Massively http://massively.joystiq.com Massively http://www.blogsmithmedia.com/www.joystiq.com/media/feedlogo.gif Massively http://massively.joystiq.com en-us Copyright 2013 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[Not So Massively: Cash MOBA tournaments, Diablo III's birthday, and Star Citizen's new website]]>http://massively.joystiq.com/2013/05/20/not-so-massively-cash-moba-tournaments-diablo-iiis-birthday/http://massively.joystiq.com/2013/05/20/not-so-massively-cash-moba-tournaments-diablo-iiis-birthday/http://massively.joystiq.com/2013/05/20/not-so-massively-cash-moba-tournaments-diablo-iiis-birthday/#commentsFiled under: , , , , , , , , , , , , , , , , , , , , , , ,

Not So Massively Cash MOBA tournaments, Diablo III's birthday, and Star Citizen's new website
Dota 2 celebrated the incredible sales of its world championship interactive compendium with free gifts for all players; the compendium has now sold over 266,000 units, raising the prize fund in The International to over $2,000,000 US. Third-person MOBA SMITE has recently entered the competitive tournament scene with two new weekly $1,000 tournaments. Rise of Immortals also announced its first competitive tournament since the Battle For Graxia update and revealed details of its hilariously-named ranged centaur character Murderhoof.

League of Legends revealed the new custom item set feature coming in Patch 3.7 and published a new champion spotlight video on classic ranged carry Ashe. Guardians of Middle-Earth also released its latest paid DLC character, The Mouth of Sauron, based on a character who was originally cut from the cinematic release of The Lord of the Rings: The Return of the King.

Diablo III celebrated the first anniversary of its release on May 15th with anniversary livestreams and a magic-find bonus for all players. The latest patch also raised the increments in which money can be sold on the Real Money Auction House to ten million in response to massive oversupply. Path of Exile revealed details of its upcoming Patch 0.1.1.0 that will add new party loot options and other features, and Star Citizen showed off its new website with a special e-commerce section in which players can buy ships for cash.

Continue reading Not So Massively: Cash MOBA tournaments, Diablo III's birthday, and Star Citizen's new website

MassivelyNot So Massively: Cash MOBA tournaments, Diablo III's birthday, and Star Citizen's new website originally appeared on Massively on Mon, 20 May 2013 21:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments

    ]]>    action-mmoaction-rpganniversaryanniversary-eventashebattle-for-graxiabattlenetbirthdayblizzardblizzard-entertainmentCompendiumcompetitive-gamingconsolecustom-item-setCustom-Item-Setsd3dawngatediablodiablo-2diablo-3diablo-iidiablo-iiidotadota-2e-sporte-sportsesportesportsf2pfantasyfeaturedfree-to-playgaslightgodgodsgothic-fantasygraxiagrinding-geargrinding-gear-gamesguardians-of-middle-earthinfinite-crisisInteractive-Compendiumisisjokerleague-of-legendslollord-of-the-ringslotrmiddle-earthmobamonolithmonolith-studiosmouth-of-sauronmultiplayermurderhoofnewsnot-so-massivelynsmone-yearone-year-anniversaryonline-multiplayeropinionpath-of-exilepetroglyphpetroglyph-gamesplaystation-networkpoeps3psnpvpriotriot-gamesrise-of-immortalsroiround-uprounduprpgskarasmitethe-jokerthe-mouth-of-sauronthird-personvalvevideovideoswarner-brosxboxxbox-360xbox-livexbox360Mon, 20 May 2013 21:00:00 EST    <![CDATA[EVE Mobile is coming according to Jon Lander]]>http://massively.joystiq.com/2013/05/20/eve-mobile-is-coming-according-to-jon-lander/http://massively.joystiq.com/2013/05/20/eve-mobile-is-coming-according-to-jon-lander/http://massively.joystiq.com/2013/05/20/eve-mobile-is-coming-according-to-jon-lander/#commentsFiled under: , , , , , , ,

    Now you can stand next to someone, blow up their ship on your phone, then punch them.
    If you've ever been involved in a discussion about EVE Online, you've heard it referred to as a sequence of spreadsheets which occasionally let you fly a spaceship. Which certainly has some basis in truth. Certainly it's a game with many possible systems that could be ported to a mobile client, something that CCP's Jon Lander is claiming will be a reality in the near future. Lander has moved from being EVE's executive producer to mobile development, but his new position is clearly still tied to the same game.

    Rather than simply being a series of spreadsheets for your smartphone, Lander has made it clear that the mobile team wants for the various EVE mobile apps to be functional games in their own right. It's a field that CCP has explored before, stopping either due to technical hurdles or business concerns. But Lander's confident that players will be using the mobile applications by the time next year's Fanfest rolls around.

    MassivelyEVE Mobile is coming according to Jon Lander originally appeared on Massively on Mon, 20 May 2013 20:30:00 EST. Please see our terms for use of feeds.

    Permalink | Email this | Comments

    ]]>    ccpccp-gameseveeve-mobileeve-onlineinternet-spaceshipsjon-landermobilemobile-developmentsandboxsci-fispreadsheets-onlineMon, 20 May 2013 20:30:00 EST    <![CDATA[Cloud Imperium unveils Star Citizen hangar module]]>http://massively.joystiq.com/2013/05/20/cloud-imperium-unveils-star-citizen-hangar-module/http://massively.joystiq.com/2013/05/20/cloud-imperium-unveils-star-citizen-hangar-module/http://massively.joystiq.com/2013/05/20/cloud-imperium-unveils-star-citizen-hangar-module/#commentsFiled under: , , , , , , , ,

    Star Citizen - Hangar module with Hornet
    Cloud Imperium has taken the wraps off Star Citizen's hangar module, a standalone app that's scheduled to be released to early adopters later this summer. Pledgers will get a chance to walk through their hangars and ogle their pledge ships, as well as climb inside them and invite their friends over for a spaceship-themed soiree.

    The hangar module is "about 50 percent fleshed out right now," according to the spiffy Cloud Imperium video tour that you can watch after the cut.

    [Thanks Eric!]

    Continue reading Cloud Imperium unveils Star Citizen hangar module

    MassivelyCloud Imperium unveils Star Citizen hangar module originally appeared on Massively on Mon, 20 May 2013 20:00:00 EST. Please see our terms for use of feeds.

    Permalink | Email this | Comments

    ]]>    chris-robertscloud-imperiumcloud-imperium-gamescrowdfundingcry-enginecryenginehangarhangar-moduleinternet-spaceshipskickstartersandboxsci-fispaceshipstar-citizenstar-citizen-hangarvideozomg-do-wantMon, 20 May 2013 20:00:00 EST    <![CDATA[Gloria Victis pre-alpha screens show forest updates]]>http://massively.joystiq.com/2013/05/20/gloria-victis-pre-alpha-screens-show-forest-updates/http://massively.joystiq.com/2013/05/20/gloria-victis-pre-alpha-screens-show-forest-updates/http://massively.joystiq.com/2013/05/20/gloria-victis-pre-alpha-screens-show-forest-updates/#commentsFiled under: , , , ,

    Gloria Victis pre-alpha screens show forest updates
    Black Eye Games updated its Gloria Victis Facebook page over the weekend. The occasion was a pre-alpha feature push that saw plenty of new stuff make its way into the fledgling sandbox.

    "The forest is now filled with life," the post says, including boars, foxes, wolves, and plenty of raw gatherables like bark, timber, hops, flax, and sunflowers. Black Eye has also enlarged the game world proper and added humanoid mobs. There are screens of all this stuff and more behind the links below. You'll also find some Massively-exclusive screens behind the break.

    [Thanks to everyone who tipped us!]

    Continue reading Gloria Victis pre-alpha screens show forest updates

    MassivelyGloria Victis pre-alpha screens show forest updates originally appeared on Massively on Mon, 20 May 2013 19:00:00 EST. Please see our terms for use of feeds.

    Permalink | Email this | Comments

    ]]>    black-eyeblack-eye-gamesfantasygloria-victisgloria-victis-alphapre-alphasandboxMon, 20 May 2013 19:00:00 EST    <![CDATA[Guild Wars 2 prepares for Southsun showdown]]>http://massively.joystiq.com/2013/05/20/guild-wars-2-prepares-for-southsun-showdown/http://massively.joystiq.com/2013/05/20/guild-wars-2-prepares-for-southsun-showdown/http://massively.joystiq.com/2013/05/20/guild-wars-2-prepares-for-southsun-showdown/#commentsFiled under: , , , ,

    Guild Wars 2 prepares for Southsun showdown
    The big baddie of Guild Wars 2's recent living story has been called out. He's Canach, a renegade who thinks that that the answer to every urban planning problem is "more monsters." The Sylvari is behind a plot to use the creatures of Southsun to free settlers from the grasp of the Consortium.

