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>business-modelsdigital-downloadsf2pfree-to-playfreemiumlegolego-grouplego-universemmo-industrysubscriptionstrialTue, 21 Jun 2011 11:00:00 EST<![CDATA[Choose My Adventure: Should have played it by now edition]]>http://massively.joystiq.com/2011/06/15/choose-my-adventure-should-have-played-it-by-now-edition/http://massively.joystiq.com/2011/06/15/choose-my-adventure-should-have-played-it-by-now-edition/http://massively.joystiq.com/2011/06/15/choose-my-adventure-should-have-played-it-by-now-edition/#commentsFiled under: , , ,

I admit it: I stick with my games for a long time. When I step into an MMO, I make it home for a while, and it takes a lot of effort for me to move along. That's part of the reason the games I'm actively playing are generally on the older side -- I've already got a history there. Unfortunately, it also means that there are a lot of games, new and old, that I just haven't had the time to play just yet. So to kick off my tenure on Choose My Adventure, I'm going to kick that straight to the curb with a poll I'd like to call the Should Have Played It By Now Edition.

But which game I'll spend the next several weeks playing isn't up to me; that task lies in your hands, folks. So what's it going to be? Should I stop being the only person in the world who hasn't played RIFT? Will I dive into the free-to-play domain of Runes of Magic? Should I break my usual conventions and take a shot at Global Agenda or get some solid aggression out of my system with Warhammer Online? All of these are games I've only had a little playtime with at best, and in most cases, I haven't even touched them. So click on past the break and let me know what I'll be playing, and I'll see you back here in a week to find out more about my next destination. (But make sure to vote by 11:59 p.m. EDT on June 19th!)

Continue reading Choose My Adventure: Should have played it by now edition

MassivelyChoose My Adventure: Should have played it by now edition originally appeared on Massively on Wed, 15 Jun 2011 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>allodsallods-onlinechampions-onlinechoose-my-adventurecmacoeq2eqiieverquest-2everquest-iifeaturedfrfree-realmsgaglobal-agendalego-universelupollpollsriftrift-planes-of-telararomrunes-of-magics2sotnwsword-2sword-of-the-new-worldwarwarhammer-onlineWed, 15 Jun 2011 15:00:00 EST<![CDATA[Former LEGO Universe dev: 'I have decided to get out of the MMO game']]>http://massively.joystiq.com/2011/05/24/former-lego-universe-dev-i-have-decided-to-get-out-of-the-mmo-game/http://massively.joystiq.com/2011/05/24/former-lego-universe-dev-i-have-decided-to-get-out-of-the-mmo-game/http://massively.joystiq.com/2011/05/24/former-lego-universe-dev-i-have-decided-to-get-out-of-the-mmo-game/#commentsFiled under: , , , ,

We're all familiar with that guy who gets burned out on his game and makes a very public and lengthy rant as to why he's quitting on the official forums. But what happens when a developer does the same thing to a larger audience? Today we found out, as former LEGO Universe dev Ryan Seabury wrote an open letter saying why he left NetDevil -- and why he'll never work on MMOs again.

Seabury cites four reasons: that the "MMO" label has lost its meaning, it takes too long and is too stressful to develop new games, it's difficult to play around with creative concepts, and the market is trending toward indie titles anyway. He left to start up END Games Entertainment so that he and others of a similar mind could indulge in "a ridiculous variety of game ideas" instead of treading the waters of the status quo.

His letter is largely upbeat as he focuses on the joys of game development and play, and he thinks that it's high past time studios break out of old mindsets to embrace the new: "We have come to a point where the game concept trumps such insignificant bullet points, and global social connectivity is a given. From a creative standpoint, this is fantastic. Ideas are king once again; the industry feels as vibrant to me as the golden nostalgia years I experienced as a kid growing up through the coin-op and early console eras, except we've finally ditched the nerd-in-basement stigma."

You can read Seabury's full letter over at Kotaku.

MassivelyFormer LEGO Universe dev: 'I have decided to get out of the MMO game' originally appeared on Massively on Tue, 24 May 2011 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>end-gamesend-games-entertainmentindiekotakulegolego-grouplego-universenetdevilopen-letterryan-seaburyTue, 24 May 2011 13:00:00 EST<![CDATA[LEGO Universe opens the Nexus Tower]]>http://massively.joystiq.com/2011/05/23/lego-universe-opens-the-nexus-tower/http://massively.joystiq.com/2011/05/23/lego-universe-opens-the-nexus-tower/http://massively.joystiq.com/2011/05/23/lego-universe-opens-the-nexus-tower/#commentsFiled under: , , , , ,

It's always nice to finish a big construction project of LEGO bricks, even if you're just making something out of spare bricks on your desktop instead of working. It's the same for LEGO Universe, but in a somewhat more substantive fashion -- the Nexus Tower, a massive structure composed of a huge number of bricks, has finally been completed in-game. Thanks to players donating bricks and working toward the tower's completion, everyone can start enjoying the features of this large-scale hub as well as several content updates due to accompany it.

Players who explore the tower will find over 50 new missions to undertake as well as several faction leaders to work alongside as they learn more about the history of the game's multiversal setting. There are also new items, new pets, new daily missions, and a promise of more content to come down the pipeline following this. LEGO Universe players can check out all of the new stuff in-game now, but if you can't log in right at the moment, take a look at the trailer just after the break.

