Massively http://massively.joystiq.com Massively http://www.blogsmithmedia.com/http://massively.joystiq.com/media/feedlogo.gif Massively http://massively.joystiq.com en-us Copyright 2013 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[City of Steam's Tears of the Oracle patch hails the return of the greenskins]]>http://massively.joystiq.com/2013/06/19/city-of-steams-tears-of-the-oracle-patch-hails-the-return-of-th/http://massively.joystiq.com/2013/06/19/city-of-steams-tears-of-the-oracle-patch-hails-the-return-of-th/http://massively.joystiq.com/2013/06/19/city-of-steams-tears-of-the-oracle-patch-hails-the-return-of-th/#commentsFiled under: , , , , , , , , , , , ,

City of Steam's Tears of the Oracle patch hails the return of the greenskins
When City of Steam threw open its browser-based beta doors to all players, certain classes and races were noticeably missing from the soirée. But some fan-favorites have finally gotten their invitation and will be rejoining the party when the 1.3 patch Tears of the Oracle hits next week; greenskins, dwarves, and Channelers will once again be available to play.

And that's not even the half of it! This next patch will also be raising the level cap, expanding questlines, and adding plenty of new things, including the Founder's Annex suburb, a PvP event, a collection system, rare mobs in dungeons, plenty of cosmetic items, and even a new crafting system. On top of that, levels one through nine can resurrect for free in dungeons and the salvage system got an overhaul. So get ready to get your goblin (or hobbe, or orc) on next week!

[Source: Mechanist Games press release]

MassivelyCity of Steam's Tears of the Oracle patch hails the return of the greenskins originally appeared on Massively on Wed, 19 Jun 2013 10:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>Channelercity-of-steamcrafting-changescrafting-systemfantasyFounders-Annexgoblingoblinsgreenskinshigher-level-caphobbehobbeslevel-cap-increasemechanistmechanist-gamesnew-areasnew-itemsopen-betaorcorcsreturn-of-the-greenskinssalvagingsci-fisteampunkWed, 19 Jun 2013 10:30:00 EST<![CDATA[City of Steam dev journal discusses game events]]>http://massively.joystiq.com/2013/06/18/city-of-steam-dev-journal-discusses-game-events/http://massively.joystiq.com/2013/06/18/city-of-steam-dev-journal-discusses-game-events/http://massively.joystiq.com/2013/06/18/city-of-steam-dev-journal-discusses-game-events/#commentsFiled under: , , , , , , , , ,

City of Steam dev journal discusses game events
With a name meaning the center, you'd expect City of Steam's Nexus to be a happening place even in beta, right? That means plenty of events for folks to get in on. Well, it just so happens that there are two general events already in game and a third on the way, and Mechanist Games gives players the lowdown on how to get in on the action in the latest dev journal.

Unlike temporary in-game events, events in CoS are permanent instances you queue for. Of course, victory promises reward. Of the two current events, the Arena is all about survival of the soloist as waves of mobs crash into you whereas Tesla Defense is a five-man tower defense. When patch 1.3 releases, the PvP-based Siege of the Spire will join the event lineup as a MOBA-inspired arena that includes mobs, turrets, and team bases. Players can join the regular events as well as daily and weekly events with larger rewards. For more details, check out the official site.

MassivelyCity of Steam dev journal discusses game events originally appeared on Massively on Tue, 18 Jun 2013 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>Arenabetacity-of-steamdungeondungeonseventsfantasygoblinmechanistmechanist-gamesPvPsci-fiSiege-of-the-SpiresteampunkTesla DefenseTesla-DefenseTue, 18 Jun 2013 10:00:00 EST<![CDATA[Jukebox Heroes: Starting your MMO music collection]]>http://massively.joystiq.com/2013/06/11/jukebox-heroes-starting-your-mmo-music-collection/http://massively.joystiq.com/2013/06/11/jukebox-heroes-starting-your-mmo-music-collection/http://massively.joystiq.com/2013/06/11/jukebox-heroes-starting-your-mmo-music-collection/#commentsFiled under: , , , ,

Jukebox Heroes Starting your MMO music collection
I love seeing people turned on to MMO music, particularly after it's gotten such a bad rap over the years. But for the new fan, it can be a daunting proposition to start up a collection. After all, it's not as if you can go down to your local vinyl shop, peruse a stack of 45s, and come out with a full set of SOE's greatest hits. Only a fraction of MMO scores are available for purchase these days, with the rest being free, packaged in with collector's editions, out of print, or just tucked away inside of game files somewhere.

So how do you get started on building up a robust library of MMO music? If you don't have deep pockets, which scores would I recommend you pick up first? Well, my friend, I've given it some thought and have put together a guide to six essential purchases that will get you off to a great start. Don't thank me; thank music. And also me because I did this hard work.

Continue reading Jukebox Heroes: Starting your MMO music collection

MassivelyJukebox Heroes: Starting your MMO music collection originally appeared on Massively on Tue, 11 Jun 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>age-of-conanaionchance-thomascity-of-steamcollectioncomposercomposersdark-age-of-cameloteverquestfeaturedfinal-fantasy-xigame-musicguild-warsguild-wars-2inon-zurjeremy-soulejukeboxjukebox-heroesjustin-olivettilord-of-the-rings-onlinemmo-jukeboxmmo-musicmusicopinionpirates-of-the-burning-seariders-of-rohanriftsoundtracksoundtracksspiral-knightsthe-secret-worldworld-of-warcraftTue, 11 Jun 2013 09:00:00 EST<![CDATA[Mechanist launches City of Steam's patch 1.2: The Vault Unsealed]]>http://massively.joystiq.com/2013/05/28/mechanist-launches-city-of-steams-patch-1-2-the-vault-unsealed/http://massively.joystiq.com/2013/05/28/mechanist-launches-city-of-steams-patch-1-2-the-vault-unsealed/http://massively.joystiq.com/2013/05/28/mechanist-launches-city-of-steams-patch-1-2-the-vault-unsealed/#commentsFiled under: , , , , , , ,

City of Steam: Draug and Riven
Tomorrow (or tonight, depending on your point of view) is patch day for free-to-play, browser-based title City of Steam. Starting at 2 a.m. EDT, the game will be taken offline for four to six hours while Mechanist Games pushes live patch 1.2: The Vault Unsealed.

This new patch adds quite a bit of content to the still-in-development City of Steam, including new quests, the return of the Riven and Draug as playable races, the addition of a new content hub by the name of The Vault and a brand-new Wilderness level known as The Broken Stair. The level cap has also been raised up to 32, and PvP enthusiasts will find a new map and new tournament event in which to slay their fellow players.

Mechanist is promising more details once the servers come back online; in the meantime, you can discuss the patch over at the official City of Steam forums.

MassivelyMechanist launches City of Steam's patch 1.2: The Vault Unsealed originally appeared on Massively on Tue, 28 May 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabeta-testbeta-testingcity-of-steamf2pfantasyfree-to-playfreemiumgoblinmechanistmechanist-gamesmicrotransactionmicrotransactionspatchpremiumsci-fisteampunktestingThe-Vault-UnsealedTue, 28 May 2013 18:00:00 EST<![CDATA[The Stream Team: Monocle Day edition, May 20 - 26, 2013]]>http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/#commentsFiled under: , , ,

The Stream Team Monocle day edition, May 20 26, 2013
Two weeks ago, y'all had the chance to select a new holiday to help add some cheer to the otherwise bland weeks in the middle of May. The choices teased and tantalized you, but you're a discriminating crowd. In a race fraught with nail-biting suspense, only one ultimately prevailed. And so it is with further ado we bring to you: Monocle Day!

This Tuesday, May 21st, has been selected to be the auspicious day of this most storied celebration. Why? Because 5/21 splits into 5 + 2 + 1, which of course = 8, and we all know that 8 is just two monocles stacked on top of each other! And as always, Massively TV is here to help you ring in the new holiday, with special shows throughout the entire week. Check out the full schedule of celebratory events hosted by The Stream Team after the break. Then let us know if you'll be wearing your own monocle in honor of the festivities.