    A showdown with Canach is set to happen when the next chapter of the game's living story rolls out on May 28. The update, titled Last Stand at Southsun, will contain a solo dungeon where players will go mano-a-planto with Canach. ArenaNet says that those who defeat Canach will then open up new group content to tackle.

    Other changes on deck include a zone-stomping monster and plenty of changes to world-vs.-world content. Southsun living story events, achievements, and rewards will be available until June 11th.

    MassivelyGuild Wars 2 prepares for Southsun showdown originally appeared on Massively on Mon, 20 May 2013 18:00:00 EST. Please see our terms for use of feeds.

    Permalink | Email this | Comments

    ]]>    anetarenanetbuy-to-playcanacheventfantasyguild-wars-2gw2in-game-eventlast-stand-at-southsunliving-storyncsoftsouthsunsouthsun-coveworld-vs-worldwvwMon, 20 May 2013 18:00:00 EST    <![CDATA[It's a ship in a box in Star Trek Online]]>http://massively.joystiq.com/2013/05/20/its-a-ship-in-a-box-in-star-trek-online/http://massively.joystiq.com/2013/05/20/its-a-ship-in-a-box-in-star-trek-online/http://massively.joystiq.com/2013/05/20/its-a-ship-in-a-box-in-star-trek-online/#commentsFiled under: , , , , ,

    Astute observers will note the similarity to the Scimitar.
    Just because you're playing a Romulan in Star Trek Online's first expansion doesn't mean every other Romulan is your friend. Empress Sela's Tal Shiar are a huge threat not just to the nascent Romulan Republic but to all sentient life throughout the galaxy, epitomized with their insectoid ships that fuse Romulan, Borg, and Elachi technology together. Needless to say, these ships are never good to see on the horizon. Unless you happen to open one in a lockbox, anyhow.

    Yes, the newest lockbox in the game will give players a chance to earn the strange ships of the Tal Shiar, giving all captains a chance to fly some of the strangest ships yet seen in the game. The ships perform similarly to Romulan crafts with their built-in cloaks, but they exchange some of the active Romulan cloaking power for tactical weapons like Shrapnel Torpedoes. For more details on what awaits in the upcoming lockboxes, take a look at the full rundown of potential prizes.

    MassivelyIt's a ship in a box in Star Trek Online originally appeared on Massively on Mon, 20 May 2013 17:30:00 EST. Please see our terms for use of feeds.

    Permalink | Email this | Comments

    ]]>    crypticcryptic-studiosexpansionf2pfree-to-playlegacy-of-romuluslockboxnew-lockboxnew-shipsperfect-worldperfect-world-entertainmentpweremusromulussci-fishipsstar-trekstar-trek-mmostar-trek-onlinestoMon, 20 May 2013 17:30:00 EST    <![CDATA[Elder Scrolls Online elaborates on crafting and exploration]]>http://massively.joystiq.com/2013/05/20/elder-scrolls-online-elaborates-on-crafting-and-exploration/http://massively.joystiq.com/2013/05/20/elder-scrolls-online-elaborates-on-crafting-and-exploration/http://massively.joystiq.com/2013/05/20/elder-scrolls-online-elaborates-on-crafting-and-exploration/#commentsFiled under: , , , , ,

    Elder Scrolls Online answers crafting and exploration queries
    ZeniMax scooped up all of the questions that fans had after seeing The Elder Scrolls Online's crafting and exploration video, and answered several of the most pressing of them in a new post.

    TESO will feature five crafting professions: weaponsmith, armorsmith, enchanter, alchemist, and provisioner. Of these, players are able to train in two fields so that a robust economy will develop between crafters. While there aren't any recipes in the game, players have multiple avenues to combine ingredients and make the same item. The studio indicated that those who have played previous Elder Scrolls games might have an advantage in knowing familiar plants and crafting ingredients and how they interact.

    Other topics in the AMA include fishing lures, how big your library can get (there's no limit, basically), the use of Mundus Stones, and the difficulty of lockpicking. "Your lockpicking will automatically improve as you level, gradually making chests that were once very difficult to open a much easier prospect. Though your lockpicking skill will increase as you level, the chests you encounter in higher level areas will also be more difficult," ZeniMax explained.

    MassivelyElder Scrolls Online elaborates on crafting and exploration originally appeared on Massively on Mon, 20 May 2013 17:00:00 EST. Please see our terms for use of feeds.

    Permalink | Email this | Comments

    ]]>    amaask-me-anythingask-us-anythingbethesdabethesda-softworksbethsoftcommunity-q-and-acraftingdaggerfallelder-scrollselder-scrolls-onlineesoexplorationfactionsfishinglockpickingmorrowindoblivionpvpq-and-arvrsandboxskyrimtamrieltestesothe-elder-scrollsthe-elder-scrolls-onlinethree-faction-pvpthree-way-pvpzenimaxzenimax-mediazenimax-onlinezenimax-online-studiosMon, 20 May 2013 17:00:00 EST    <![CDATA[Leaderboard: Which upcoming fantasy MMO are you looking forward to the most?]]>http://massively.joystiq.com/2013/05/20/leaderboard-which-upcoming-fantasy-mmo-are-you-looking-forward/http://massively.joystiq.com/2013/05/20/leaderboard-which-upcoming-fantasy-mmo-are-you-looking-forward/http://massively.joystiq.com/2013/05/20/leaderboard-which-upcoming-fantasy-mmo-are-you-looking-forward/#commentsFiled under: , , ,

    Leaderboard Which upcoming fantasy MMO are you looking forward to the most
    Since last week's Leaderboard went over so well, I figured, why not put up another semi-controversial poll in the hopes that fans of the choices I inadvertently leave off will pepper my inbox with hate mail? Snarkiness aside, I am curious to see the results of today's vote, which pits the big three fantasy MMOs releasing over the next year against one another in a grueling duel to the death.

    The prize? The coveted title of Most Anticipated 2013/14 Fantasy MMO in the Massively Comments Section, which is going to be really hard to cram onto the trophy. In any case, vote for your favorite after the break.

    Ever wish that you could put to rest a long-standing MMO debate once and for all? Then welcome to the battle royal of Massively's Leaderboard, where two sides enter the pit o' judgment -- and only one leaves. Vote to make your opinion known, and see whether your choice tops the Leaderboard!

    Continue reading Leaderboard: Which upcoming fantasy MMO are you looking forward to the most?

    MassivelyLeaderboard: Which upcoming fantasy MMO are you looking forward to the most? originally appeared on Massively on Mon, 20 May 2013 16:00:00 EST. Please see our terms for use of feeds.

    Permalink | Email this | Comments

      ]]>      battle-royalleaderboardmost-anticipated-mmoone-on-oneone-vs-oneopinionpollpollsversusvotevotesvotingvsMon, 20 May 2013 16:00:00 EST      <![CDATA[Chaos Theory: Opinions, facts, and open flames]]>http://massively.joystiq.com/2013/05/20/chaos-theory-opinions-facts-and-open-flames/http://massively.joystiq.com/2013/05/20/chaos-theory-opinions-facts-and-open-flames/http://massively.joystiq.com/2013/05/20/chaos-theory-opinions-facts-and-open-flames/#commentsFiled under: , , , , , , ,

      Chaos Theory Opinions, facts, and open flames
      It's not often that my writings take a ranty slant, In fact, I don't believe I have ever expressed anything along those lines here in Chaos Theory -- although I have a time or two elsewhere. Blue moons come and go much more frequently than I don my Massively-standard-issue flame-retardant garb and venture forth. But right here, right now looks to be one of those times, and I'm already suiting up. So what about The Secret World has me riled up enough to flex my woefully underused ranting muscle?

      Nothing.

      Seriously, I can't call to mind a single thing in the game deserving of a rant. Sure, TSW isn't perfect; there are flaws and there are things that could use improving, things that are certainly worth discussing. But rant-inducing? Nope. Too bad the same can't be said for people.

      It doesn't matter how many times I've witnessed it: It never ceases to amaze me when folks trumpet their own opinions as fact while insisting dissenting opinions can't possibly exist. It's like they board the crazy train where the lines between opinion and fact are swirled together like coffee and creamer, where reality and logic are tossed right out the window. So as a public service, I'm going to derail that train.

      Continue reading Chaos Theory: Opinions, facts, and open flames

      MassivelyChaos Theory: Opinions, facts, and open flames originally appeared on Massively on Mon, 20 May 2013 15:00:00 EST. Please see our terms for use of feeds.