Continue reading LEGO Universe opens the Nexus Tower

MassivelyLEGO Universe opens the Nexus Tower originally appeared on Massively on Mon, 23 May 2011 20:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>legolego-universelumajor-patchesmajor-updatesnetdevilnexus-towerpatchesupdatesMon, 23 May 2011 20:30:00 EST<![CDATA[LEGO Universe unveils May contest schedule]]>http://massively.joystiq.com/2011/05/03/lego-universe-unveils-may-contest-schedule/http://massively.joystiq.com/2011/05/03/lego-universe-unveils-may-contest-schedule/http://massively.joystiq.com/2011/05/03/lego-universe-unveils-may-contest-schedule/#commentsFiled under: , , , , , ,

May in LEGO Universe is all about faction pride, and as such, players are invited to participate in a host of exciting contests to demonstrate their factions' superiority. Well, that and win prizes. You can have your blocky cake and eat it in LEGO Universe!

The site has posted its May contest schedule for your edification:
  • All month: Join the community effort is underway to build the Nexus Tower via donations.
  • May 7-8: Race in the LEGO Grand Prix, which will take place at a soon-to-be revealed location.
  • May 14-15: Take aim and fire during the Shooting Gallery Showdown, where players will try to hit enemy ships and creatures in the water.
  • May 21-22: Submit your best faction screenshot for a shot at several prizes.
  • May 28-29: Unite with your faction in the Battle for Nimbus Station!
Take a gander at the contest details and the many, many goodies you can win over at LEGO Universe.

MassivelyLEGO Universe unveils May contest schedule originally appeared on Massively on Tue, 03 May 2011 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>battle-for-nimbus-stationcontestcontestsfactionfaction-pridegrand-prixlegolego-grand-prixlego-grouplego-universenexus-towerprizespromotionsraceshooting-galleryTue, 03 May 2011 12:00:00 EST<![CDATA[LEGO Universe readying new race track, pets, property, and a month-long event]]>http://massively.joystiq.com/2011/04/26/lego-universe-readying-new-race-track-pets-property-and-a-mon/http://massively.joystiq.com/2011/04/26/lego-universe-readying-new-race-track-pets-property-and-a-mon/http://massively.joystiq.com/2011/04/26/lego-universe-readying-new-race-track-pets-property-and-a-mon/#commentsFiled under: , , , , , , ,

Next week is looming large for fans of LEGO Universe. May 3rd will see major new challenges made available to the game's community according to a LEGO press release circulated earlier this afternoon.

First up is a month-long initiative to finish the colossal Nexus Tower construction project. The tower houses the Nexus of Imagination, and it's a good thing too since the dastardly Maelstrom is bent on unyielding destruction. Players will need to contribute bricks to the Nexus Force cause or risk leaving Imagination vulnerable to the forces of darkness.

LEGO Universe will also be sporting a new race track as of next week, and the circuit is every bit as grueling as its name (Dragonmaw Chasm) suggests. New achievements are the order of the day, and skilled racers can unlock new cars including the Fire Brawl and Mach Lava. Finally, the new game update is bringing new property options to LEGO Universe. These include the ability for players to place pets on their in-game homesteads and bring said pets to life via a system of behaviors. Head to the official LEGO Universe website for more.

Gallery: LEGO Universe Main Gallery

MassivelyLEGO Universe readying new race track, pets, property, and a month-long event originally appeared on Massively on Tue, 26 Apr 2011 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>buildingdragonmarkdragonmaw-chasmfamilygallerykidslegolego-universemaelstromnexus-of-imaginationnexus-towernexus-tower-projectpatchespetspropertyrace-carsrace-trackscreenshotsupdatesTue, 26 Apr 2011 20:00:00 EST<![CDATA[Choose My Adventure: Into the cave I go!]]>http://massively.joystiq.com/2011/04/13/choose-my-adventure-into-the-cave-i-go/http://massively.joystiq.com/2011/04/13/choose-my-adventure-into-the-cave-i-go/http://massively.joystiq.com/2011/04/13/choose-my-adventure-into-the-cave-i-go/#commentsFiled under: , , , ,

Hello Massively Readers, and thank you MJ for passing the torch! It's been an enjoyable ride following her in her Xyson adventures, and I hope I can do the same for whatever game is chosen.

And that brings me to the list -- what would you like to see me play? I made sure to include some of the bridesmaids from previous polls, as well as a few that were mentioned and not listed.

So what's it going to be, Massively readers? Will Pirates of the Burning Sea finally get its comeuppance, or will I sport a jet pack and buzz around in Global Agenda? Are you curious about whether MYST Online has the same frustratingly difficult but gorgeous puzzles as the original, or would you prefer that I return to my roots and spend some time on the EverQuest progression server? And, of course, there's my long-lost uncle whom I never got to know -- EverQuest II Extended. Maybe you'd prefer to see an EQII vet head to free-to-play land.

Whatever the game, I'm looking forward to your help choosing my path, and if you are also playing, I hope to get to know some of you during my adventures. Make sure to get your votes in by 11:59 p.m. EDT on Sunday, April 17th!