Continue reading The Stream Team: Monocle Day edition, May 20 - 26, 2013

MassivelyThe Stream Team: Monocle Day edition, May 20 - 26, 2013 originally appeared on Massively on Mon, 20 May 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>Achaeaaction-mmoactivisionagonanetAnno-Onlinearenanetaventurinebiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamescity-of-steamconsoleconsolescrypticcryptic-studiosdarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodfdndDotA-2dragonDragonrealmsdragonsdragons-propheteaelectronic-artselswordeq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfrfree-realmsfree-to-playfuncomgoblinguild-warsgwhi-rezhi-rez-studioshistoricalhorrorhousinginfernuminfernum-productionsinternet-spaceshipskid-friendlykidskids-mmolivestreamlivestreaminglivestreamslucasartsmassively-metamassively-tvmechanistmechanist-gamesmetamobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftneverwinteropen-pvpperfect-worldperfect-world-entertainmentplaneplanesplaystation-3playstation3pollps3pvppwerunewakerrunewaker-entertainmentsandboxsci-fantasysci-fisecret-worldskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicsteampunkstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorthe-old-republicthe-secret-worldthe-stream-teamthreshold-rpgtortswtwitchtwitch-tvunholy-warswarwarcraftwargaming.netwarplanewarplanesworld-of-warcraftworld-of-warplaneswowwowpMon, 20 May 2013 09:00:00 EST<![CDATA[The Stream Team: MLT edition, May 13 - 19, 2013]]>http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/http://massively.joystiq.com/2013/05/13/the-stream-team-mlt-edition-may-13-19-2013/#commentsFiled under: , , ,

The Stream Team May 13 19, 2013
Nothing beats an MLT, especially when the tomato is nice and ripe! Except maybe Massively TV. MMmm mmmm. Now there's something you can really sink your teeth into -- the wild and crazy antics of your favorite Stream Team hosts! And they've got a menu for all tastes this week, from space adventures to dragons to WWII planes. Of course, it all comes with a side of reruns and a dessert highlight to complete your meal.

So pull up a chair and grab yourself a helping or two... or 10. Hey, there's no limit here; enjoy as much as you like! While you're enjoying the spread, be sure to join in the after-dinner chat in Outtakes.

Continue reading The Stream Team: MLT edition, May 13 - 19, 2013

MassivelyThe Stream Team: MLT edition, May 13 - 19, 2013 originally appeared on Massively on Mon, 13 May 2013 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-mmoactivisionage-of-conanage-of-conan-unchainedagonanetaocaoc-unchainedarenanetarkark-hunterarkfallaventurinebiowareblizzardblizzard-entertainmentbuy-to-playccpccp-gamescity-of-steamconanconsoleconsolescrypticcryptic-studiosdarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodefiancedfdnddota-2Dragonrealmseaelectronic-artselswordeq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfree-to-playfuncomgoblinguild-warsgwhi-rezhi-rez-studioshistoricalhorrorhyboriainternet-spaceshipslivestreamlivestreaminglivestreamslucasartsmabinogimassively-metamassively-tvmechmechanistmechanist-gamesmechsmechwarriormechwarrior-mmomechwarrior-onlinemetammo-shootermobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmwomythologyncsoftneverwinternexonnexon-americaopen-pvpperfect-worldperfect-world-entertainmentpiranhapiranha-gamesplaneplanesplaystation-3playstation3pollps3pvppwesandboxsci-fantasysci-fisecret-worldshooterskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicsteampunkstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorsyfythe-old-republicthe-secret-worldthe-stream-teamthird-person-shootertortpstransmedia-synergytriontrion-worldstswtvtwitchtwitch-tvunchainedunholy-warswarwarcraftwargaming.netwarplanewarplanesworld-of-warcraftworld-of-warplaneswowwowpxboxMon, 13 May 2013 09:00:00 EST<![CDATA[Betawatch: May 4 - 10, 2013]]>http://massively.joystiq.com/2013/05/10/betawatch-may-4-10-2013/http://massively.joystiq.com/2013/05/10/betawatch-may-4-10-2013/http://massively.joystiq.com/2013/05/10/betawatch-may-4-10-2013/#commentsFiled under: , , , ,

It's really good, it is.
You don't need to read the rest of this column, folks. City of Steam goes into open beta in two hours, so there is no reason for you to be sitting here when you could be playing that. Oh, and Marvel Heroes is running one last open beta weekend. And UFO Online is also in open beta. Plus, Arcane Saga launched (or re-launched) its beta. There is too much stuff to play for you to be sitting around reading columns about betas. You've got your project right there.

Still here? You're really dedicated to that beta list, huh? Well, we appreciate that. And you can find it just past the break as always, and you can feel free to let us know if we missed anything down in the comments just as always. But seriously, you don't even need to close your browser for City of Steam. That's accessibility right there.

Continue reading Betawatch: May 4 - 10, 2013

MassivelyBetawatch: May 4 - 10, 2013 originally appeared on Massively on Fri, 10 May 2013 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>alphaalphasarcane-sagabetabeta-testbeta-testingbetasbetawatchcity-of-steamclosed-betafeaturedgame-testinglaunchlaunchesmarvel-heroesmassively-metaopen-betarounduptestingufo-onlineFri, 10 May 2013 20:00:00 EST<![CDATA[City of Steam opens beta doors at 10 p.m. tonight]]>http://massively.joystiq.com/2013/05/10/city-of-steam-opens-beta-doors-at-10-pm-tonight/http://massively.joystiq.com/2013/05/10/city-of-steam-opens-beta-doors-at-10-pm-tonight/http://massively.joystiq.com/2013/05/10/city-of-steam-opens-beta-doors-at-10-pm-tonight/#commentsFiled under: , , , , , , ,

City of Steam opens beta doors at 10 pm tonight
If you've been eagerly awaiting your chance to get into the browser-based steampunk goodness of City of Steam, your wait is nearly over. Clear your Friday night plans because in just a few hours at 10:00 p.m. EDT, the city of Nexus will be welcoming its new residents. And you won't be needing any early access key, as Mechanist Games is throwing the beta doors open wide for any and all!

Returning testers will notice many new features have been added since the closed beta runs, like events, a plethora of new cosmetic items, and more streamlined skill, talent, and crafting systems. And jetpacks -- who can forget the jetpacks! Players will also find over 80 dungeons, over 100 quests, new PvP maps, open Wilderness levels, customizable gear, and more... and that's only to start! The devs have an aggressive release schedule plan of adding new features and content on an almost bi-weekly basis throughout the beta.

For more details on what you can expect, check out Massively's hands-on experience as well as the official open beta features list.

[Source: Mechanist Games press release]

MassivelyCity of Steam opens beta doors at 10 p.m. tonight originally appeared on Massively on Fri, 10 May 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>city-of-steamfantasygoblinmechanistmechanist-gamesnew-contentopen-betasci-fisteampunkThe-NexusFri, 10 May 2013 11:00:00 EST<![CDATA[City of Steam opens up beta to all on May 10th]]>http://massively.joystiq.com/2013/05/07/city-of-steam-opens-up-beta-to-all/http://massively.joystiq.com/2013/05/07/city-of-steam-opens-up-beta-to-all/http://massively.joystiq.com/2013/05/07/city-of-steam-opens-up-beta-to-all/#commentsFiled under: , , , ,

City of Steam opens up beta to all
You know the special beta keys that you needed to access the upcoming City of Steam test? Yeah, well, you don't need them any longer. Mechanist Games has decided to drop the key concept in order to open up the beta to everyone. So starting on May 10th, anyone who has an interest in checking out this steampunk MMO may do so with no hassle.

The upcoming beta test will be continuous and will feature an improved tutorial, events, wiliderness levels, and the Massively-approved technique of jumping. The team also removed the old faction system and teased the possibility of a MOBA-like addition to the game.

[Source: Mechanist Games press release]

MassivelyCity of Steam opens up beta to all on May 10th originally appeared on Massively on Tue, 07 May 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabeta-keysbeta-testcity-of-steamclosed-betafantasygoblinmechanistmechanist-gamesmobaopen-betasci-fisteampunkTue, 07 May 2013 18:00:00 EST<![CDATA[City of Steam open beta early admission starts May 10]]>http://massively.joystiq.com/2013/04/26/city-of-steam-open-beta-early-admission-starts-may-10/http://massively.joystiq.com/2013/04/26/city-of-steam-open-beta-early-admission-starts-may-10/http://massively.joystiq.com/2013/04/26/city-of-steam-open-beta-early-admission-starts-may-10/#commentsFiled under: , , , , , , , ,

City of Steam open beta early admission starts May 10
Want an early look at steampunk browser MMO City of Steam? Mark May 10th on your calendar, because that's the day that Mechanist is launching an "early admission" ramp up to its forthcoming open beta test.

The testing phase will be continuous (as opposed to that trendy weekend-only tomfoolery), and Mechanist will start with three classes and four races with more to come as the process matures. If you don't have a key already, you can get one by subscribing to the City of Steam newsletter on the official site.