      Permalink | Email this | Comments

        ]]>        3-faction3-factionsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragonendgamefactionfaction-pvpfantasyfeaturedfuncomhorrorilluminatimythologyopinionopinion-vs-factopinionsrantrantssci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonwho-cares-about-endgameMon, 20 May 2013 15:00:00 EST        <![CDATA[Rhode Island selling 38 Studios' game assets]]>http://massively.joystiq.com/2013/05/20/rhode-island-selling-38-studios-game-assets/http://massively.joystiq.com/2013/05/20/rhode-island-selling-38-studios-game-assets/http://massively.joystiq.com/2013/05/20/rhode-island-selling-38-studios-game-assets/#commentsFiled under: , ,

        Rhode Island selling 38 Studios' IP
        Do you have a few million on you and a desire to preserve some gaming history? Then pick up the phone and call Rhode Island, as the state is getting ready to sell 38 Studios' assets, including its games.

        The state is looking to recoup some of it $130 million debt that it fell into once 38 Studios went belly-up. One of Rhode Island's lawyers says there "is interest" in the studio's assets, including concept art, design documents, and computer software. The sale of 38 Studios' IP includes the Amalur franchise, which encompassed the Project Copernicus MMO.

        The state is also set to begin a lawsuit this week against former 38 Studios execs, including founder Curt Schilling. The suit claims that the executives did not inform the state when they knew that the studio would have a hard time keeping afloat financially. Schilling has asked the judge to dismiss the suit.

        MassivelyRhode Island selling 38 Studios' game assets originally appeared on Massively on Mon, 20 May 2013 14:00:00 EST. Please see our terms for use of feeds.

        Permalink | Email this | Comments

        ]]>        38-studiosamaluramalur-mmo-industryassetsconcept-artcurt-schillinggame-assetsipip-assetskingdoms-of-amalur-reckoninglawsuitproject-copernicusrhode-islandriedcsaleMon, 20 May 2013 14:00:00 EST        <![CDATA[Captain's Log: What to expect in Star Trek Online's Legacy of Romulus expansion]]>http://massively.joystiq.com/2013/05/20/captains-log-stos-legacy-of-romulus-expansion-launches-tomorr/http://massively.joystiq.com/2013/05/20/captains-log-stos-legacy-of-romulus-expansion-launches-tomorr/http://massively.joystiq.com/2013/05/20/captains-log-stos-legacy-of-romulus-expansion-launches-tomorr/#commentsFiled under: , , , , , , , ,

        STO Haakona warbird header
        It's a little strange to think that it's already been three months since the developers at Star Trek Online first teased us with the Legacy of Romulus expansion with the March Beneath the Raptor's Wings kicker at the end of the anniversary video. Even then there were many of us who sincerely doubted the teaser meant we would finally be able to play a Romulan character, let alone that the Klingon faction would be filled-out.

        Yet here we are, on the eve of the release of Star Trek Online's first expansion and a flood of new material. Beware, I will be writing spoilers about the new content, but if you're not worried about that, feel free to join me as I touch on most of what we're going to see!

        Continue reading Captain's Log: What to expect in Star Trek Online's Legacy of Romulus expansion

        MassivelyCaptain's Log: What to expect in Star Trek Online's Legacy of Romulus expansion originally appeared on Massively on Mon, 20 May 2013 13:00:00 EST. Please see our terms for use of feeds.

        Permalink | Email this | Comments

          ]]>          bird of preyBirdOfPreycaptains-logcrypticcryptic-studiosexpansionf2pfeaturedfederationfree-to-playklingonklingon defense forceklingonslegacy of romulusopinionparadise cityperfect-worldperfect-world-entertainmentplanet of galactic peacepreviewpreviewspweromulanRomulanssci-fishipsstar-trekstar-trek-mmostar-trek-onlinestowarbirdMon, 20 May 2013 13:00:00 EST          <![CDATA[Aion helps player pop the question]]>http://massively.joystiq.com/2013/05/20/aion-helps-player-pop-the-question/http://massively.joystiq.com/2013/05/20/aion-helps-player-pop-the-question/http://massively.joystiq.com/2013/05/20/aion-helps-player-pop-the-question/#commentsFiled under: , , , ,

          Aion helps player pop the question
          Who says devs only want to beat us with a nerf bat? When a long-time Aion player decided he wanted to ask the most important question of his life using the game he and his beloved shared countless hours in over the years, devs jumped to his aid.

          To help make the experience memorable, Aion's devs provided a backdrop of cakes and musicians in Sanctum Square on the Israphel server where both resided. Then as the hopeful groom-to-be dropped to his knee in game, the heartfelt words he recited to her in real life also flashed across the game screen for all to see. When she gave her answer, the sky exploded in fireworks and everyone saw the message, "She said YES!!!"

          Congratulations to the happy couple, Jambo and Trishann! We're sure that's a proposal that will not be forgotten. And kudos to NCsoft for having the heart to be a part of one of the greatest moments in its players' lives. You can see more images of the event below.

          Gallery: Aion wedding proposal

          MassivelyAion helps player pop the question originally appeared on Massively on Mon, 20 May 2013 12:00:00 EST. Please see our terms for use of feeds.

          Permalink | Email this | Comments

            ]]>            aionascensionf2pfantasyfree-to-playncsoftproposaltruly-freeMon, 20 May 2013 12:00:00 EST            <![CDATA[The Nexus Telegraph: Still moving in WildStar]]>http://massively.joystiq.com/2013/05/20/the-nexus-telegraph-still-moving-in-wildstar/http://massively.joystiq.com/2013/05/20/the-nexus-telegraph-still-moving-in-wildstar/http://massively.joystiq.com/2013/05/20/the-nexus-telegraph-still-moving-in-wildstar/#commentsFiled under: , , , , ,

            Or just stand there and let it reach you, that's cool too.
            The downside to writing about WildStar in this stage of the game's lifecycle is that because of the very nature of beta tests, I'm going to be spending a lot of time speculating instead of talking about certainties. Last week, I speculated. I was wrong on some points, as I found out when I got a letter from Carbine clarifying some things that had previously been ambiguous enough for speculation.

            The upside to writing about WildStar in this stage of the game's lifecycle is that sometimes I get letters from development staff letting me in on valuable inside information.

            Aside from being able to clarify my previous incorrect speculation, I also have for you a number of other important bits of information regarding the game this week, including a brief discussion of whether or not the game will allow for flight on a regular basis. So since that's well worth discussing, let's go ahead and just make this column another dialogue about movement.

            Continue reading The Nexus Telegraph: Still moving in WildStar

            MassivelyThe Nexus Telegraph: Still moving in WildStar originally appeared on Massively on Mon, 20 May 2013 11:00:00 EST. Please see our terms for use of feeds.

            Permalink | Email this | Comments

              ]]>              areascarbinecarbine-studiosclimatecolumnfeaturedflightflyingflying-mountsloremovementncsoftnexusnexus-telegraphopinionregionssandparksci-fantasysci-fithe-nexus-telegraphtransportwildstarzonesMon, 20 May 2013 11:00:00 EST              <![CDATA[Obsidian and Allods team up to create Skyforge]]>http://massively.joystiq.com/2013/05/20/obsidian-and-allods-team-up-to-create-skyforge/http://massively.joystiq.com/2013/05/20/obsidian-and-allods-team-up-to-create-skyforge/http://massively.joystiq.com/2013/05/20/obsidian-and-allods-team-up-to-create-skyforge/#commentsFiled under: , ,

              Obsidian and Allods team up to create Skyforge
              If you've ever been curious about what would happen if you mixed the Allods Online team with Obsidian Entertainment, wonder no more! The two forces announced their partnership at the Russian Game Developers Convention where they unveiled their upcoming MMORPG, Skyforge. The game is planned to release for the PC in 2014.

              More details are available from the devs themselves in the video after the break, if you speak Russian. For those who don't, you can catch a few snippits of game video between the interviews and a stretch coming just before the seven minute mark.

              Continue reading Obsidian and Allods team up to create Skyforge

              MassivelyObsidian and Allods team up to create Skyforge originally appeared on Massively on Mon, 20 May 2013 10:00:00 EST. Please see our terms for use of feeds.

              Permalink | Email this | Comments

              ]]>              allodsallods-onlineastrum-nivalf2pfantasyfree-to-playgala-netgpotatomail-ru-gamesmail.ru-gamesmailru-gamesObsidianObsidian-EntertainmentSkyforgeMon, 20 May 2013 10:00:00 EST              <![CDATA[The Stream Team: Monocle Day edition, May 20 - 26, 2013]]>http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/http://massively.joystiq.com/2013/05/20/the-stream-team-monocle-day-edition-may-20-26-2013/#commentsFiled under: , , ,

              The Stream Team Monocle day edition, May 20 26, 2013
              Two weeks ago, y'all had the chance to select a new holiday to help add some cheer to the otherwise bland weeks in the middle of May. The choices teased and tantalized you, but you're a discriminating crowd. In a race fraught with nail-biting suspense, only one ultimately prevailed. And so it is with further ado we bring to you: Monocle Day!