Continue reading Choose My Adventure: Into the cave I go!

MassivelyChoose My Adventure: Into the cave I go! originally appeared on Massively on Wed, 13 Apr 2011 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>choose-my-adventurecmaDCUOeq2xeve-onlineeverquest-2-extendedeverquest-progressionfeaturedfree-realmsglobal-agendaLEGO-Universemyst-onlinePirates-of-the-Burning-Seaworld-of-tanksWed, 13 Apr 2011 15:00:00 EST<![CDATA[Massively's April Fools' Day [adjective] roundup]]>http://massively.joystiq.com/2011/04/01/massivelys-april-fools-day-adjective-roundup/http://massively.joystiq.com/2011/04/01/massivelys-april-fools-day-adjective-roundup/http://massively.joystiq.com/2011/04/01/massivelys-april-fools-day-adjective-roundup/#commentsFiled under: , ,

The favorite day of the year for anyone named April has [verb ending in ed] the internet, making some web surfers [emotion] and others [emotion]. In [adjective] Massively fashion, we felt it best to gather all this news [adverb]. After all, what would an event be without a [adjective] Massively roundup?

World of Warcraft [past tense verb] not just one internet prank but four for the [plural noun] of BattleNet. Turbine invited its [plural noun] to be the broccoli for [adjective] race in Dungeons and Dragons Online. The [plural title] of Star Wars: The Old Republic did not want to leave the Wookiee [plural noun] from playing their [adjective] game, so they created a Shyriiwook interface for all those [adjective] people. However, the prank that takes the [food] has to be ArenaNet's new Guild Wars 2 class, the Commando; Anet created [adjective] videos complete with jiggle physics and placed helicopters into the current Guild Wars game.

After the cut, we have [past tense verb] all the [adjective] pranks in this year's batch of favorite MMOs. Now you won't have to [verb] around the internet to find them yourself! But if you do [verb] something not on our list, let us know in the comments.

Continue reading Massively's April Fools' Day [adjective] roundup

MassivelyMassively's April Fools' Day [adjective] roundup originally appeared on Massively on Fri, 01 Apr 2011 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>april-foolsapril-fools-2011arenanetCCPdark-age-of-camelotDDOdungeons-and-dragons-onlineEAEVEeve-onlinefeaturedfirefallforsaken-worldfuncomgazillion-entertainmentglobal-agendaguild-warsGuild-Wars-2hi-rez-studiosholidayholidaysincarnaLEGO-Universemad-libmad-libsmad-libs-april-fools-day-2011Mythic-Entertainmentperfect-world-entertainmentpocket-legendspuzzle-piratesred-5-studiosround-uprounduproundupssecret-worldSOESonySony-Online-Entertainmentstar-wars-galaxiesthe-secret-worldTurbine-Entertainmentwizard-101Fri, 01 Apr 2011 15:30:00 EST<![CDATA[LEGO Universe on sale for $9.99]]>http://massively.joystiq.com/2011/03/31/lego-universe-on-sale-for-9-99/http://massively.joystiq.com/2011/03/31/lego-universe-on-sale-for-9-99/http://massively.joystiq.com/2011/03/31/lego-universe-on-sale-for-9-99/#commentsFiled under: , , , ,

Have you seen the prices for LEGO brick,s these days? Some parents have had to choose between purchasing their child a Harry Potter Hogwarts set or paying the mortgage that month -- and Harry Potter usually wins. Fortunately, you can get your virtual LEGOs on for cheap: LEGO Universe is on sale for $9.99 in the official LEGO store.

You'll want to note that this is a physical copy of the game, not a digital download. The purchase also includes the first month of play, which certainly lowers the barrier of entry. This promotion is a limited time offer, although the company didn't put an exact end date on it.

This follows LEGO Universe's transition from Gazillion to the LEGO Group. Newcomers to the game will certainly want to check out the cooperative community events that highlight this MMO's unique strengths.

MassivelyLEGO Universe on sale for $9.99 originally appeared on Massively on Thu, 31 Mar 2011 11:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dealgazillionharry-potterhogwartslegolego-grouplego-universepromotionsaleThu, 31 Mar 2011 11:30:00 EST<![CDATA[LEGO Universe builds community via community building]]>http://massively.joystiq.com/2011/03/24/lego-universe-builds-community-via-community-building/http://massively.joystiq.com/2011/03/24/lego-universe-builds-community-via-community-building/http://massively.joystiq.com/2011/03/24/lego-universe-builds-community-via-community-building/#commentsFiled under: , , , ,

The fun of playing with LEGO sets is only half in the assembly -- a lot of the enjoyment comes with showing off what you've created to others, no matter your age. It's an element that LEGO Universe has taken to heart, as a recent release talks about the community events the game has run thus far and the plans for more events in the future.

Each month of the game's operation has been based around a core theme for community events and challenges, giving players unified goals to work toward. March is the Battle Month, with the final event taking place this weekend in the Battle for Nimbus Station. Players who successfully face off against 29 waves of enemies will be in the running to win a variety of in-game prizes as well as some real-world LEGO sets.

The Creation Lab has also been a major area of development, allowing user-generated content to come front and center in the community. Even if you're not currently playing LEGO Universe, you can take part in some of the contests and get your own buildings in the game -- sharing what you've built with everyone even if it's not made out of plastic bricks.