MassivelyCity of Steam open beta early admission starts May 10 originally appeared on Massively on Fri, 26 Apr 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabrowserbrowser-basedcity-of-steamcity-of-steam-betafantasygoblinmechanistmechanist-gamessci-fisteampunkFri, 26 Apr 2013 11:00:00 EST<![CDATA[The Daily Grind: Has an MMO ever implemented your idea?]]>http://massively.joystiq.com/2013/04/26/the-daily-grind-has-an-mmo-ever-implemented-your-idea/http://massively.joystiq.com/2013/04/26/the-daily-grind-has-an-mmo-ever-implemented-your-idea/http://massively.joystiq.com/2013/04/26/the-daily-grind-has-an-mmo-ever-implemented-your-idea/#commentsFiled under: , , , , , ,

City of Steam
Earlier this month, Massively's MJ sat down with the City of Steam devs and discovered that you, the Massively readers, had actually influenced one of the game mechanics. Wrote MJ,
There is one new feature that was put into game specifically because of Massively fans: jumping! That's right. You made it clear you wanted jumping in game, and the devs listened. Who says you don't have the power to change things?
Leaving aside the implication that we spent one of our precious wishes on jumping, I thought this was really cool, and I tried to think of other examples of players coming up with amazing (or not) design ideas that were subsequently implemented in a game. I can think of certain demands that were met in classic MMOs. World of Warcraft is infamous for implementing the most popular player mods as official features, and in more recent news, there are Guild Wars 2's efforts to split reset times for different continents after much player protest.

How about you? Has an MMO ever implemented your idea or the ideas of a fellow player?

Every morning, the Massively bloggers probe the minds of their readers with deep, thought-provoking questions about that most serious of topics: massively online gaming. We crave your opinions, so grab your caffeinated beverage of choice and chime in on today's Daily Grind!

MassivelyThe Daily Grind: Has an MMO ever implemented your idea? originally appeared on Massively on Fri, 26 Apr 2013 08:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>brianna-royce-tdgbring-back-precastingcity-of-steamdaily-grindgame-designGuild-Wars-2gw2ideaideasjumpingopinionplayer-ideastdgthe-daily-grindultima-onlineuoWorld-of-WarcraftwowFri, 26 Apr 2013 08:00:00 EST<![CDATA[City of Steam gets the green light]]>http://massively.joystiq.com/2013/04/19/city-of-steam-gets-the-green-light/http://massively.joystiq.com/2013/04/19/city-of-steam-gets-the-green-light/http://massively.joystiq.com/2013/04/19/city-of-steam-gets-the-green-light/#commentsFiled under: , , , , ,

City of Steam has been greenlit for Steam
The steampunk browser MMO City of Steam is happy to announce today that it has been greenlit by the benevolent members of Steam.

What does this mean? It means that the people have spoken and they want to see City of Steam on... Steam, and the folks at Mechanist Games can now work with Valve to get the game up on the popular game distribution platform, opening the free-to-play title up to much more exposure.

Out of 1195 games campaigning for a spot on Steam, CoS came out in "8th or 9th place," according to the team's recent news post. Up next: getting out of beta and on to a finished client-based version for Steam.

Congratulations to everyone at Mechanist Games!

MassivelyCity of Steam gets the green light originally appeared on Massively on Fri, 19 Apr 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>city-of-steamfantasygoblingreenlitmechanistmechanist-gamessci-fisteamsteampunkvalveFri, 19 Apr 2013 18:00:00 EST<![CDATA[City of Steam going public with wilderness areas]]>http://massively.joystiq.com/2013/04/09/city-of-steam-going-public-with-wilderness-areas/http://massively.joystiq.com/2013/04/09/city-of-steam-going-public-with-wilderness-areas/http://massively.joystiq.com/2013/04/09/city-of-steam-going-public-with-wilderness-areas/#commentsFiled under: , , , , , , , , ,

City of Steam going public with wilderness areas
If you were just thinking to yourself that the one thing City of Steam needed (besides being released already so you can play!) was an open, public hunting area, you're in luck! In the latest dev blog, Mechanist Games announced the addition of wilderness areas -- zones where many players can congregate, kill respawning mobs, and do quests. The wilderness areas give players a travel route that offers XP and loot along the way. Wilderness areas will also host public events and have an occasional rare spawn.

Even more things are in store for these public areas. The dev blog hints at PvP, as also mentioned in Massively's recent interview.

MassivelyCity of Steam going public with wilderness areas originally appeared on Massively on Tue, 09 Apr 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>city-of-steamdev-blogdev-diaryfantasygoblinmechanistmechanist-gamesnew-areapublic-areapublic-eventssci-fisteampunkwildernessTue, 09 Apr 2013 11:00:00 EST<![CDATA[GDC 2013: City of Steam demo showcases crafting and other streamlined features]]>http://massively.joystiq.com/2013/04/05/gdc-2013-city-of-steam-demo-showcases-crafting-and-other-stream/http://massively.joystiq.com/2013/04/05/gdc-2013-city-of-steam-demo-showcases-crafting-and-other-stream/http://massively.joystiq.com/2013/04/05/gdc-2013-city-of-steam-demo-showcases-crafting-and-other-stream/#commentsFiled under: , , , , , , , , , , , ,

GDC 2013 City of Steam demo showcases crafting and other streamlined features
It may seem like a while has passed since we last experienced City of Steam, the fantasy steampunk MMORPG that fits in your browser. That's because it has! The game's last closed beta testing round was back in December, and fans have been eagerly waiting to get back into the city-state of Nexus. Of course there has been some news to tide us over in the meantime while developers have been turning all of that beta feedback into fixes and updates, but that's not the same; people want to play. Luckily, it's GDC to the rescue!

While the rest of the world won't actually get to access City of Steam until it launches open beta (which is anticipated to be within the next two months!), I was able to dive in and explore the fruits of the devs' winter labors. And let me tell you, they've put their time to good use! I met with Communications Manager Gabriel Laforge and Operations Director Andrew Woodruff from Mechanist Games who showed off all the work that has gone into the game since the beta closed, from graphics to crafting to airships. They also highlighted the game's cash shop and revealed numerous rewards players can earn simply by playing the game.

Continue reading GDC 2013: City of Steam demo showcases crafting and other streamlined features

MassivelyGDC 2013: City of Steam demo showcases crafting and other streamlined features originally appeared on Massively on Fri, 05 Apr 2013 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>city-of-steamconconferenceconventioneventevent-coverageeventsfantasyfeaturedgame-developers-conferencegame-developers-conference-2013gdcgdc-2013goblinhands-oninterviewinterviewsmassively-event-coveragemechanistmechanist-gamespreviewpreviewsR2-gamessci-fisteampunkFri, 05 Apr 2013 16:30:00 EST<![CDATA[PAX East 2013: Hands-on with City of Steam]]>http://massively.joystiq.com/2013/03/23/pax-east-2013-hands-on-with-city-of-steam/http://massively.joystiq.com/2013/03/23/pax-east-2013-hands-on-with-city-of-steam/http://massively.joystiq.com/2013/03/23/pax-east-2013-hands-on-with-city-of-steam/#commentsFiled under: , , , , , , , , , , , , , ,

Screenshot -- City of Steam
I don't know what it is about steam engines, brass goggles, and copious amounts of clockwork mechanisms that excites me so much, but the steampunk genre has a special place in my heart. With that in mind, it should be no surprise that when I discovered that Mechanist Games, the
studio behind upcoming F2P browser MMO City of Steam, was going to be at PAX East, I immediately claimed the assignment.

For the uninitiated, City of Steam is a title that mixes the traditional fantasy flavors of magic, elves, and goblins with steampunk staples of industrialism, clockwork automatons, and airships to create what is described as "industrial age fantasy in a fallen world." During my time at PAX East, I got to spend just under an hour exploring the world of City of Steam and chatting with the game's developers who were milling about the booth. It's a fairly ambitious title that's aiming to bring a high-quality, modern MMO experience to players' browsers, but will it run like clockwork or go up in a cloud of steam?

Continue reading PAX East 2013: Hands-on with City of Steam

MassivelyPAX East 2013: Hands-on with City of Steam originally appeared on Massively on Sat, 23 Mar 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>city-of-steamconconventioneventevent-coverageeventsexpof2pfantasyfeaturedfree-to-playgoblinhands-onmassively-event-coveragemechanistmechanist-gamesmicrotransactionmicrotransactionspaxpax-2013pax-eastpax-east-2013penny-arcade-expopreviewpreviewssci-fisteampunkSat, 23 Mar 2013 15:00:00 EST<![CDATA[Free for All: The 10 best-looking browser-based MMORPGs]]>http://massively.joystiq.com/2013/03/20/free-for-all-the-10-best-looking-browser-based-mmorpgs/http://massively.joystiq.com/2013/03/20/free-for-all-the-10-best-looking-browser-based-mmorpgs/http://massively.joystiq.com/2013/03/20/free-for-all-the-10-best-looking-browser-based-mmorpgs/#commentsFiled under: , , , , , , , , , , , ,

Battlestar Galactica Online screenshot
Beauty, they say, is in the eye of the beholder. Keep that in mind before you tell that me the games that fill out the following list of "best-looking browser-based MMORPGs" are ugly as sin. Sure, some of them are an acquired taste, but I wanted to display just how much variety there is now in browser gaming. It's not the delivery system it once was; we have had fancier-looking Flash-based titles for a while, but now with engines like Unity or Silverlight and even HTML5 coding, we have games that look no different from their client-based counterparts.