              This Tuesday, May 21st, has been selected to be the auspicious day of this most storied celebration. Why? Because 5/21 splits into 5 + 2 + 1, which of course = 8, and we all know that 8 is just two monocles stacked on top of each other! And as always, Massively TV is here to help you ring in the new holiday, with special shows throughout the entire week. Check out the full schedule of celebratory events hosted by The Stream Team after the break. Then let us know if you'll be wearing your own monocle in honor of the festivities.

              Continue reading The Stream Team: Monocle Day edition, May 20 - 26, 2013

              MassivelyThe Stream Team: Monocle Day edition, May 20 - 26, 2013 originally appeared on Massively on Mon, 20 May 2013 09:00:00 EST. Please see our terms for use of feeds.

              Permalink | Email this | Comments

                ]]>                Achaeaaction-mmoactivisionagonanetAnno-Onlinearenanetaventurinebiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamescity-of-steamconsoleconsolescrypticcryptic-studiosdarkfalldarkfall-unholy-warsdc-universedc-universe-onlinedcuodfdndDotA-2dragonDragonrealmsdragonsdragons-propheteaelectronic-artselswordeq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfactionfantasyfeaturedfrfree-realmsfree-to-playfuncomgoblinguild-warsgwhi-rezhi-rez-studioshistoricalhorrorhousinginfernuminfernum-productionsinternet-spaceshipskid-friendlykidskids-mmolivestreamlivestreaminglivestreamslucasartsmassively-metamassively-tvmechanistmechanist-gamesmetamobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftneverwinteropen-pvpperfect-worldperfect-world-entertainmentplaneplanesplaystation-3playstation3pollps3pvppwerunewakerrunewaker-entertainmentsandboxsci-fantasysci-fisecret-worldskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicsteampunkstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlesssuperherosuperheroesswtorthe-old-republicthe-secret-worldthe-stream-teamthreshold-rpgtortswtwitchtwitch-tvunholy-warswarwarcraftwargaming.netwarplanewarplanesworld-of-warcraftworld-of-warplaneswowwowpMon, 20 May 2013 09:00:00 EST                <![CDATA[The Daily Grind: When are rollbacks and wipes absolutely necessary?]]>http://massively.joystiq.com/2013/05/20/the-daily-grind-when-are-rollbacks-absolutely-necessary/http://massively.joystiq.com/2013/05/20/the-daily-grind-when-are-rollbacks-absolutely-necessary/http://massively.joystiq.com/2013/05/20/the-daily-grind-when-are-rollbacks-absolutely-necessary/#commentsFiled under: , , , , , , , , , , , , ,

                When are rollbacks absolutely necessary
                In the last few weeks, two big games we cover on Massively have been slammed with exploits that have injured their respective economies: Diablo III and Neverwinter. In Diablo III's case, a gold duping bug apparently pumped insane amounts of cash into the economy. Neverwinter's exploits run the gamut from Foundry abuses to negative auction hall bids that don't consume gold to classes that can one-shot bosses making farming trivial. According to these claims, NW exploiters are making off with thousands of real-life dollars when cashing out their ill-gotten funds.

                In both cases, players called for characters wipes and rollbacks, believing each exploit severe enough to merit a clean slate. But in Diablo III's case, while the studio dealt harshly with the exploiters, the developers disagreed with the need for wipes and do-overs, presumably having concluded that such drastic measures would impact the legit playerbase far more than would a dented economy. Neverwinter, on the other hand, chose to roll back the servers, causing widespread uproar.

                That brings us to today's question: Which studio was right? How bad does an exploit have to be before character wipes and server rollbacks are absolutely necessary?

                Every morning, the Massively bloggers probe the minds of their readers with deep, thought-provoking questions about that most serious of topics: massively online gaming. We crave your opinions, so grab your caffeinated beverage of choice and chime in on today's Daily Grind!

                MassivelyThe Daily Grind: When are rollbacks and wipes absolutely necessary? originally appeared on Massively on Mon, 20 May 2013 08:00:00 EST. Please see our terms for use of feeds.

                Permalink | Email this | Comments

                  ]]>                  Blizzardbrianna-royce-tdgcharacter-wipecryptic-studiosdaily-grinddiablo-3diablo-iiieconomyexploitexploitsneverwinteropinionperfect-world-entertainmentpwerollbackrollbacksserver-wipetdgthe-daily-grindwipewipesMon, 20 May 2013 08:00:00 EST                  <![CDATA[Neverwinter returns with seven-hour rollback after exploit]]>http://massively.joystiq.com/2013/05/20/neverwinter-returns-with-seven-hour-rollback-after-exploit/http://massively.joystiq.com/2013/05/20/neverwinter-returns-with-seven-hour-rollback-after-exploit/http://massively.joystiq.com/2013/05/20/neverwinter-returns-with-seven-hour-rollback-after-exploit/#commentsFiled under: , , , ,

                  Neverwinter returns with sevenhour rollback after exploit
                  Over the weekend, a massive exploit plagued Perfect World Entertainment's Neverwinter beta as players discovered a way to make billions off of the auction house and Astral Diamond Exchange.

                  After initially closing the economy to explore the company's options, PWE decided to do a seven-hour rollback of the servers that affects the progress made between 8:20 a.m. EDT (5:20 a.m. PDT) and 3:20 p.m. EDT (12:20 p.m. PDT) yesterday for all players.

                  "Rest assured, the issue has been corrected and we have taken appropriate action against all players who took advantage of the bug, including but not limited to enforcing permanent bans," the announcement reads.

                  [Thanks to everyone who sent this one in!]

                  MassivelyNeverwinter returns with seven-hour rollback after exploit originally appeared on Massively on Mon, 20 May 2013 07:00:00 EST. Please see our terms for use of feeds.

                  Permalink | Email this | Comments

                  ]]>                  action-mmocrypticcryptic-studiosdndexploitsf2pfantasyfree-to-playneverwinterperfect-worldperfect-world-entertainmentpwerollbackMon, 20 May 2013 07:00:00 EST                  <![CDATA[MMO Week in Review: Trion's tribulations and DUST's launch]]>http://massively.joystiq.com/2013/05/19/mmo-week-in-review-trions-tribulations-and-dusts-launch/http://massively.joystiq.com/2013/05/19/mmo-week-in-review-trions-tribulations-and-dusts-launch/http://massively.joystiq.com/2013/05/19/mmo-week-in-review-trions-tribulations-and-dusts-launch/#commentsFiled under: , ,

                  RIFT
                  At the end of every week, we round up the best and most popular news stories, exclusive features, and insightful columns published on Massively and then present them all in one convenient place. If you missed a big MMO or WoW Insider story last week, you've come to the right post.

                  This week, Trion Worlds' announcement that RIFT will transition to a free-to-play MMO in less than a month was tempered by news that the studio was forced to lay off a large portion of its staff, though the RIFT team itself was unaffected. Meanwhile, CCP's console shooter DUST 514 officially launched; Massively's Jef Reahard delivered tepid impressions of the game.

                  Read on for a look at the rest of this week's top MMO stories.

                  Continue reading MMO Week in Review: Trion's tribulations and DUST's launch

                  MassivelyMMO Week in Review: Trion's tribulations and DUST's launch originally appeared on Massively on Sun, 19 May 2013 20:00:00 EST. Please see our terms for use of feeds.

                  Permalink | Email this | Comments

                    ]]>                    featuredjoystiqmassively-metametarounduptop-storiesweek-in-reviewweekly-recapweekly-roundupwow-insiderSun, 19 May 2013 20:00:00 EST                    <![CDATA[EVE Evolved: Fanfest 2013 video roundup]]>http://massively.joystiq.com/2013/05/19/eve-evolved-fanfest-2013-video-roundup/http://massively.joystiq.com/2013/05/19/eve-evolved-fanfest-2013-video-roundup/http://massively.joystiq.com/2013/05/19/eve-evolved-fanfest-2013-video-roundup/#commentsFiled under: , , , , , , , , , , , , , , , , , , , , ,

                    EVE Evolved Fanfest 2013 video roundup
                    Last month saw the huge tenth anniversary EVE Online Fanfest, a three-day convention packed full of exclusive reveals, behind-the-scenes talks, and community events. This year's Fanfest was the biggest one yet, celebrating EVE's tenth anniversary with special guest speakers from the scientific community, the reveal of a new virtual reality dogfighter, DUST 514's launch, and details of the upcoming Odyssey expansion. Massively was there to bring you coverage of the big news as it happened, and CCP streamed some of the key talks and events live to viewers at home.

                    This year's Fanfest sold out so quickly that many people who wanted to go didn't get a chance to, and only a select few talks were shown on the public livestream. With such a packed event schedule, even players in attendance couldn't be there for every interesting talk. Thankfully, CCP recorded over 30 of the most anticipated events and has now uploaded the videos to YouTube. Highlights include the Make EVE Real videos, the EVE keynote, the CCP Presents Keynote, and the talks on how DUST 514 integrates with the EVE economy.