MassivelyLEGO Universe builds community via community building originally appeared on Massively on Thu, 24 Mar 2011 21:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>buildingcommunity-contestscommunity-eventscontestscreationinnovationkid-gameskidslegolego-brickslego-universelunetdeviloriginal-creationugcuser-generated-contentThu, 24 Mar 2011 21:00:00 EST<![CDATA[Gazillion press release clarifies Netdevil layoff rumors]]>http://massively.joystiq.com/2011/02/24/gazillion-press-release-clarifies-netdevil-layoff-rumors/http://massively.joystiq.com/2011/02/24/gazillion-press-release-clarifies-netdevil-layoff-rumors/http://massively.joystiq.com/2011/02/24/gazillion-press-release-clarifies-netdevil-layoff-rumors/#commentsFiled under: , , , , , , ,

The NetDevil/LEGO Universe brouhaha that unfolded earlier this morning is officially official thanks to a press release just published by Gazillion Entertainment. Gazillion has formally agreed to sell its development stake in the LEGO Universe MMO to the LEGO Group (the game's publisher and custodian of the world-famous toy brand).

Most of the LEGO devs, formerly employed by NetDevil (a Gazillion subsidiary), have received employment offers from the LEGO Group and will continue iterating on the game from the company's Louisville, Colorado studio.

Gazillion is re-focusing its ongoing development efforts into browser games, according to President and COO David Brevik. "The transition of members of our team to the LEGO Group enables us to focus completely on internally-published, free-to-play game businesses," he said.

MassivelyGazillion press release clarifies Netdevil layoff rumors originally appeared on Massively on Thu, 24 Feb 2011 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>acquisitionsbreakingbrowser-baseddavid-brevikf2pfree-to-playgazilliongazillion-entertainmentlegolego-grouplego-universemmo-industrynetdevilpress-releaseThu, 24 Feb 2011 15:30:00 EST<![CDATA[NetDevil lays off large portion of its staff [Updated]]]>http://massively.joystiq.com/2011/02/24/netdevil-lays-off-large-portion-of-its-staff/http://massively.joystiq.com/2011/02/24/netdevil-lays-off-large-portion-of-its-staff/http://massively.joystiq.com/2011/02/24/netdevil-lays-off-large-portion-of-its-staff/#commentsFiled under: , , , , , , ,

When it comes to game development, it's somewhat common to see a layoff or realignment of development team members shortly after the release of a title. However, it appears that NetDevil's most recent round of layoffs came as a complete surprise to its employees. After all, the company's most recent release, LEGO Universe, is well past that initial post-launch phase, having gone live back in October 2010, and both Jumpgate Evolution and Fortune Online are (at least supposedly) under development currently at the studio. There are jobs posted on the hiring page, as well.

However, it appears that the developer, owned by Gazillion Entertainment, is on shaky ground as of this morning, according to rumors. The truly horrible thing about this isn't that some developers were laid off -- it's how the affected employees found out. It appears that some of the NetDevil employees were notified that they were going to be laid off via Facebook postings before they were officially contacted by the company, according to a blog posting by Toby Cochran, who worked as a character/creature animator on LEGO Universe. Apparently an image showing a tombstone with the inscription "NetDevil R.I.P. Oct 1997-Feb 2011" started making the rounds on social networking sites shortly thereafter, indicating a far bleaker picture than just that of layoffs.

We've reached out to NetDevil and Gazillion Entertainment for comment on the rumors and what, if anything, it will mean for the development of Jumpgate Evolution and Fortune Online. We'll be sure to update this post as soon as we have further information. In the meantime, we hope that all the talented, hard-working NetDevil employees who were affected are able to land fabulous new well-paying spots elsewhere, continuing to do what they love.

[Update: We received the following statement from NetDevil: "The transition of members of our team to the LEGO Group allows us to conclude the work-for-hire segment of NetDevil's business and lets us expand our internally-published, free-to-play game businesses based on our own properties and licensed properties. Gazillion is wholly focused on developing, operating, and publishing the next generation of browser-delivered games," said David Brevik, President and COO. "We're proud of the LEGO Universe game that our team built, and we are certain that it has a bright future."]

MassivelyNetDevil lays off large portion of its staff [Updated] originally appeared on Massively on Thu, 24 Feb 2011 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>businessemployeesfacebookFOfortune-onlinegazilliongazillion-entertainmentJGEjumpgate-evolutionlayoffslego-universeLUmmo-industrynet-devilNetDevilrumorsocial-networkingtoby-cochranThu, 24 Feb 2011 10:00:00 EST<![CDATA[LEGO Universe invites players to battle for Nimbus Station]]>http://massively.joystiq.com/2011/02/18/lego-universe-invites-players-to-battle-for-nimbus-station/http://massively.joystiq.com/2011/02/18/lego-universe-invites-players-to-battle-for-nimbus-station/http://massively.joystiq.com/2011/02/18/lego-universe-invites-players-to-battle-for-nimbus-station/#commentsFiled under: , , , , , ,

Grab three of your buddies, gear up, and get ready to travel through time to save the LEGO Universe (or at least, Nimbus Station). Starting on February 23rd, NetDevil and the LEGO Group are inviting groups of four players to journey backwards to battle the evil Maelstrom in a thrilling confrontation to decide Nimbus Station's fate.