There are still some ugly-as-sin games out there as well, but they have endearing qualities all the same. So keep that in mind; this is my top 10 list. If you want to suggest your own in the comments section, I would love to hear them!

Now, on to the list, in no particular order...

Continue reading Free for All: The 10 best-looking browser-based MMORPGs

MassivelyFree for All: The 10 best-looking browser-based MMORPGs originally appeared on Massively on Wed, 20 Mar 2013 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>a-mystical-landarcane-legendsbattlestar-galactica-onlinebeau-hindmanBigpointcity-of-steamdragons-of-atlantisdrakensang-onlineEAf2pfeaturedffafree-for-allfree-to-playfreemiuminnogamesjagexkabamkartugalord-of-ultimamad-otter-gamesmilmoopinionrunescapespacetime-studiosvelvet-ropeWed, 20 Mar 2013 17:00:00 EST<![CDATA[City of Steam fires up the Colossus]]>http://massively.joystiq.com/2013/02/06/city-of-steam-fires-up-the-colossus/http://massively.joystiq.com/2013/02/06/city-of-steam-fires-up-the-colossus/http://massively.joystiq.com/2013/02/06/city-of-steam-fires-up-the-colossus/#commentsFiled under: , , , , ,

City of Steam fires up the Colossus
There appears to be no shortage of interesting sights and sounds to experience in City of Steam, although one particular landmark looms above the rest. It's the Colossus, a slumbering defensive... thing that rests in the city proper, and Mechanist Games has an amusing post giving a bit of backstory to the machine.

Apparently the Colossus was created a long time ago as a giant mobile fortress tasked with protecting the city in times of dire peril. As the city is more or less at peace, the Colossus is in stand-by mode -- although it could be woken at any moment.

This mega-sized robot features cannons and an arm that's good for punchin' and aught else. The devs revealed that originally it had several more limbs, but revisions turned it into a walking fort instead.

MassivelyCity of Steam fires up the Colossus originally appeared on Massively on Wed, 06 Feb 2013 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betacanadacanadianscity-of-steamclosed-betacolossusdev-diaryfantasygoblinhumorloremechanistmechanist-gamessci-fisteampunkWed, 06 Feb 2013 16:00:00 EST<![CDATA[City of Steam's bestiary gives pre-launch advantage]]>http://massively.joystiq.com/2013/01/31/city-of-steams-bestiary-gives-pre-launch-advantage/http://massively.joystiq.com/2013/01/31/city-of-steams-bestiary-gives-pre-launch-advantage/http://massively.joystiq.com/2013/01/31/city-of-steams-bestiary-gives-pre-launch-advantage/#commentsFiled under: , , , , ,

City of Steam's beastiary gives prelaunch advantage
While we're twiddling our thumbs waiting for the steampunk City of Steam to finally release, Mechanist Games has a great way that we can prepare for the launch. The team has put a spotlight on the website's bestiary, a helpful encyclopedia of creatures and people that players will be encountering in the game proper.

Beyond just providing some flavor and filling in some lore, the bestiary has a practical purpose by giving players details as to the strengths, weaknesses, and relationships between the mobs. The bestiary can be searched by individual creatures and by species and has plenty of cool pictures to boot.

MassivelyCity of Steam's bestiary gives pre-launch advantage originally appeared on Massively on Thu, 31 Jan 2013 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bestiarybetacity-of-steamdev-diarydev-journalencyclopediafantasygoblinmechanistmechanist-gamessci-fisteampunkThu, 31 Jan 2013 16:00:00 EST<![CDATA[City of Steam partners with publisher R2 Games]]>http://massively.joystiq.com/2013/01/22/city-of-steam-partners-with-publisher-r2-games/http://massively.joystiq.com/2013/01/22/city-of-steam-partners-with-publisher-r2-games/http://massively.joystiq.com/2013/01/22/city-of-steam-partners-with-publisher-r2-games/#commentsFiled under: , , , , ,

City of Steam partners with publisher R2 Games
Although limited in duration, City of Steam's alpha and closed beta sessions last year have helped build a following for Mechanist Games' upcoming steampunk-flavored browser-based MMO. And now, thanks to a publishing partnership with Reality Squared Games, the industrial age fantasy game will have access to a wider audience.

R2 Games already has other free-to-play titles in its portfolio, but City of Steam will be the first using the Unity 3D engine. R2 Games CEO Jared Psigoda stated, "I see a lot of potential in City of Steam. Mechanist Games' approach to making a game is something we're thrilled to be a part of. We want to make sure City of Steam gets the recognition it deserves for being the innovative game that it is."

[Source: Reality Squared Games press release]

MassivelyCity of Steam partners with publisher R2 Games originally appeared on Massively on Tue, 22 Jan 2013 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>city-of-steamfantasygoblinJared-Psigodamechanistmechanist-gamespublishing-partnershipr2-gamesreality-squared-gamessci-fisteampunkUnity-3DUnity-3D-engineTue, 22 Jan 2013 12:00:00 EST<![CDATA[City of Steam focuses on improvements for open beta]]>http://massively.joystiq.com/2013/01/09/city-of-steam-focuses-on-improvements-for-open-beta/http://massively.joystiq.com/2013/01/09/city-of-steam-focuses-on-improvements-for-open-beta/http://massively.joystiq.com/2013/01/09/city-of-steam-focuses-on-improvements-for-open-beta/#commentsFiled under: , , , ,

City of Steam focuses on improvements for open beta
With City of Steam preparing for its eventual open beta test, Mechanist Games CEO Dave Lindsay has a few words to say about the testing process so far and what the team has in store for the future. Lindsay said that he personally spent time gaming with players during the recent test because as he says, "I believe as a small developer working on our first game, it's critical for us to be listening to our players."

Lindsay delivers a substantial list of improvements and additions for the next version of the game in a short letter on the official site. Among these chances include a smoother difficulty curve, easier-to-understand stats, a broader training regimen, better UI tools for quests, and a whole lot of polishing.

Then there are some yet-to-be-named surprises: "Of course, we will continue to raise the bar for browser games all-over the world. New features will definitely be in there to dazzle and jaw-drop. You ain't never seen a browser game like this!"

MassivelyCity of Steam focuses on improvements for open beta originally appeared on Massively on Wed, 09 Jan 2013 14:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betacity-of-steamdave-lindsaydev-diaryfantasygoblinmechanistmechanist-gamesopen-betasci-fisteampunkWed, 09 Jan 2013 14:30:00 EST<![CDATA[The Perfect Ten: New MMOs to watch in 2013]]>http://massively.joystiq.com/2013/01/03/the-perfect-ten-new-mmos-to-watch-in-2013/http://massively.joystiq.com/2013/01/03/the-perfect-ten-new-mmos-to-watch-in-2013/http://massively.joystiq.com/2013/01/03/the-perfect-ten-new-mmos-to-watch-in-2013/#commentsFiled under: , , , , , , , , , , ,

The Perfect Ten New MMOs to watch in 2013
Oh, I had a great Perfect Ten prepped as the first list of the year, but my meanie-face editor slammed on the veto button and told me, point-blank, that I was going to be counting down the best MMO prospects for the year. Then she drove a lawnmower through a Nordstroms while huffing paint thinner and throwing empty cans at the security personnel. Even so, her idea is probably more interesting than what I had.

Let me give you a few notes on today's list because I sense that I'm going to tick more of you off than normal here. My goal was to sift through the possible releases for 2013 and pick the 10 most promising, both in "will it actually launch this year?" and in its potential for success. The combination makes it a tough call because some of these will undoubtedly be delayed to 2014 or beyond and some of these we still don't know as much as we'd like about them.

But who cares? Let's have some fun and kick this year off right. Here are my picks for new MMOs to watch in 2013.