                    In this week's EVE Evolved, I round up all of the EVE Fanfest videos in a handy list.

                    Continue reading EVE Evolved: Fanfest 2013 video roundup

                    MassivelyEVE Evolved: Fanfest 2013 video roundup originally appeared on Massively on Sun, 19 May 2013 18:00:00 EST. Please see our terms for use of feeds.

                    Permalink | Email this | Comments

                      ]]>                      alliance-panelapocalypseasteroidasteroid-miningasteroidsbattleshipccpccp-gameschinaconcept-artconsoleconventioncrimewatchcsm-paneldustdust-514economyeveeve-evolvedeve-fanfesteve-fanfest-2013eve-is-realeve-onlineeventeventsfanfestfaster-than-lightfeaturedfpsftlgame-designgearinternet-spaceshipskeynotemake-eve-realminingmmofpsodysseyopinionplanetary-conquestplaystationplaystation-3progressionps3pvpsandboxsci-fishooterspace-elevatorspreadsheets-onlineuprisingSun, 19 May 2013 18:00:00 EST                      <![CDATA[Stick and Rudder: Why all the love for Roberts and Star Citizen?]]>http://massively.joystiq.com/2013/05/19/stick-and-rudder-why-all-the-love-for-roberts-and-star-citizen/http://massively.joystiq.com/2013/05/19/stick-and-rudder-why-all-the-love-for-roberts-and-star-citizen/http://massively.joystiq.com/2013/05/19/stick-and-rudder-why-all-the-love-for-roberts-and-star-citizen/#commentsFiled under: , , , , , , , , , , , ,

                      Stick and Rudder - Why all the love for Roberts and Star Citizen?
                      I was talking with a gaming buddy recently who missed the whole space sim experience in the 1990s. He's a Star Wars fan and a real-life pilot pushing 40, so it surprised me to learn that he'd never heard of Wing Commander, Freespace, X-Wing, and the like. My jaw really hit the floor as our conversation turned to current games and I began to evangelize about Star Citizen and Chris Roberts.

                      "Who's Chris Roberts?" he asked, with a straight face.

                      Continue reading Stick and Rudder: Why all the love for Roberts and Star Citizen?

                      MassivelyStick and Rudder: Why all the love for Roberts and Star Citizen? originally appeared on Massively on Sun, 19 May 2013 14:00:00 EST. Please see our terms for use of feeds.

                      Permalink | Email this | Comments

                        ]]>                        celebritychris-robertsclaw-markscloud-imperiumcloud-imperium-gamingfeaturedhero-worshipimmersionloreroberts-space-industriesroleplayingrsisandboxsci-fishipspacespace-simspacesimstar-citizenstar-citizen-lorestar-citizen-writers-guidestick-and-ruddertie-fighterwing-commanderx-wingSun, 19 May 2013 14:00:00 EST                        <![CDATA[Exploits plague Neverwinter economy, PWE responds [Updated]]]>http://massively.joystiq.com/2013/05/19/exploits-plague-neverwinter-economy-cryptic-responds/http://massively.joystiq.com/2013/05/19/exploits-plague-neverwinter-economy-cryptic-responds/http://massively.joystiq.com/2013/05/19/exploits-plague-neverwinter-economy-cryptic-responds/#commentsFiled under: , , , , ,

                        Neverwinter
                        Multiple Massively sources and forum users are reporting that a serious auction hall exploit involving negative bids has turned the fledgling economy of Neverwinter on its head. Perfect World/Cryptic appear to be locking down forum threads on the topic and have posted the following in response to the exploits:
                        We currently are in the process of taking action against a subset of accounts that were confirmed to have utilized exploits that affected the game balance or economy. These accounts may be banned, temporarily or permanently, depending on the severity of exploit utilization. Anyone who is affected by this will receive notification via email. [...] Thank you for your patience and support while we continue to do everything in our power to ensure that Neverwinter remains a fair and balanced game experience.
                        The post also encourages anyone banned unfairly to contact customer support for resolution. A followup post by a Cryptic moderator from last night tells players that "there are no plans for another wipe at this time." And a message on the Neverwinter's German-language Facebook page suggests that the Neverwinter Gateway has been taken offline while the issue is investigated. We'll keep you posted as the story develops. [Thanks to Dan, J, Ehra, David, Dixa, Mike, xpac, Jan, and Zaph for the tips!]

                        [Update: Cryptic has posted a new response to the latest exploit: "The Astral Diamond Exchange and the Auction House have been temporarily taken offline to resolve a high priority bug. At this time we are still investigating the details regarding the issue and will post more information as the situation progresses. As the issue involves in-game currency, we understand that there may be questions regarding the follow up actions needed to ensure that the economy remains fair and balanced. At this time we are still in the process of collecting the data, but plan to share details regarding follow up actions once the investigation concludes. Thank you for your patience and understanding while we continually smooth out issues during open beta."]

                        MassivelyExploits plague Neverwinter economy, PWE responds [Updated] originally appeared on Massively on Sun, 19 May 2013 13:00:00 EST. Please see our terms for use of feeds.

                        Permalink | Email this | Comments

                        ]]>                        action-mmobugbugscrypticcryptic-studiosdndeconomyexploitexploitsf2pfantasyfree-to-playneverwinterperfect-worldperfect-world-entertainmentpweSun, 19 May 2013 13:00:00 EST                        <![CDATA[Rise and Shiny: DragonRealms]]>http://massively.joystiq.com/2013/05/19/rise-and-shiny-dragonrealms/http://massively.joystiq.com/2013/05/19/rise-and-shiny-dragonrealms/http://massively.joystiq.com/2013/05/19/rise-and-shiny-dragonrealms/#commentsFiled under: , , , , , , , , , , , ,

                        DragonRealms website artwork
                        As a part of MUD May, I just had to play at least one MUD for Rise and Shiny. I have a handful of favorite MUDs, like GemStone IV, BatMUD, and Achaea, but I have never really given DragonRealms a chance. Until now. I've poked into it here and there, but every time I found myself on the Simutronics website, I always logged into GemStone IV. I heard that DragonRealms was a lot different, more hardcore, and filled with PvP, and after spending an initial week with the game and the killer community, I can say that it is different, but mainly in a few outstanding ways. Of course I might find much more that sets the game apart if I played it for several years like some of the people I met in game, but for now I'll settle with telling you what I've learned so far.

                        The usual embedded video in this article serves two purposes. First, it's an interview piece I did with Eric Latham, Producer at Simutronics. Next, it's a glance at DragonRealms, from character creation to a bit of gameplay. It's not as in-depth as my other videos, but it keeps in the greater theme of MUD May.

                        Continue reading Rise and Shiny: DragonRealms

                        MassivelyRise and Shiny: DragonRealms originally appeared on Massively on Sun, 19 May 2013 12:00:00 EST. Please see our terms for use of feeds.

                        Permalink | Email this | Comments

                          ]]>                          anno-onlinebeau-hindmanDragonrealmseric-lathamf2pfeaturedfree-to-playgemstone-ivhands-onlivestreammassively-tvmudMUD-MayMUDsmulti-user-domainmulti-user-dungeonrise-and-shinysimutronicsstreamthe-settlers-onlinetwitchtwitch-tvvideoSun, 19 May 2013 12:00:00 EST                          <![CDATA[One Shots: The many lives of Gwen Thackeray]]>http://massively.joystiq.com/2013/05/19/one-shots-the-many-lives-of-gwen-thackeray/http://massively.joystiq.com/2013/05/19/one-shots-the-many-lives-of-gwen-thackeray/http://massively.joystiq.com/2013/05/19/one-shots-the-many-lives-of-gwen-thackeray/#commentsFiled under: , , , , , ,

                          One Shots Looming death
                          Hey Gwen, how's it hanging? Find that flute yet? Yeah, don't worry, I'm sure it'll turn up around here somewhere. Don't get too near the river there, girl; those skale have a nasty bite! Say, what's that sulfurous smell in the air? And those distant screams that are drawing nearer at an incredible rate? And a sudden looming premonition that the property values around here are about to take a nosedive?

                          Reader Sharvis sent in this Guild Wars picture with a modicum of pity: "Here is Gwen moments before the Searing. Poor girl."

                          Don't feel too sorry for her, Sharvis! She gets an entire expansion, after all!

                          Continue reading One Shots: The many lives of Gwen Thackeray

                          MassivelyOne Shots: The many lives of Gwen Thackeray originally appeared on Massively on Sun, 19 May 2013 10:00:00 EST. Please see our terms for use of feeds.