You'll need to find Wenn Wuzzit, a Venture League time traveler who has taken up residence in the present-day Nimbus Station. His time-twister contraption serves as your personal way-back machine and as a gateway to epic battles vs. 30 waves of enemies and bosses.

In addition to the Nimbus Station shenanigans, LEGO Universe is releasing new build missions and achievements tied to players' Property Worlds. Four new dailies and 12 new achievements are on tap, with rewards that include faction tokens, Mega Brick booster packs, and new Doom Star and Behavior Model sets. Sound exciting? Check out all the details via the new trailer after the cut.

Continue reading LEGO Universe invites players to battle for Nimbus Station

MassivelyLEGO Universe invites players to battle for Nimbus Station originally appeared on Massively on Fri, 18 Feb 2011 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>FamilyKidsLegoLego-groupLego-universeMaelstromNetdevilNew-achievementsNew-daily-questsNimbusNimbus-stationTime-machineTime-travelTrailerVideoFri, 18 Feb 2011 11:00:00 EST<![CDATA[The MMO Report: The sad, strange death of Company of Heroes Online]]>http://massively.joystiq.com/2011/02/14/the-mmo-report-the-sad-strange-death-of-company-of-heroes-onli/http://massively.joystiq.com/2011/02/14/the-mmo-report-the-sad-strange-death-of-company-of-heroes-onli/http://massively.joystiq.com/2011/02/14/the-mmo-report-the-sad-strange-death-of-company-of-heroes-onli/#commentsFiled under: , , , , , , , ,

Bad puns, sexual innuendo and all the MMO news you can handle are crammed into yet another MMO Report, brought to us by our friends at G4TV. Casey Schreiner and his fabulous tie recall a few of the biggest stories from the previous week.

First up on the docket is the cancellation of two THQ titles previously in development: Company of Heroes Online and WWE Smackdown vs. Raw Online. Both of these games were an attempt by the studio to bring its western-style MMOs to a Korean market, although THQ ultimately decided that this move wasn't at the top of its priority list.

On a more upbeat note, Casey talks up LEGO Universe's Crux Prime update, which came complete with ninjas and multiplayer madness. And yes, Casey, we agree that LEGOs are "awesome."

Other topics for the Report include Undead Labs' "Class 3" single-player XBLA title that's hopefully leading up to the studio's zombie MMO, robo-Batman in a new DCUO video, the announcement of BlizzCon's 2011 dates, and a Blizzard theme park called "Joy Land" in China. Face it: We have a weird hobby.

Hit the jump to watch the full MMO Report!

Continue reading The MMO Report: The sad, strange death of Company of Heroes Online

MassivelyThe MMO Report: The sad, strange death of Company of Heroes Online originally appeared on Massively on Mon, 14 Feb 2011 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>batmanblizzardblizzconcasey-schreinercinematicclass-3Company-of-Heroescompany-of-heroes-onlineconventioncrux-primedc-universe-onlinedcuog4g4tvjoy-landlegolego-universelegosmmo-reportrobo-batmanthe-mmo-reportthqundead-labswwe-onlineWWE-SmackDown-vs-RAWxblaMon, 14 Feb 2011 12:00:00 EST<![CDATA[LEGO Universe releases Crux Prime update]]>http://massively.joystiq.com/2011/02/08/lego-universe-releases-crux-prime/http://massively.joystiq.com/2011/02/08/lego-universe-releases-crux-prime/http://massively.joystiq.com/2011/02/08/lego-universe-releases-crux-prime/#commentsFiled under: , , , , , ,

Pirates or ninjas? That is the age-old question. As of today we know where the LEGO Universe team stands thanks to the new Crux Prime update. LEGO's Ninjago line is the star of NetDevil's latest content patch, and players can participate in a new storyline that involves the search for Sensei Wu. It seems the reclusive Wu is a master of Spinjitzu, the only skill that can stand up to the hordes of skeleton enemies descending on Crux Prime.

The patch contains a substantial amount of new content including over 100 missions and achievements, over 100 new pieces of gear, and four rare armor sets to collect.

Finally, the Crux Prime update brings multiplayer team functionality to the fight against The Maelstrom, and groups of up to four friends can join forces to save the Nexus Tower and do battle to protect the Imagination Nexus. Get a glimpse of the new Crux Prime trailer after the cut.

Continue reading LEGO Universe releases Crux Prime update

MassivelyLEGO Universe releases Crux Prime update originally appeared on Massively on Tue, 08 Feb 2011 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>crux-primefamilygazillionkidslegolego-universemaelstromnet-devilnew-contentnew-questsnew-zoneninjaninjassensei-wuskeletonspinjitsutrailervideoTue, 08 Feb 2011 10:00:00 EST<![CDATA[LEGO Universe unveils newest zone for flipping out and killing people]]>http://massively.joystiq.com/2011/01/11/lego-universe-unveils-newest-zone-for-flipping-out-and-killing-p/http://massively.joystiq.com/2011/01/11/lego-universe-unveils-newest-zone-for-flipping-out-and-killing-p/http://massively.joystiq.com/2011/01/11/lego-universe-unveils-newest-zone-for-flipping-out-and-killing-p/#commentsFiled under: , , , , , , , ,

The LEGO brand is nothing if not a universe of heterogeneity -- race cars, aquatic explorers, space police, and even Batman have long existed side-by-side. The newest kid on the metaphorical block is the just-begun Ninjago line, and it's being celebrated in LEGO Universe with the addition of the newest zone, Crux Prime. But the zone has more to offer than just a cavalcade of ninja, with brand-new gear, weapons, and decals for players to unlock as they progress through the zone's new content.