Continue reading The Perfect Ten: New MMOs to watch in 2013

MassivelyThe Perfect Ten: New MMOs to watch in 2013 originally appeared on Massively on Thu, 03 Jan 2013 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>aaactionaction-mmoage-of-wulinage-of-wushuarche-agearcheagearkark-hunterarkfallasiabethesdabethesda-softworksbethsoftcarbinecarbine-studiosccpccp-gameschinachinesechinese-mmochris-robertscity-of-steamconsolecrowdfundingcrypticcryptic-studiosdaggerfalldefiancednddustdust-514elder-scrollselder-scrolls-onlineesoeveeve-onlinef2pfactionsfantasyfeaturedfpsfree-to-playgazilliongazillion-entertainmentgoblingpotatogvghistoricalhumorjet-likickstarterkidnappingmartial-artsmarvelmarvel-heroesmarvel-universemarvel-universe-onlinemechanistmechanist-gamesming-dynastymmofpsmorrowindmuoncsoftneverwinteroblivionopinionp10perfect-10perfect-tenperfect-worldperfect-world-entertainmentplaneplanesplaystationplaystation-3please-dont-suckps3pvppwerounduprvrsandboxsandparksci-fantasysci-fisecret-identityshooterskyrimsnail-gamessnail-games-usaspaceshipstar-citizensteampunksuperherosuperheroessyfytamrieltestesothe-elder-scrollsthe-elder-scrolls-onlinethe-perfect-10the-perfect-tenthree-faction-pvpthree-way-pvptop-10top-10-listtop-tentop-ten-listtransmedia-synergytriontrion-worldstvwarwargaming.netwarplanewarplaneswildstarworld-of-warplaneswowpwswushuwuxiaxboxxl-gamesxlgameszenimaxzenimax-mediazenimax-onlinezenimax-online-studiosThu, 03 Jan 2013 13:00:00 EST<![CDATA[Mechanist says no to huge pauldrons, revamps City of Steam NPC duds]]>http://massively.joystiq.com/2013/01/02/mechanist-says-no-to-huge-pauldrons-revamps-city-of-steam-npc-d/http://massively.joystiq.com/2013/01/02/mechanist-says-no-to-huge-pauldrons-revamps-city-of-steam-npc-d/http://massively.joystiq.com/2013/01/02/mechanist-says-no-to-huge-pauldrons-revamps-city-of-steam-npc-d/#commentsFiled under: , , , , , , ,

City of Steam - Nexan guard uniforms
It didn't take Mechanist Games long to release its first City of Steam dev journal for 2013. Today's steampunk browser title update focuses on an NPC uniform revamp, and while clothes aren't quite the stuff of epic MMO legend, we must admit to digging the new Victorian duds.

The NPCs in question are Nexan guards, the original outfits for which featured gigantic shoulder pauldrons and some sort of checkerboard faux pas motif. The new uniform is noticeably sleeker, "much more respectable, and far less gaudy," according to the devs. Have a look for yourself at the official City of Steam website.

MassivelyMechanist says no to huge pauldrons, revamps City of Steam NPC duds originally appeared on Massively on Wed, 02 Jan 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>browserbrowser-basedcity-of-steamcity-of-steam-uniformsdev-diarydev-journaldev-updatefantasymechanistmechanist-gamessci-fisteampunkWed, 02 Jan 2013 11:00:00 EST<![CDATA[The Stream Team: Countdown edition, December 31, 2012 - January 6, 2013]]>http://massively.joystiq.com/2012/12/31/the-stream-team-countdown-edition-december-31-2012-january/http://massively.joystiq.com/2012/12/31/the-stream-team-countdown-edition-december-31-2012-january/http://massively.joystiq.com/2012/12/31/the-stream-team-countdown-edition-december-31-2012-january/#commentsFiled under: , , ,

The Stream Team Countdown edition, December 31, 2012 January 6, 2013
It's the final countdown. Do do do do. Do do do do do... Admit it, you were just singing along too, weren't you? That's OK -- I wasn't listening. Or recording. Promise! If your sparkling rendition becomes an overnight sensation on YouTube, it will be purely a coincidence.

Seriously, how is this year over already? This is it. The clock has nearly finished ticking down on 2012. In fact, before this week is out, we will leave the year behind us. It was a fairly good one, and I will give it a fond farewell. But then it is on to a brand-spanking new year.

It is at this time that many folks make resolutions to enhance their lives. What better way to enhance life than by adding more The Stream Team hilarity? I shall join in this time-honored tradition and commit to immerse myself in as much Massively TV as possible, starting with all of the great shows this week. Or was it that I will avoid being committed... either way, it will make for some great entertainment. So why don't you join us in filling 2013 with gaming goodness? And be sure to drop us a note about your favorite New Year's traditions in the comments!

Continue reading The Stream Team: Countdown edition, December 31, 2012 - January 6, 2013

MassivelyThe Stream Team: Countdown edition, December 31, 2012 - January 6, 2013 originally appeared on Massively on Mon, 31 Dec 2012 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>aionanetarenanetascensionbiowareborderlands-2buy-to-playccpccp-gameschampionschampions-onlinechampscity-of-steamcocrypticcryptic-studioseaelectronic-artseq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfamilyfantasyfeaturedfpsfree-to-playfuncomgoblinguild-wars-2gw2hi-rezhi-rez-studioshistoricalhorrorinternet-spaceshipskid-friendlykids-mmokingsislekingsisle-entertainmentlivestreamlivestreaminglivestreamslucasartsmassively-metamassively-tvmechanistmechanist-gamesmetammo-shootermmofpsmobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftperfect-worldperfect-world-entertainmentpiratepirate101piratesplanetsideplanetside-2pollps2pvppwesandboxsci-fantasysci-fisecret-worldshooterskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstarcraft-2starcraft-iisteampunkstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtortanktankstelonthe-old-republicthe-secret-worldthe-stream-teamtortruly-freetswtwitchtwitch-tvvanguardvanguard-saga-of-heroesvgwarwargaming.networld-of-tankswotMon, 31 Dec 2012 10:00:00 EST<![CDATA[City of Steam fans treated to dev humiliation video for reaching goal]]>http://massively.joystiq.com/2012/12/27/city-of-steam-fans-treated-to-dev-humiliation-video-for-reaching/http://massively.joystiq.com/2012/12/27/city-of-steam-fans-treated-to-dev-humiliation-video-for-reaching/http://massively.joystiq.com/2012/12/27/city-of-steam-fans-treated-to-dev-humiliation-video-for-reaching/#commentsFiled under: , , , , , , , , , ,

City of Steam fans treated to dev humiliation video for reaching goal
Whether it was out of love for the game or just a wicked sense of humor, City of Steam fans banded together and supported the steampunk browser game enough to earn their first special dev humiliation reward on the Steam-o-Meter. So what type of public humiliation were the devs subjected to? How about FemGab and AndrewYunk starring in a live-action trailer of the beta itself!

Check out the humorous -- yet eerily accurate -- depictions of character creation, the tutorial, looting, and PvP in the video after the break! And if you want to see how well the devs have lived this humiliation down, then tune in to Massively TV this Friday, December 28th, at 9:00 p.m. EST for a dev-filled stream spectacular.

[Source: Mechanist Games press release]

Continue reading City of Steam fans treated to dev humiliation video for reaching goal

MassivelyCity of Steam fans treated to dev humiliation video for reaching goal originally appeared on Massively on Thu, 27 Dec 2012 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>city-of-steamfantasygoalsgoblinhumiliationhumorlive-action-trailermechanistmechanist-gamessci-fiSteam-o-MetersteampunkvideoThu, 27 Dec 2012 20:00:00 EST<![CDATA[The Stream Team: Peace on Earth edition, December 24 - 30, 2012]]>http://massively.joystiq.com/2012/12/24/the-stream-team-peace-on-earth-edition-december-24-30-2012/http://massively.joystiq.com/2012/12/24/the-stream-team-peace-on-earth-edition-december-24-30-2012/http://massively.joystiq.com/2012/12/24/the-stream-team-peace-on-earth-edition-december-24-30-2012/#commentsFiled under: , , , ,

The Stream Team Peace on Earth edition, December 24 30, 2012
I don't know about you, but I am pretty glad the world didn't end, either by a butterfly flapping its wings or by World of Warcraft shutting down (your top two votes!). Despite all the troubles in it, I'm still pretty fond of this place. After all, this is where the MMOs are! And Massively TV. Of course, there are many other reasons, not the least of which is this very special time of year.

On that note, The Stream Team wishes you all a wonderful holiday season. May your homes and lives be filled with peace, happiness, and lightning-fast internet! Oh, and also the sound of this week's streams...

Continue reading The Stream Team: Peace on Earth edition, December 24 - 30, 2012

MassivelyThe Stream Team: Peace on Earth edition, December 24 - 30, 2012 originally appeared on Massively on Mon, 24 Dec 2012 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>acage-of-wulinage-of-wushuaionanetarenanetascensionasherons-callasherons-call-2asiabiowarebuy-to-playccpccp-gameschampionschampions-onlinechampschinachinesechinese-mmocity-of-steamclassic-mmococonsoleconsolescrypticcryptic-studiosdc-universedc-universe-onlinedcuodota-2dota2eaelectronic-artseq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfallen-earthfantasyFar-Cry-3fefeaturedfpsfree-to-playfuncomg1gamersfirstgoblinGoodgame-Empiregpotatoguild-wars-2gvggw2hi-rezhi-rez-studioshistoricalhorrorinternet-spaceshipsjet-likidnappinglivestreamlivestreaminglivestreamslucasartsmartial-artsmassively-metamassively-tvmechanistmechanist-gamesmetaming-dynastymmo-shootermmofpsmobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftperfect-worldperfect-world-entertainmentplanetsideplanetside-2playstation-3playstation3pollpost-apocpost-apocalypticps2ps3pvppwesandboxsci-fantasysci-fisecret-worldshooterskill-basedSmitesnail-gamessnail-games-usasoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstarcraft-iisteampunkstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtortanktanksThe-Lost-Titansthe-old-republicthe-secret-worldthe-stream-teamtortruly-freetswturbineturbine-entertainmenttwitchtwitch-tvwarwargaming.netwastelandsworld-of-tankswotwushuwuxiaMon, 24 Dec 2012 10:00:00 EST<![CDATA[The Stream Team: End of the world edition, December 17 - 23, 2012]]>http://massively.joystiq.com/2012/12/17/the-stream-team-end-of-the-world-edition-december-17-23-201/http://massively.joystiq.com/2012/12/17/the-stream-team-end-of-the-world-edition-december-17-23-201/http://massively.joystiq.com/2012/12/17/the-stream-team-end-of-the-world-edition-december-17-23-201/#commentsFiled under: , , , ,

The Stream Team End of the world edition, December 17 23, 2012
It's the end of the world as we know it, and I feel fine! Why? Because we've got The Stream Team to keep us company in the final week! So even if the world ends on December 21st, there are plenty of wacky Massively antics to keep us entertained. What's on the schedule this time around? Plenty -- see for yourself.