                          Permalink | Email this | Comments

                            ]]>                            activisionanetarenanetblizzardblizzard-entertainmentbring-back-one-shotsbuy-to-playccpccp-gameseveeve-onlinefantasygalleriesgalleryguild-warsguild-wars-2gwgw2internet-spaceshipsncsoftone-shotspics-or-it-didnt-happenreader-screenshotsreader-submissionssandboxsci-fiscreenshotscreenshotsspreadsheets-onlineuser-submissionswarcraftworld-of-warcraftwowSun, 19 May 2013 10:00:00 EST                            <![CDATA[Yes, that is a car in ArcheAge]]>http://massively.joystiq.com/2013/05/19/yes-that-is-a-car-in-archeage/http://massively.joystiq.com/2013/05/19/yes-that-is-a-car-in-archeage/http://massively.joystiq.com/2013/05/19/yes-that-is-a-car-in-archeage/#commentsFiled under: , , , , , ,

                            Yep, that's a car in ArcheAge
                            This not-sure-if-serious moment is brought to you by XLGAMES. The Korean MMO maker, presumably hard at work collaborating with Trion to westernize its ArcheAge sandbox opus (right guys... guys?), has published what can only be termed a curious gameplay video to its official YouTube channel.

                            The clip features car racing and a number of spiffy looking hot rods, which normally wouldn't raise any eyebrows if they weren't located smack dab in the middle of a feudalized high fantasy world that, up until now, has featured sailing ships, horses, and low-tech gliders as its primary forms of transportation. It's hard to tell what's under the hood on these babies -- maybe it's some sort of steampunkish propulsion system -- but one thing's for sure: We can't make this stuff up.

                            Have yourself a look-see after the cut.

                            [Thanks Dengar!]

                            Continue reading Yes, that is a car in ArcheAge

                            MassivelyYes, that is a car in ArcheAge originally appeared on Massively on Sun, 19 May 2013 09:00:00 EST. Please see our terms for use of feeds.

                            Permalink | Email this | Comments

                            ]]>                            aaarche-agearcheagearcheage-cararcheage-carsarcheage-racingfantasypvpracingsandboxsandparkwtfxl-gamesxlgamesSun, 19 May 2013 09:00:00 EST                            <![CDATA[The Daily Grind: Why do you play an anthropomorphic race?]]>http://massively.joystiq.com/2013/05/19/the-daily-grind-why-do-you-play-an-anthropomorphic-race/http://massively.joystiq.com/2013/05/19/the-daily-grind-why-do-you-play-an-anthropomorphic-race/http://massively.joystiq.com/2013/05/19/the-daily-grind-why-do-you-play-an-anthropomorphic-race/#commentsFiled under: , , , ,

                            The Daily Grind Why do you play an anthropomorphic race
                            A Daily Grind discussion last week on MMO races that we detest got me thinking about anthropomorphic races -- you know, the animals-on-hind-legs dudes and dudettes. The frog-people. The cow-people. The cat-people. The wolf-people. The leopard-people. The rat-people. The lizard-people. The panda-people. Really, the sky's the limit when you can turn any animal into a humanoid playable race. I'm only disappointed that we haven't seen platypus-people or manatee-people yet in MMOs.

                            Without bringing the "imaginary racism" this time, I'm genuinely curious what propels people to play an anthropomorphic race. The easy jab would be to say that it's just catering to the furries out there, but I think that's not universally true. What's the appeal of playing a dog-person? It can't just be racials such as "mark your territory" and "excess slobber."

                            So I want to hear from the folks who play one of these races and hear what your reason is for picking an animal-humanoid character. Don't be defensive. I'm not attacking you; I'm merely curious. Is it the road less traveled? Is it an affection you have for a particular animal? Is it a rebellion against the boring fantasy races out there?

                            Every morning, the Massively bloggers probe the minds of their readers with deep, thought-provoking questions about that most serious of topics: massively online gaming. We crave your opinions, so grab your caffeinated beverage of choice and chime in on today's Daily Grind!

                            MassivelyThe Daily Grind: Why do you play an anthropomorphic race? originally appeared on Massively on Sun, 19 May 2013 08:00:00 EST. Please see our terms for use of feeds.

                            Permalink | Email this | Comments

                              ]]>                              caitlincathardaily-grindfroglokkurasashaopinionpandaranraceracesratongasarnaktaurentdgthe-daily-grindworgenSun, 19 May 2013 08:00:00 EST                              <![CDATA[TUG tech video shows off in-house engine]]>http://massively.joystiq.com/2013/05/18/tug-tech-video-shows-off-in-house-engine/http://massively.joystiq.com/2013/05/18/tug-tech-video-shows-off-in-house-engine/http://massively.joystiq.com/2013/05/18/tug-tech-video-shows-off-in-house-engine/#commentsFiled under: , , , , ,

                              TUG concept art
                              Recently Nerd Kingdom promised more demonstrations of the tech behind its new TUG MMO hopeful. The company has made good with a new video that shows off the in-house engine, and lead programmer Brandon Nelson starts things off with an interesting tidbit about the game's contouring algorithm. "An algorithm like dual contouring gives us the ability to have the same quality of terrain that other games have, but not have to have them generated by level designers," Nelson explains.

                              There's quite a lot of additional info packed into the clip's six-minute running time, all of which you can see for yourself after the break. You can also learn more about TUG via the project's Kickstarter site.

                              Continue reading TUG tech video shows off in-house engine

                              MassivelyTUG tech video shows off in-house engine originally appeared on Massively on Sat, 18 May 2013 21:30:00 EST. Please see our terms for use of feeds.

                              Permalink | Email this | Comments

                              ]]>                              brandon-nelsoncontouring-algorithmcrowdfundingdevelopmentkickstarternerd-kingdomopen-worldopen-world-sandboxsandboxtugtug-videoSat, 18 May 2013 21:30:00 EST                              <![CDATA[Darkfall plans summer content update, suffers DDOS attack [Updated]]]>http://massively.joystiq.com/2013/05/18/aventurine-outlines-darkfalls-summer-content-update-plans/http://massively.joystiq.com/2013/05/18/aventurine-outlines-darkfalls-summer-content-update-plans/http://massively.joystiq.com/2013/05/18/aventurine-outlines-darkfalls-summer-content-update-plans/#commentsFiled under: , , , , , , , , ,

                              This is a road in Darkfall
                              Darkfall's long-awaited Unholy Wars makeover launched almost a month ago, and now Aventurine is turning its eyes toward the future of its PvP-focused fantasy sandbox. AV's Tasos Flambouras posted a schedule of planned content updates on the forums earlier this week that stretches all the way into July. Aside from the usual MMO bug fixes and tweaks, there are major additions like the Svartvann, Marthnyr, Hardruk, and Dulguna dungeons, new families of monsters, new ships, and sea fortresses. [Thanks Dengar!]

                              [Update: Aventurine is reporting that its NA servers are suffering the effects of a DDoS attack. The official blog reads, "In regard to the ping issues on the NA server the past couple of days, this was due to a DDoS attack during NA prime time. We have taken measures in cooperation with our hosting providers to filter this attack, and we're monitoring the situation. We'll keep you updated and we apologize for any inconvenience."]

                              MassivelyDarkfall plans summer content update, suffers DDOS attack [Updated] originally appeared on Massively on Sat, 18 May 2013 21:00:00 EST. Please see our terms for use of feeds.

                              Permalink | Email this | Comments

                              ]]>                              agonaventurinedarkfalldarkfall-dungeonsdarkfall-unholy-warsdarkfall-updatesdffantasyopen-pvppvpsandboxtasos-flambourasunholy-warsSat, 18 May 2013 21:00:00 EST                              <![CDATA[Wizardry Online prepping for 'major code update']]>http://massively.joystiq.com/2013/05/18/wizardry-online-prepping-for-major-code-update/http://massively.joystiq.com/2013/05/18/wizardry-online-prepping-for-major-code-update/http://massively.joystiq.com/2013/05/18/wizardry-online-prepping-for-major-code-update/#commentsFiled under: , , , , ,

                              Wizardry Online prepping for 'major code update'
                              SOE's Wizardry Online website has updated with a post outlining an upcoming "major code update." The patch will bring the western client "one step closer to all the advanced features of the Japanese version of Wizardry Online," the company says.

                              Advanced forging and the game's socketing system take up most of the space in this particular blog entry, but there's also a mention of new skills for each class as well as a skill reset NPC.

                              MassivelyWizardry Online prepping for 'major code update' originally appeared on Massively on Sat, 18 May 2013 20:30:00 EST. Please see our terms for use of feeds.