Players will be tasked with finding the long-lost Sensei Wu amid the ruins of the Ninjago Monastery to learn the powerful skill known as Spinjitzu. They'll need it, too, with Maelstrom Skeletons attempting to steal the beacon of Imagination from the tower in Crux Prime. With over 100 new missions for players to undertake and an ongoing story that promises to unfold over time, LEGO Universe players should find plenty to like about Crux Prime. Take a sneak peek at the zone in the gallery below as well as the trailer past the cut.

Gallery: LEGO Universe Crux Prime gallery

Continue reading LEGO Universe unveils newest zone for flipping out and killing people

MassivelyLEGO Universe unveils newest zone for flipping out and killing people originally appeared on Massively on Tue, 11 Jan 2011 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>crux-primegalleriesgallerygazillionlegolego-brickslego-universenetdevilnew-contentnew-gearnew-missionsnew-questsnew-zoneninjaninjaspreviewscreenshotstrailervideovideoszoneTue, 11 Jan 2011 19:00:00 EST<![CDATA[LEGO Universe hosting a race contest for the New Year weekend]]>http://massively.joystiq.com/2011/01/01/lego-universe-hosting-a-race-contest-for-the-new-year-weekend/http://massively.joystiq.com/2011/01/01/lego-universe-hosting-a-race-contest-for-the-new-year-weekend/http://massively.joystiq.com/2011/01/01/lego-universe-hosting-a-race-contest-for-the-new-year-weekend/#commentsFiled under: , , , , , ,

If you or your favorite youngster has been enjoying LEGO Universe, this weekend would be an especially good time to play, not only because it's a holiday weekend with plenty of free time for everyone, but because a special contest is being held in the game up through January 2nd. Twenty winners on the Space Blizzard Race Track will start the new year with prizes in-game, and the luckiest three winners will be driving away with an entire prize pack of LEGO World Racers sets.

To qualify, players must complete all three races on the track before the end of Sunday, January 2nd. The time at which the contest ends varies by the local time of each server. The setters of the top 20 times will be rewarded with prizes, with a full giftset going to the top 10 racers over the two-day period. LEGO Universe players still have enough time to get onto the track and get to racing, so go ahead and see what you can accomplish.

MassivelyLEGO Universe hosting a race contest for the New Year weekend originally appeared on Massively on Sat, 01 Jan 2011 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>contestfamily-gamesgazillionkidslegolego-brickslego-prizeslego-setslego-universenetdevilnewsraceracersracingSat, 01 Jan 2011 19:00:00 EST<![CDATA[LEGO Universe content keeps building toward the future]]>http://massively.joystiq.com/2010/12/20/lego-universe-content-keeps-building-toward-the-future/http://massively.joystiq.com/2010/12/20/lego-universe-content-keeps-building-toward-the-future/http://massively.joystiq.com/2010/12/20/lego-universe-content-keeps-building-toward-the-future/#commentsFiled under: , , , , , ,

With nothing stopping players save for what their imagination can come up with, the worlds of LEGO Universe have been exploding with content since launch. As a matter of fact, in the last month the moderation team has approved over 86,000 different player-created spaces that offer tons of unique and interesting LEGO Universe content so it can be shared with other players in the game. Add to that Netdevil's push for new content including the Frostfell holiday area, as well as special LEGO World Builder League zones, and there's quite a bit of new content in the game since launch.

According to information from the LEGO Group and Netdevil, the plans for 2011 are even more ambitious. Future content updates will offer LEGO Unvierse players the chance to interact with the LEGO factional leaders and further help push the maelstrom forces back -- unlocking new worlds and storylines in the process. The other interesting thing of note is the plan to add an all-new LEGO IP into LEGO Universe in 2011. In the meantime, check out the new screenshots and video offering a look at some of the myriad creations players are already enjoying in-game.

Gallery: LEGO Universe Main Gallery

Continue reading LEGO Universe content keeps building toward the future

MassivelyLEGO Universe content keeps building toward the future originally appeared on Massively on Mon, 20 Dec 2010 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>gazilliongazillion-entertainmentlegolego-companylego-groupLEGO-Universenetdevilnew-areanew-contentnew-creationsscreenshotscreenshotsuser-created-contentuser-generated-contentvideoMon, 20 Dec 2010 20:00:00 EST<![CDATA[Frostburgh holiday comet headed for LEGO Universe]]>http://massively.joystiq.com/2010/11/23/frostburgh-holiday-comet-headed-for-lego-universe/http://massively.joystiq.com/2010/11/23/frostburgh-holiday-comet-headed-for-lego-universe/http://massively.joystiq.com/2010/11/23/frostburgh-holiday-comet-headed-for-lego-universe/#commentsFiled under: , , , , , ,

In the mood for a snowy throwdown? Netdevil and Gazilion have just the thing for you LEGO Universe players -- an entirely new wintry wonderland named Frostburgh! The new area is actually situated on an icy comet that will open up on November 30th, offering players a whole new area to explore in honor of LEGO Universe's winter holiday, Frostivus. In fact, there will be a festive new mission every day for the entire month that Frostburgh will be orbiting near Nimbus Station, as well as all new holiday NPCs to meet with.