But wait, if the world is ending, why bother extending the schedule past the fateful date of destruction? Well, it just looked too unbalanced when chopped in half! And besides, if the world ends with a zombie apocalypse, who's to say that we won't enjoy some shows even when we become zombies? Speaking of endings, what is your prediction for the final finale?

Continue reading The Stream Team: End of the world edition, December 17 - 23, 2012

MassivelyThe Stream Team: End of the world edition, December 17 - 23, 2012 originally appeared on Massively on Mon, 17 Dec 2012 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>age-of-wulinage-of-wushuaionanetarenanetascensionasherons-call-2asiabiowarebrowserbrowser-basedbuy-to-playccpccp-gameschampionschampions-onlinechampschinachinesechinese-mmocity-of-steamclassic-mmococonsoleconsolescrypticcryptic-studiosdc-universedc-universe-onlinedcuodota-2eaelectronic-artseq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfallen-earthfantasyfar-cry-3fefeaturedfree-to-playfuncomg1gamepotgamersfirstgoblinGoodgame-Empiregpotatoguild-wars-2gvggw2Habbo-Hotelhardcorehi-rezhi-rez-studioshistoricalhorrorinternet-spaceshipsjagexjagex-games-studiojet-likidnappinglivestreamlivestreaminglivestreamslord-of-the-ringslord-of-the-rings-onlinelotrolucasartsmartial-artsmassively-metamassively-tvmechanistmechanist-gamesmetaming-dynastymobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftopen-pvpperfect-worldperfect-world-entertainmentpermadeathpkplayer-killingplaystation-3playstation3pollpost-apocpost-apocalypticps3pvppwersrunescapesandboxsci-fantasysci-fisecret-worldsir-techskill-basedSMITEsnail-gamessnail-games-usasoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicStarCraft-IIsteampunkstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtortanktanksThe-Lost-Titansthe-old-republicthe-secret-worldthe-stream-teamtorTorchlight-IItruly-freetswturbineturbine-entertainmenttwitchtwitch-tvwarwargaming.netwastelandswizardrywizardry-onlineworld-of-tankswotwushuwuxiaMon, 17 Dec 2012 10:00:00 EST<![CDATA[City of Steam double feature: A beta trailer and a Steam Greenlight campaign]]>http://massively.joystiq.com/2012/12/12/city-of-steam-double-feature-a-beta-trailer-and-a-steam-greenli/http://massively.joystiq.com/2012/12/12/city-of-steam-double-feature-a-beta-trailer-and-a-steam-greenli/http://massively.joystiq.com/2012/12/12/city-of-steam-double-feature-a-beta-trailer-and-a-steam-greenli/#commentsFiled under: , , , , , , , ,

City of Steam double feature: a beta trailer and a Steam greenlight campaign
If you've been wanting to get a look at the upcoming steampunk MMO City of Steam but haven't been able to procure a closed beta spot, there are still two days until the Autumnwane testing round. However, if you can't wait that long, Mechanist Games has a new trailer showing off the game to tide you over.

On top of that, the studio has announced that City of Steam has kicked off its Greenlight campaign on Steam. What does this mean for fans? It means that if the game gets enough votes, it will be made available on Steam, which will in turn add a number of new features to the game, including pets, new dungeon types, new steambikes, extra character customization options, and more!

To get your City of Steam fix, be sure to watch the creatively done trailer after the break, and then don't forget to watch Massively TV this Friday night, December 14th, at 9:00 p.m. EST to see the game live!

[Source: Mechanist Games press release]

Continue reading City of Steam double feature: A beta trailer and a Steam Greenlight campaign

MassivelyCity of Steam double feature: A beta trailer and a Steam Greenlight campaign originally appeared on Massively on Wed, 12 Dec 2012 17:15:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>beta-trailercity-of-steamfantasygoblinmechanistmechanist-gamessci-fiSteamSteam-greenlightsteampunktrailerWed, 12 Dec 2012 17:15:00 EST<![CDATA[City of Steam hits support goal, revamps hotbars]]>http://massively.joystiq.com/2012/12/11/city-of-steam-hits-support-goal-revamps-hotbars/http://massively.joystiq.com/2012/12/11/city-of-steam-hits-support-goal-revamps-hotbars/http://massively.joystiq.com/2012/12/11/city-of-steam-hits-support-goal-revamps-hotbars/#commentsFiled under: , , , , , ,

City of Steam hits support goal, revamps hotbars
The fanbase has rallied around City of Steam, sending its "Steam-o-Meter" shooting straight to the top. Mechanist Games announced that the community topped the meter with four million points, which means that the company is making good on its promise to include more content for the developing title.

The new content that's coming to the game includes a Marshpuggle pet, a steampunk motorcycle, the Dwarf race, and an as-of-yet-unspecified way of shaming developers. There are pictures for several of these, including a couple teasing a special reward.

The team also overhauled the game's hotbar, saying that while the old design was functional and aesthetically pleasing, the devs thought they could do better. The new hotbar not only has more of that gear-happy look but has a convenient button for emotes.

MassivelyCity of Steam hits support goal, revamps hotbars originally appeared on Massively on Tue, 11 Dec 2012 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betacity-of-steamdev-humiliationdwarvesfantasygoblinguihotbarmechanistmechanist-gamesmotorcyclesci-fisteam-o-metersteampunkuiuser-interfaceTue, 11 Dec 2012 18:00:00 EST<![CDATA[The Stream Team: Lull in the storm edition, December 3 - 9, 2013]]>http://massively.joystiq.com/2012/12/03/the-stream-team-lull-in-the-storm-edition-december-3-9-201/http://massively.joystiq.com/2012/12/03/the-stream-team-lull-in-the-storm-edition-december-3-9-201/http://massively.joystiq.com/2012/12/03/the-stream-team-lull-in-the-storm-edition-december-3-9-201/#commentsFiled under: , , ,

The Stream Team Lull in the storm edition, December 3 9, 2013
From horror movies to storms, there is always a lull before the stuff really hits the fan. And right now is the lull in the storm that is holiday preparation. It's just a short span of time that offers a breather between the insanity that is Black Friday and the rush of all else that comes with the season, so take advantage of it! Before all the decorating, holiday parties, shopping, cooking, and everything else, settle back and watch some Massively TV!

While you relax and enjoy your lull, The Stream Team will treat you to a bit of beta action, some heroic antics, plenty of shooting, and possibly even the final moments of one title. Then, if you can muster the energy for it, share your favorite relaxation ritual. Can you guess one of mine?

Continue reading The Stream Team: Lull in the storm edition, December 3 - 9, 2013

MassivelyThe Stream Team: Lull in the storm edition, December 3 - 9, 2013 originally appeared on Massively on Mon, 03 Dec 2012 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>aionallodsallods-onlineanetarenanetascensionastrum-nivalback-to-betabetabiowarebrowserbrowser-basedcasualccpccp-gameschampionschampions-onlinechampscity-of-heroescity-of-steamcity-of-villainscocohcovcoxcrypticcryptic-studioseaelectronic-artseq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfamilyfantasyfeaturedflashfpsfree-to-playfreedomfuncomgala-netglitchgoblingpotatoguild-wars-2gw2hi-rezhi-rez-studioshipsterhistoricalhorrorinternet-spaceshipskid-friendlykids-mmokingsislekingsisle-entertainmentlivestreamlivestreaminglivestreamslucasartsmail-ru-gamesmail.ru-gamesmailru-gamesmassively-metamassively-tvmechanistmechanist-gamesmetammo-shootermmofpsmobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftparagonparagon-studiosperfect-worldperfect-world-entertainmentpiratepirate101piratesplanetsideplanetside-2pollps2pvppwerelaxationsandboxsci-fantasysci-fisecret-worldshooterskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlineStar-Stablestar-warsstar-wars-the-old-republicsteampunkstreamstream-schedulestream-teamstreamersstreamingstreamteamsuperherosuperheroesswtorTaikodomtanktankstelonthe-old-republicthe-secret-worldthe-stream-teamtinyspecktortruly-freetswtwitchtwitch-tvunlauncheningvanguardvanguard-saga-of-heroesvgwarwargaming.networld-of-tankswotMon, 03 Dec 2012 09:00:00 EST<![CDATA[City of Steam beta coming to the Middle East, Turkey, and North Africa]]>http://massively.joystiq.com/2012/11/30/city-of-steam-beta-coming-to-the-middle-east-turkey-and-north/http://massively.joystiq.com/2012/11/30/city-of-steam-beta-coming-to-the-middle-east-turkey-and-north/http://massively.joystiq.com/2012/11/30/city-of-steam-beta-coming-to-the-middle-east-turkey-and-north/#commentsFiled under: , , , , , , , ,

City of Steam beta coming to the Middle East, Turkey, and North Africa
If you're looking for a steampunk-flavored browser MMO, look no further than Mechanist Games' City of Steam. If you're looking for a steampunk-flavored browser MMO localized in both Arabic and Turkish, well, we'll point you toward CoS yet again.