                              Permalink | Email this | Comments

                              ]]>                              gamepothardcoreopen-pvppermadeathpkplayer-killingpvpsir-techsoesony-online-entertainmentwizardrywizardry-major-code-updatewizardry-onlineSat, 18 May 2013 20:30:00 EST                              <![CDATA[Tattered Notebook: A guide to EQII's Moonlight Enchantments (with new stuff!)]]>http://massively.joystiq.com/2013/05/18/tattered-notebook-a-guide-to-eqiis-moonlight-enchantments-an/http://massively.joystiq.com/2013/05/18/tattered-notebook-a-guide-to-eqiis-moonlight-enchantments-an/http://massively.joystiq.com/2013/05/18/tattered-notebook-a-guide-to-eqiis-moonlight-enchantments-an/#commentsFiled under: , , , , , , ,

                              Tattered Notebook A guide to EQII's Moonlight Enchantments and new stuff!
                              Lately, there have been a number of topics all vying for my attention here in Tattered Notebook. In a couple of instances, some of them got a little rough and started pushing the others around to try for a better place in line. Yet all the while, EverQuest II's Moonlight Enchantments has been patiently waiting. So as a reward (we do like to reward good behavior here!), that quiet little topic is getting the spotlight in a special bonus edition. And the timing couldn't be more perfect!

                              You see, initially this guide was just going to focus on speed to help you get through that short two-day event that comes but once a month on the 20th and 21st in EQII. Now, however, we get to delve into the changes and new things coming to the Enchanted Grottoes, from even more housing items (yes, that's on top of the new additions in March) to two new repeatable quests to earn the tokens to buy the items. And with this month's festival right around the corner, having a game plan ready to get the most out of those two days will benefit new and old players alike.

                              Continue reading Tattered Notebook: A guide to EQII's Moonlight Enchantments (with new stuff!)

                              MassivelyTattered Notebook: A guide to EQII's Moonlight Enchantments (with new stuff!) originally appeared on Massively on Sat, 18 May 2013 20:00:00 EST. Please see our terms for use of feeds.

                              Permalink | Email this | Comments

                                ]]>                                decoratingeqeq-2eq-iieq2eqiieverquesteverquest-2everquest-iif2pfantasyfeaturedfree-to-playgrottogrottoeshousinghousing-itemsin-game-eventMoonlight-Enchantmentmoonlight-enchantmentsnew-itemsnew-questsopinionsoesonysony-online-entertainmenttattered-notebookthe-tattered-notebookSat, 18 May 2013 20:00:00 EST                                <![CDATA[Guild Wars 2 gives voice to the Consortium]]>http://massively.joystiq.com/2013/05/18/guild-wars-2-gives-voice-to-the-consortium/http://massively.joystiq.com/2013/05/18/guild-wars-2-gives-voice-to-the-consortium/http://massively.joystiq.com/2013/05/18/guild-wars-2-gives-voice-to-the-consortium/#commentsFiled under: , , , ,

                                Guild Wars 2 puts a voice to the Consortium
                                "The Consortium is neither good nor evil. The Consortium is capitalist," ArenaNet Narrative Designer Scott McGough begins as he introduces this faction to gamers in a new video. If you've been playing Guild Wars 2's new living world content in Southsun Cove, then you've undoubtedly bumped into one or two of the representatives from this firm.

                                McGough explains that the Consortium is angling to be a competitor to the Black Lion Trading Company, and that means selling people all sorts of feel-good products that they want and need. They also appeared to be the savior of the refugees from the previous living story, offering the dispossessed a place to live and work. Unfortunately for the settlers, the Consortium is not prepared to let them go any time soon, and Southsun Cove is a much more dangerous place to live than the Consortium realized.

                                Check out the backstory video for the Consortium after the jump!

                                Continue reading Guild Wars 2 gives voice to the Consortium

                                MassivelyGuild Wars 2 gives voice to the Consortium originally appeared on Massively on Sat, 18 May 2013 18:00:00 EST. Please see our terms for use of feeds.

                                Permalink | Email this | Comments

                                ]]>                                anetarenanetbuy-to-playconsortiumfantasyguild-wars-2gw2living-storylorencsoftscott-mcgoughsouthsun-covethe-consortiumvideoSat, 18 May 2013 18:00:00 EST                                <![CDATA[The Mog Log: Final Fantasy XIV beta phase 1 and 2 - FATEs and dungeons]]>http://massively.joystiq.com/2013/05/18/the-mog-log-final-fantasy-xiv-beta-phase-1-and-2-fates-and-du/http://massively.joystiq.com/2013/05/18/the-mog-log-final-fantasy-xiv-beta-phase-1-and-2-fates-and-du/http://massively.joystiq.com/2013/05/18/the-mog-log-final-fantasy-xiv-beta-phase-1-and-2-fates-and-du/#commentsFiled under: , , , , , , ,

                                That withdrawal is a very real thing. I'm missing it.
                                Do you smell that on the wind, my friends? It smells like June is fast approaching, and more importantly it smells like soon we'll be able to welcome the third phase of testing with open arms. Which is good, since I am currently going through withdrawal. I wake up in cold sweats, try to change my class in other games, start up the Final Fantasy XIV beta client in the hopes that someone "accidentally" turned the servers back on... you get the general idea.

                                To help alleviate this, I'm going to talk about the two pieces of the game from the first two beta phases that are in need of the most polish. While there are places to improve elsewhere, FATEs and dungeons have issues that might need a bit more hammering to fix. Or they might be fine and we just haven't yet seen enough of the game to know everything. Either way, let's get started with the big addition to the game, the system that had no predecessor in Final Fantasy XIV's first version: the FATE system.

                                Continue reading The Mog Log: Final Fantasy XIV beta phase 1 and 2 - FATEs and dungeons

                                MassivelyThe Mog Log: Final Fantasy XIV beta phase 1 and 2 - FATEs and dungeons originally appeared on Massively on Sat, 18 May 2013 16:00:00 EST. Please see our terms for use of feeds.

                                Permalink | Email this | Comments

                                  ]]>                                  betabetasconsoleconsolesdungeonsdynamic-eventsfantasyfatesfeaturedffff14ffxivfinal-fantasyfinal-fantasy-14final-fantasy-xivfull-active-time-eventsgroup-contentmog-logopinionraidssquaresquare-enixsquenixthe-mog-logSat, 18 May 2013 16:00:00 EST                                  <![CDATA[Wings Over Atreia: Shugo Kingdom returns to Aion]]>http://massively.joystiq.com/2013/05/18/wings-over-atreia-shugo-kingdom-returns-to-aion/http://massively.joystiq.com/2013/05/18/wings-over-atreia-shugo-kingdom-returns-to-aion/http://massively.joystiq.com/2013/05/18/wings-over-atreia-shugo-kingdom-returns-to-aion/#commentsFiled under: , , , , , , ,

                                  Wings Over Atreia Shugo Kingdom returns to Aion
                                  Who says we can't get what we want? I wanted the Shugo Kingdom Adventure event to return to Aion, and I'm getting my wish. Booyah! No, really, it's true: Starting after maintenance on May 22nd, Daevas who've flown over level 50 will again be able to journey for a limited time to the long lost vaults of the Shugo Kingdom in search of great and glorious treasure. And by treasure, I mean a trove of chests filled with AP items, Stormwing armor pieces and weapons, or even rare sets of wings. Of course what you get depends on how many keys you have and a little luck, so there's no harm in starting your sacrifices to Aion's RNG gods now.

                                  Did you miss out on the event last time but are looking forward to it this go around? Or maybe you need a refresher because the trauma of not getting that one item caused you to block all knowledge of the zone from your mind? Either way, this edition of Wings Over Atreia will give you a heads up on what to expect. And as an added bonus, Associate Producer Sean Orlikowski shared his tips and tricks for making the most of your Shugo Kingdom Adventures.

                                  Continue reading Wings Over Atreia: Shugo Kingdom returns to Aion

                                  MassivelyWings Over Atreia: Shugo Kingdom returns to Aion originally appeared on Massively on Sat, 18 May 2013 14:00:00 EST. Please see our terms for use of feeds.

                                  Permalink | Email this | Comments

                                    ]]>                                    aionascensionbe-a-Shugodungeonseventf2pfantasyfeaturedfree-to-playguideImperial-Tombin-game-eventinstancencsoftopinionSean-OrlikowskiShigosShugo-Kingdom-AdventureStormwing-loottruly-freewings-over-atreiaSat, 18 May 2013 14:00:00 EST                                    <![CDATA[The Road to Mordor: Six reasons LotRO's Lore-masters rock]]>http://massively.joystiq.com/2013/05/18/the-road-to-mordor-six-reasons-lotros-lore-masters-rock/http://massively.joystiq.com/2013/05/18/the-road-to-mordor-six-reasons-lotros-lore-masters-rock/http://massively.joystiq.com/2013/05/18/the-road-to-mordor-six-reasons-lotros-lore-masters-rock/#commentsFiled under: , , , , ,

                                    The Road to Mordor Six reasons why Loremasters rock
                                    In my Lord of the Rings Online career, I've played two classes far more than any others: the Captain and the Lore-master. Both scratch that "pet class" itch that I have in MMOs, both are quite group-friendly, and both seem to be somewhat unorthodox picks (at least compared to the plague of Hunters and Champions infecting the game).