Aside from the new holiday quests, players will additionally have the chance to get into snowball fights, build gingerbread houses, open presents, pick up fun wintry stuff for their minifigs, and tame new reindeer pets. Additionally, the Vertigo Loop racetrack is in for a snowy storm of its own: Icy road conditions and evil snowmen are on the forecast, which will create new challenges for racers. For those who manage to make it through the hazardous road conditions, new achievements and special Frostivus cars await!

As a preview of the chilly LEGO Universe fun that kicks offt next week, we've gathered up a handful of screenshots in the gallery below, or you can check out the Frostburgh trailer after the break!

Gallery: LEGO Universe Main Gallery

Continue reading Frostburgh holiday comet headed for LEGO Universe

MassivelyFrostburgh holiday comet headed for LEGO Universe originally appeared on Massively on Tue, 23 Nov 2010 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>frostburghfrostivusgallerygazilliongazillion-entertainmentholiday-2010LEGOLEGO-Universelego-universe-mmonetdevilscreenshotstrailervideoTue, 23 Nov 2010 11:00:00 EST<![CDATA[The Daily Grind: Should trailers use only in-game footage?]]>http://massively.joystiq.com/2010/11/21/the-daily-grind-should-trailers-use-only-in-game-footage/http://massively.joystiq.com/2010/11/21/the-daily-grind-should-trailers-use-only-in-game-footage/http://massively.joystiq.com/2010/11/21/the-daily-grind-should-trailers-use-only-in-game-footage/#commentsFiled under: , , ,

The purpose of a game trailer is undoubtedly to showcase the game and generate some excitement for it. Many companies opt to release trailers using in-game footage, making a big selling point of their game's graphics. This strategy has been used to successfully promote games from World of Warcraft to TERA. With a trailer containing actual game footage, players can get a good impression of what the game will look like before giving it a try. On the other end of the spectrum, some companies choose to create vivid cinematics to showcase the game's story and get fans excited. These tend to show some key point in the game's lore, which fans of that IP are likely to respond well to. We've seen some pretty epic cinematics for World of Warcraft's Cataclysm expansion, DC Universe Online's in-depth story, Lego Universe's unique gameplay ideas and Star Wars: The Old Republic's epic backstory.

With the latest few EVE Online trailers, there has been a strange merging of those two ideas. EVE's trailers were once filmed using only in-game footage, but over the past several expansions, CCP has begun moving into a more cinematic style. The trailers still depict the in-game environment but are rendered in an external scene-composition suite using higher resolution versions of all the models and textures in-game. The latest trailer for EVE's upcoming Incursion expansion certainly looks good and tells the story of what's to come, but is it missing something fundamental by using out-of-game graphics?

Where do you stand on this issue? Should game trailers use only in-game footage or do you find well-done cinematics more enticing? And is there a middle ground where the two can meet?
Every morning, the Massively bloggers probe the minds of their readers with deep, thought-provoking questions about that most serious of topics: massively online gaming. We crave your opinions, so grab your caffeinated beverage of choice and chime in on today's Daily Grind!

MassivelyThe Daily Grind: Should trailers use only in-game footage? originally appeared on Massively on Sun, 21 Nov 2010 08:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>cataclysmccpccp-eveccp-gamescinematicseveeve-ccpeve-mmorpgeve-onlineexpansiongraphicsincursionlegoLEGO-Universeteratera-onlinethe-daily-grindtrailerWorld-of-WarcraftwowSun, 21 Nov 2010 08:00:00 EST<![CDATA[LEGO Universe publishes new World Build League zones]]>http://massively.joystiq.com/2010/11/15/lego-universe-publishes-new-world-build-league-zones/http://massively.joystiq.com/2010/11/15/lego-universe-publishes-new-world-build-league-zones/http://massively.joystiq.com/2010/11/15/lego-universe-publishes-new-world-build-league-zones/#commentsFiled under: , , , ,


LEGO Universe hasn't been out that long (it launched on October 26th to be exact), but NetDevil and the LEGO Group are already expanding the family-friendly MMO with three new zones developed by the World Build League. The WBL, formerly known as LEGO Universe Partners, is a group of LEGO fans from around the world who have partnered with NetDevil to create professional-quality player content. To access the new content, travel to Starbase 3001, jump on the launch pad, and select the new area of your choice. DeepFreeze, MoonBase, and Portabello await.

As you might expect, DeepFreeze is a winter-themed zone where you can build a snowman or ride a Zamboni. MoonBase is designed to delight your inner sci-fi geek, as the low gravity atmosphere lets you high-jump to your heart's content while you're keeping a wary eye out for alien encounters. Portabello brings a fantasy feel to the game complete with dragon quest-givers and other genre staples.

Check out the video after the break, and hit up the official website for more details.