Mechanist's latest press release trumpets the game's closed beta, which is coming to the Middle East, North Africa, and Turkey in the first quarter of 2013. To join the beta and take part in what Mechanist dubs "MMORPG history," head to the game's official website and sign up.

[Source: Mechanist Games press release]

MassivelyCity of Steam beta coming to the Middle East, Turkey, and North Africa originally appeared on Massively on Fri, 30 Nov 2012 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betacity-of-steamcity-of-steam-betafantasygoblinmechanistmechanist-gamessci-fisteampunkFri, 30 Nov 2012 13:00:00 EST<![CDATA[City of Steam shows player collaborations]]>http://massively.joystiq.com/2012/11/26/city-of-steam-shows-player-collaborations/http://massively.joystiq.com/2012/11/26/city-of-steam-shows-player-collaborations/http://massively.joystiq.com/2012/11/26/city-of-steam-shows-player-collaborations/#commentsFiled under: , , , , , ,

City of Steam shows player collaborations
As part of its pre-launch fundraising efforts, Mechanist Games continues to offer players the chance to design their own in-game item for City of Steam if they kick in $500. It turns out at least four players have done so, and the devs whipped up a new blog post to show the journey from concept to completion for each of these items.

The items include a Darth Vader-style mask with cool steampunk goggles, a "Swiss Army Knife" of one-handed swords, a skull-adorned sword with an engine powering it, and a pair of sleek firearms.

Mechanist Games says that there are plenty of additional player items being designed and implemented. If you're thinking about making a mark on this upcoming game, you might want to move fast: donors will only have access to the design-an-item perk until December 5th.

If you're curious about City of Steam, check out Massively's recent hands-on with the title!

MassivelyCity of Steam shows player collaborations originally appeared on Massively on Mon, 26 Nov 2012 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betacity-of-steamdev-blogdev-diarydev-journalfantasyfundraisergeargoblinitemsmechanistmechanist-gamesplayer-created-itemsplayer-itemssci-fisteampunkweaponsMon, 26 Nov 2012 11:00:00 EST<![CDATA[The Stream Team: Pie is not a lie edition, November 26 - December 3, 2012]]>http://massively.joystiq.com/2012/11/26/the-stream-team-pie-is-not-a-lie-edition-november-26-decembe/http://massively.joystiq.com/2012/11/26/the-stream-team-pie-is-not-a-lie-edition-november-26-decembe/http://massively.joystiq.com/2012/11/26/the-stream-team-pie-is-not-a-lie-edition-november-26-decembe/#commentsFiled under: , , , ,

The Stream Team Pie is not a lie edition, November 26 December 3, 2012
Ahh, the big dinner is over... but not the leftovers. And even better, not the pies! MMmm pie. From the results of the poll, pie is the big winner for favorite Turkey Day food. Oh sure, it appears to have tied with stuffing, mashed potatoes, and -- my personal favorite -- the day-after sandwich, but once you take into account all the pie choices, the round confectionery delight definitely wins.

And pie is just like Massively TV! No, really -- think about it. One of the greatest things about Thanksgiving pies is that there are so many different ones to choose from. If you don't really fancy one kind (I am not a fan of traditional pumpkin), you can have something else. You can also try little bits of multiple pies to see what you like, or you can simply indulge in all the varieties! And The Stream Team offers a variety of games to sample vicariously, regardless your personal taste. Some streams even come with a dollop of dev commentary on top. You can choose to sample one or two here and there, or you can dive right in and gorge on all of them. So check out what's on this week's menu...

Continue reading The Stream Team: Pie is not a lie edition, November 26 - December 3, 2012

MassivelyThe Stream Team: Pie is not a lie edition, November 26 - December 3, 2012 originally appeared on Massively on Mon, 26 Nov 2012 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>age-of-wulinage-of-wushuaionallodsallods-onlineanetarenanetascensionasiaastrum-nivalback-to-betabetabiowarebrowserbrowser-basedcasualccpccp-gameschampionschampions-onlinechampschinachinesechinese-mmocity-of-steamcoconsoleconsolescrypticcryptic-studiosDayZdc-universedc-universe-onlinedcuoeaelectronic-artseq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfamily-Guy-Onlinefantasyfeaturedflashfpsfree-to-playfuncomgala-netglitchgoblingpotatoguild-wars-2gvggw2hi-rezhi-rez-studioshipsterhistoricalhorrorinternet-spaceshipsjet-likidnappinglivestreamlivestreaminglivestreamslucasartsmail-ru-gamesmail.ru-gamesmailru-gamesmartial-artsmassively-metamassively-tvmechanistmechanist-gamesmetaming-dynastymmo-shootermmofpsmobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftnew-englandparadoxparadox-interactiveperfect-worldperfect-world-entertainmentpermadeathplanetsideplanetside-2playstation-3playstation3pollps2ps3pvppwesalemsandboxsci-fantasysci-fisecret-worldshooterskill-basedSmitesnail-gamessnail-games-usasoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicsteampunkstreamstream-schedulestream-teamstreamersstreamingstreamteamsuperherosuperheroesswtortaikodomtanktankstelonthe-old-republicthe-secret-worldthe-stream-teamtinyspecktortruly-freetswtwitchtwitch-tvunlauncheningvanguardvanguard-saga-of-heroesvgwarwargaming.networld-of-tankswotwushuwuxiaMon, 26 Nov 2012 09:00:00 EST<![CDATA[Browser beauty: Hands-on with City of Steam]]>http://massively.joystiq.com/2012/11/16/browser-beauty-hands-on-with-city-of-steam/http://massively.joystiq.com/2012/11/16/browser-beauty-hands-on-with-city-of-steam/http://massively.joystiq.com/2012/11/16/browser-beauty-hands-on-with-city-of-steam/#commentsFiled under: , , , , , , , , ,

City of Steam
Browser games aren't supposed to be like this. Browser games are supposed to be Flash-based trifles and social "gaming" money printers. They're supposed to have simple graphics, shallow gameplay and zero narrative. Put simply, browser-based games are supposed to be bad.

City of Steam, a free-to-play, browser-based MMO developed by Mechanist Games, isn't content to live in this world of assumed browser-based inferiority. In fact, the game almost feels like a challenge to the industry: If this is what browsers can do, why isn't everyone doing it? City of Steam has the potential to shake the foundation of the MMO world by proving that full, engaging game experiences can be delivered instantly and on-demand, as long as its final execution lives up to its current promise.

From what's been revealed so far, Mechanist appears to be on the right track.

Continue reading Browser beauty: Hands-on with City of Steam

MassivelyBrowser beauty: Hands-on with City of Steam originally appeared on Massively on Fri, 16 Nov 2012 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabrowserbrowser-basedbrowser-gamecity-of-steamclosed-betaf2pfantasyfeaturedfree-to-playgoblinhands-onimpressionsmechanistmechanist-gamespreviewpreviewssci-fisteampunkFri, 16 Nov 2012 13:00:00 EST<![CDATA[City of Steam posts beta schedule]]>http://massively.joystiq.com/2012/10/26/city-of-steam-posts-beta-schedule/http://massively.joystiq.com/2012/10/26/city-of-steam-posts-beta-schedule/http://massively.joystiq.com/2012/10/26/city-of-steam-posts-beta-schedule/#commentsFiled under: , , , , ,

City of Steam posts beta schedule
The time is neigh to gear up and test the heck out of City of Steam! Mechanist Games' steampunk MMO is nearing its closed beta phase and has posted a schedule for testing through the remainder of the year.

The team breaks down the closed beta cycle into four "seasons": Springtide (November 16th to the 20th), Summercrest (November 30th to the December 4th), Autumnwane (December 14th to the 18th), and Winter Festival (December 23rd to the 28th).