Continue reading LEGO Universe publishes new World Build League zones

MassivelyLEGO Universe publishes new World Build League zones originally appeared on Massively on Mon, 15 Nov 2010 15:30:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>DeepFreezedragon-brothersgazilliongazillion-entertainmentLEGOLEGO-UniverseLegosMoonBasenetdevilnew-contentnew-zonesplayer-contentplayer-generated-contentPortabelloquestsworld-build-leagueMon, 15 Nov 2010 15:30:00 EST<![CDATA[MMO Family: A parent's look at LEGO Universe]]>http://massively.joystiq.com/2010/11/02/mmo-family-a-parents-look-at-lego-universe/http://massively.joystiq.com/2010/11/02/mmo-family-a-parents-look-at-lego-universe/http://massively.joystiq.com/2010/11/02/mmo-family-a-parents-look-at-lego-universe/#commentsFiled under: , , , ,

MMO Family is your resource for leveling a gaming-specced family, from tips on balancing gaming with family life to finding age-appropriate online games for everyone in the family.

Most kids who play video games have at least seen one from the LEGO franchise. There are a ton of them -- enough, in fact, for a whole page listing them. They're fun games; I'll bet you've played at least one of them, at least in bits and pieces in a demo somewhere. After all, who doesn't love LEGOs?

Still, there was a decided "ho-hum" reaction among my team of young playtesters when I announced we were going to test the ropes of the brand new LEGO Universe MMO. Oh sure, they were willing enough, but it seemed there was always something shinier and more appealing to play on any given day than the game about good ol' LEGOs.

Until they played LEGO Universe -- and had a (brick-)smashing good time.

Gallery: First Impressions: LEGO Universe

Continue reading MMO Family: A parent's look at LEGO Universe

MassivelyMMO Family: A parent's look at LEGO Universe originally appeared on Massively on Tue, 02 Nov 2010 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>childrenfamilyfamily-gamingfeaturedkid-friendlykidslegolego-universelegosmmo-familynet-devilnetdevilparental-controlsparentsparents-guideparents-guide-to-kids-and-family-gamingryan-seaburysubscriptionwarner-brothers-interactiveTue, 02 Nov 2010 16:00:00 EST<![CDATA[GameStop throws its hat into the digital distribution ring]]>http://massively.joystiq.com/2010/11/01/gamestop-throws-its-hat-into-the-digital-distribution-ring/http://massively.joystiq.com/2010/11/01/gamestop-throws-its-hat-into-the-digital-distribution-ring/http://massively.joystiq.com/2010/11/01/gamestop-throws-its-hat-into-the-digital-distribution-ring/#commentsFiled under: , , , ,

As brick-and-mortar stores are struggling in this day and age, digital distribution has been taking off into the stratosphere. Seeing where the winds of change are blowing, GameStop has announced that it is joining the ranks of Steam, Amazon and Direct2Drive by offering a digital distribution service through its website.

If players are comfortable sacrificing a physical box copy in exchange for the speed and convenience of a digital product, GameStop's service will allow them to purchase and download games, trials, expansions and various add-ons in the comfort of their own home. Players will be allowed to install the game on one to three PCs, depending on the product. Unfortunately, because the service is being handled by a third party, GameStop gift cards and certificates are not accepted as payment.

GameStop's downloads page features a number of MMOs for purchase, including Need for Speed World, LEGO Universe, Aion and Age of Conan. If you haven't given Final Fantasy XI a whirl, the Ultimate Collection is on sale for $9.99 in both boxed and digital form.

MassivelyGameStop throws its hat into the digital distribution ring originally appeared on Massively on Mon, 01 Nov 2010 11:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>age-of-conanaionall-the-fun-of-gamestop-without-the-smell-of-the-clerksamazondigital-distributiondirect2drivedownloadfinal-fantasy-xifinal-fantasy-xi-ultimate-collectiongamestopgamestop-digitalgamestop-digital-distributionlego-universeneed-for-speed-worldsteamultimate-collectionMon, 01 Nov 2010 11:00:00 EST<![CDATA[LEGO Universe launch day roundup]]>http://massively.joystiq.com/2010/10/26/lego-universe-launch-day-roundup/http://massively.joystiq.com/2010/10/26/lego-universe-launch-day-roundup/http://massively.joystiq.com/2010/10/26/lego-universe-launch-day-roundup/#commentsFiled under: , ,

Many of us at Massively have been looking forward to the launch of LEGO Universe, and we're pretty sure a lot of you have too. Most of us never really outgrow LEGO bricks, so translating them into an MMO format seems like a recipe for fun.

The months leading up to today's launch have been full of opportunities to check out the game -- we took multiple trips into the world of LEGO Universe to check out different areas and report on what we found. In between were interviews, some awards, and an avalanche of images and trailers.

Follow along after the jump for the highlights of the past months, from the launch date announcement to the heaps of just-before-launch-day goodies!

Continue reading LEGO Universe launch day roundup

MassivelyLEGO Universe launch day roundup originally appeared on Massively on Tue, 26 Oct 2010 12:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>casualfamilygazilliongazillion-entertainmentkidslaunchlaunch-daylaunch-day-round-upLEGOLEGO-bricksLEGO-Universenetdevilround-upTue, 26 Oct 2010 12:30:00 EST