For those of you looking for a way to guarantee a beta invite or would like to support the game, the devs also announced several beta collaborator packs to purchase. Each pack includes a beta key, name reservation, and other goodies. Mechanist Games is also posting a "Steam-o-Meter" that will trigger additional development on the game once certain support goals are met.

MassivelyCity of Steam posts beta schedule originally appeared on Massively on Fri, 26 Oct 2012 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabeta-collaborator-packsbeta-schedulecity-of-steamclosed-betaclosed-beta-schedulefantasygoblinmechanistmechanist-gamespromotionsci-fisteam-o-metersteampunkFri, 26 Oct 2012 15:00:00 EST<![CDATA[City of Steam reveals journey from turn-based to real-time combat]]>http://massively.joystiq.com/2012/10/17/city-of-steam-reveals-journey-from-turn-based-to-real-time-comba/http://massively.joystiq.com/2012/10/17/city-of-steam-reveals-journey-from-turn-based-to-real-time-comba/http://massively.joystiq.com/2012/10/17/city-of-steam-reveals-journey-from-turn-based-to-real-time-comba/#commentsFiled under: , , , , ,

City of Steam regales with journey from turnbased to realtime action
The saga of City of Steam's creation continues to grow more impressive with a new behind-the-scenes story. In it, the devs tell the little-known tale about how the game used to be turn-based. This was originally due to a very limited team and budget, although the devs further justified the decision by saying that the MMO was based on a turn-based pen-and-paper game anyway.

City of Steam managed to make the transition to real-time action with the help of some surprise financing prior to alpha. Over 90% of the code had to be reworked to make it happen, but the team pulled it off prior to the game's alpha and any actual players' eyes.

It might be easy for us to take for granted how studios can whip up real-time combat in MMOs, but this post illustrates how incredibly complicated it can be, especially for teams with limited resources.

City of Steam heads into beta next month.

MassivelyCity of Steam reveals journey from turn-based to real-time combat originally appeared on Massively on Wed, 17 Oct 2012 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>actionbehind-the-scenesbetacity-of-steamcombatdev-diarydev-journaldeveloper-diarydeveloper-journalfantasygoblinmechanistmechanist-gamesreal-timesci-fisteampunkturn-basedWed, 17 Oct 2012 16:00:00 EST<![CDATA[City of Steam tells the tale of Halyar's Retreat]]>http://massively.joystiq.com/2012/10/10/city-of-steam-tells-the-tale-of-haylars-retreat/http://massively.joystiq.com/2012/10/10/city-of-steam-tells-the-tale-of-haylars-retreat/http://massively.joystiq.com/2012/10/10/city-of-steam-tells-the-tale-of-haylars-retreat/#commentsFiled under: , , , , , ,

City of Steam tells the tale of Haylar's Retreat
While it won't be ready for next month's beta, the area of Halyar's Retreat is the focus of a new City of Steam developer diary today.

Halyar's Retreat is a middle-class suburb that gradually became the hangout for all sorts of illicit businessmen and gangs. The titular greenskin soldier consolidated power and control, keeping the peace while criminal activities continued. However, when he was killed, chaos erupted and this particular area of Nexus became a lot less safe for all living and visiting there.

The team said that it originally envisioned Halyar's Retreat as being gothic architecture on top of plateaus, but it never gelled with the layout of the city. Instead, the concept was re-worked into a slightly upscale industrial suburb.

MassivelyCity of Steam tells the tale of Halyar's Retreat originally appeared on Massively on Wed, 10 Oct 2012 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betacity-of-steamfantasygoblinhaylars-retreatloremechanistmechanist-gamespreviewsci-fisteampunksuburbzoneWed, 10 Oct 2012 10:00:00 EST<![CDATA[City of Steam promises November beta]]>http://massively.joystiq.com/2012/10/08/city-of-steam-promises-november-beta/http://massively.joystiq.com/2012/10/08/city-of-steam-promises-november-beta/http://massively.joystiq.com/2012/10/08/city-of-steam-promises-november-beta/#commentsFiled under: , , , , , ,

City of Steam promises November beta
Gear up and prepare to vent some pressure: City of Steam is gaining momentum for the beta! The developers announced that the steampunk MMO will be hitting the beta testing stage in November.

As if that weren't enough reason to rejoice, the stressed-out team threw together one of the funniest promotional videos that you may ever see. The Massively staff is undecided as to the best line. "Take THAT, Copernicus!" and "So many Goblin babies!" are tied for first. Check it out after the break and let us know your favorite.

Continue reading City of Steam promises November beta

MassivelyCity of Steam promises November beta originally appeared on Massively on Mon, 08 Oct 2012 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabeta-announcementbeta-testingcity-of-steamcopernicusfantasygoblinhumormechanistmechanist-gamespromotional-videopure-winsci-fiso-many-goblin-babiessteampunktake-that-copernicusteh-funniestestingvideoMon, 08 Oct 2012 13:00:00 EST<![CDATA[City of Steam dev blog talks pathfinding challenges]]>http://massively.joystiq.com/2012/10/02/city-of-steam-dev-blog-talks-pathfinding-challenges/http://massively.joystiq.com/2012/10/02/city-of-steam-dev-blog-talks-pathfinding-challenges/http://massively.joystiq.com/2012/10/02/city-of-steam-dev-blog-talks-pathfinding-challenges/#commentsFiled under: , , , , , , , , , ,

City of Steam dev blog talks pathfinding challenges
Did you wake up this morning and think, "Hmm, if there's one thing I'd like to know more about, it's pathfinding in City of Steam."

If so, you're in luck. If not, well, too bad, because you're reading this post, which is about City of Steam pathfinding. More specifically, the folks at Mechanist Games have released a new dev diary that dives deep into the nitty gritty of the steampunk title's optimization process. As it happens, the game's movement system relies on a grid to determine what is possible or impossible as a move. This makes it challenging to present a smooth WASD input option for the player. Head to the official CoS site to see how the devs are tackling the issue.

MassivelyCity of Steam dev blog talks pathfinding challenges originally appeared on Massively on Tue, 02 Oct 2012 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>city-of-steamcity-of-steam-pathfindingcollision-detectiondev-blogdev-diaryfantasygoblinmechanistmechanist-gamespathfindingsci-fisteampunkTue, 02 Oct 2012 18:00:00 EST<![CDATA[City of Steam offers players barrels of fun before beta]]>http://massively.joystiq.com/2012/09/29/city-of-steam-offers-players-barrels-of-fun-before-beta/http://massively.joystiq.com/2012/09/29/city-of-steam-offers-players-barrels-of-fun-before-beta/http://massively.joystiq.com/2012/09/29/city-of-steam-offers-players-barrels-of-fun-before-beta/#commentsFiled under: , , , , , ,

Barreling ever onward.
Primitive human beings didn't understand many things. They didn't understand quantum physics or literary theory or fine French cooking. But they did understand one important thing: Somewhere in the world, there were barrels and crates, and smashing those barrels and crates would yield items and riches. It's that primordial instinct that the development team behind City of Steam has tapped into, and with the devs' newest development blog about the joy of smashing barrels, they're inviting you to indulge it.

You see, aside from just talking about the game approaching its closed beta testing phase, this particular developer journal contains an old gem from early internal testing: a minigame built specifically to allow the team to test barrel destruction effects. And wouldn't you know that you can now play with that same tool yourself in your browser? Go ahead and read for updates on development, but stay to wipe out a room full of barrels with an exploding barrel.

MassivelyCity of Steam offers players barrels of fun before beta originally appeared on Massively on Sat, 29 Sep 2012 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>barrelsbrowserbrowser-gamecity-of-steamculturedeveloper-blogfantasygoblinhumorjokemechanistmechanist-gamesminigamesci-fisteampunkSat, 29 Sep 2012 20:00:00 EST<![CDATA[City of Steam closed beta coming in November]]>http://massively.joystiq.com/2012/09/06/city-of-steam-closed-beta-coming-in-november/http://massively.joystiq.com/2012/09/06/city-of-steam-closed-beta-coming-in-november/http://massively.joystiq.com/2012/09/06/city-of-steam-closed-beta-coming-in-november/#commentsFiled under: , , , , , , , ,

City of Steam closed beta coming in November
Mechanist Games has announced a closed beta date for its upcoming City of Steam title. Well, sort of. A new post on the game's website spends three paragraphs leading up to the word November, but it doesn't mention a specific day.

The post also mentions that the devs are combing through reams of alpha feedback from the recently completed testing phase, and it suggests that you keep an eye on the CoS forums and your inbox if you're itching to get into beta.

City of Steam is a free-to-play browser-based MMO based on a series of steampunk-flavored RPG books.

MassivelyCity of Steam closed beta coming in November originally appeared on Massively on Thu, 06 Sep 2012 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betacity-of-steamcity-of-steam-betaclosed-betafantasygoblinmechanistmechanist-gamessci-fisteampunkThu, 06 Sep 2012 10:00:00 EST