                                    I'll leave a discussion about Captains for another time, but today I felt like talking about the strangeness that is the Lore-master. It's such a unique class in feel and execution, and it's captivated me such that I'm actually leveling up my second Lore-master because I was dissatisfied with the way I handled my first one.

                                    Maybe you've never tried one. Maybe you picked one up and just couldn't get a feel for what it was supposed to do. I'll admit that the LM is an acquired taste, partially because its skillset is all over the map and it doesn't settle into an expected template. However, it may just be the coolest class in the game. Here are six reasons why.

                                    Continue reading The Road to Mordor: Six reasons LotRO's Lore-masters rock

                                    MassivelyThe Road to Mordor: Six reasons LotRO's Lore-masters rock originally appeared on Massively on Sat, 18 May 2013 12:00:00 EST. Please see our terms for use of feeds.

                                    Permalink | Email this | Comments

                                      ]]>                                      classclass-reviewclassesf2pfantasyfeaturedfree-to-playlmlord-of-the-ringslord-of-the-rings-onlinelore-masterlore-masterslotroopinionpetpet-classroad-to-mordorthe-road-to-mordorturbineturbine-entertainmentSat, 18 May 2013 12:00:00 EST                                      <![CDATA[WRUP: Someone no longer likes us on Facebook edition]]>http://massively.joystiq.com/2013/05/18/wrup-someone-no-longer-likes-us-on-facebook-edition/http://massively.joystiq.com/2013/05/18/wrup-someone-no-longer-likes-us-on-facebook-edition/http://massively.joystiq.com/2013/05/18/wrup-someone-no-longer-likes-us-on-facebook-edition/#commentsFiled under: ,

                                      UUUUUUNNNNBREAK MY HEEEEEEAAAAART
                                      It finally happened. Like fools, we ignored the dire warnings of what would happen if we kept posting stuff about games you don't like or articles you didn't agree with. The worst has finally come to pass -- someone no longer likes our Facebook page.

                                      We've been in shock here at the office. I've been hitting the rum pretty hard even by my standards, Jef is sitting in an empty bathtub sobbing, and Bree has been playing "Unbreak my Heart" on loop for about seven hours. We'd plead for that reader to come back, but he'll never see it. He no longer likes us. It's really the worst insult you could deliver.

                                      Despite the fact that this traumatic event has left us as broken shells, we somehow managed to pull ourselves together long enough to put together an installment of WRUP. Click on past the break to see what we're up to for the next couple of days other than staring at the number of likes on Facebook, and let us know what you'll be up to in the comments.

                                      Continue reading WRUP: Someone no longer likes us on Facebook edition

                                      MassivelyWRUP: Someone no longer likes us on Facebook edition originally appeared on Massively on Sat, 18 May 2013 10:00:00 EST. Please see our terms for use of feeds.

                                      Permalink | Email this | Comments

                                      ]]>                                      featuredmassively-metametaweekendweekend-gamingwhat-are-you-playingwrupSat, 18 May 2013 10:00:00 EST                                      <![CDATA[The Daily Grind: Are you still excited to try RIFT's free-to-play option?]]>http://massively.joystiq.com/2013/05/18/the-daily-grind-are-you-still-excited-to-try-rifts-free-to-pla/http://massively.joystiq.com/2013/05/18/the-daily-grind-are-you-still-excited-to-try-rifts-free-to-pla/http://massively.joystiq.com/2013/05/18/the-daily-grind-are-you-still-excited-to-try-rifts-free-to-pla/#commentsFiled under: , , , , , , ,

                                      I don't have any idea what hand I should place this on. It looks kind of gross.
                                      If you'd missed it, RIFT recently announced that the game will go free-to-play on June 12th. Obviously, the hope is to bring in a variety of new players, but the circumstances surrounding the announcement can result in a bit of whiplash when deciding whether or not to count yourself among those getting into the game.

                                      On the one hand, RIFT is making humble promises about the item shop... but on the other hand, the development team also promised the game would never go free-to-play. Trion Worlds did just get hit by layoffs, but it's been said those layoffs don't affect RIFT's staff. It's long had consistent updates, but those updates have dropped off sharply this year.

                                      Is trying the game out a good idea? A bad one? Today, we ask our readers to decide. Carefully weighing all the evidence, are you still excited to try RIFT's free-to-play option? Or do you think you'll be giving it a pass?

                                      Every morning, the Massively bloggers probe the minds of their readers with deep, thought-provoking questions about that most serious of topics: massively online gaming. We crave your opinions, so grab your caffeinated beverage of choice and chime in on today's Daily Grind!

                                      MassivelyThe Daily Grind: Are you still excited to try RIFT's free-to-play option? originally appeared on Massively on Sat, 18 May 2013 08:00:00 EST. Please see our terms for use of feeds.

                                      Permalink | Email this | Comments

                                        ]]>                                        conquestdaily-grindf2pfantasyfree-to-playopinionpvpriftrift-literift-planes-of-telararvrtdgthe-daily-grindthree-faction-pvpthree-way-pvptriontrion-worldsSat, 18 May 2013 08:00:00 EST                                        <![CDATA[Storyboard: The way it was for three years]]>http://massively.joystiq.com/2013/05/17/storyboard-the-way-it-was-for-three-years/http://massively.joystiq.com/2013/05/17/storyboard-the-way-it-was-for-three-years/http://massively.joystiq.com/2013/05/17/storyboard-the-way-it-was-for-three-years/#commentsFiled under: , , , , ,

                                        Going back in time.
                                        Roleplaying is the same as it ever was. People are still shoehorning in lore characters into backstories, someone is a sparkly magic vampire, and you can still turn a corner in a tavern to find two people with a decided lack of gear or public shame. (In Second Life, that corner is the one you turn to download the game.) But I've had three years of talking about it, so it's at least a little different than it was.

                                        I don't know if I'd go so far as to say it's better.

                                        Every year I like to take a look back at the past year, talk about what worked well, what didn't work at all, and what I'd like to do in the future. So it is for this year, complete with a nice big surprise down at the end there. Regular readers may be less surprised, but you can just bear with me.

                                        Continue reading Storyboard: The way it was for three years

                                        MassivelyStoryboard: The way it was for three years originally appeared on Massively on Fri, 17 May 2013 21:00:00 EST. Please see our terms for use of feeds.

                                        Permalink | Email this | Comments

                                          ]]>                                          featurednew-featuresopinionretrospectiveroleplayroleplayersroleplayingrpstorystoryboardstoryboard-librarythree-yearsyear-in-reviewFri, 17 May 2013 21:00:00 EST                                          <![CDATA[Betawatch: May 11 - 17, 2013]]>http://massively.joystiq.com/2013/05/17/betawatch-may-11-17-2013/http://massively.joystiq.com/2013/05/17/betawatch-may-11-17-2013/http://massively.joystiq.com/2013/05/17/betawatch-may-11-17-2013/#commentsFiled under: , , , , ,

                                          But Iron Man 3, amirite?
                                          Early access for Marvel Heroes is just around the corner, if you consider 11 days to be a corner. It'll be a chance for everyone to get started on the process of hitting the level cap... or at least getting halfway there before grinding dailies. Your mileage may vary. DUST 514 finally ended its testing earlier this week, meaning that you can go be obliterated by an orbital strike right now if you own a PS3.

                                          Elsewhere in the testing world, Anno Online quietly went into open beta (keep an eye out for our own Beau Hindman's look at the game later this month). There are games preparing for a beta in the future, as well, and more information about popular titles still in beta. It's been a quiet week otherwise.

                                          That doesn't mean there isn't a list past the break. There's always a list. As always, if you see something odd on there, feel free to let us know in the comments.

                                          Continue reading Betawatch: May 11 - 17, 2013

                                          MassivelyBetawatch: May 11 - 17, 2013 originally appeared on Massively on Fri, 17 May 2013 20:00:00 EST. Please see our terms for use of feeds.

                                          Permalink | Email this | Comments

                                            ]]>                                            alphaalphasanno-onlinebetabeta-testbeta-testingbetasbetawatchclosed-betadust-514featuredgame-testinglaunchlaunchesmarvel-heroesmassively-metaopen-betarounduptestingFri, 17 May 2013 20:00:00 EST                                            <![CDATA[Gaslight Joker spotlighted in new Infinite Crisis gameplay vid]]>http://massively.joystiq.com/2013/05/17/gaslight-joker-spotlighted-in-new-infinite-crisis-gameplay-vid/http://massively.joystiq.com/2013/05/17/gaslight-joker-spotlighted-in-new-infinite-crisis-gameplay-vid/http://massively.joystiq.com/2013/05/17/gaslight-joker-spotlighted-in-new-infinite-crisis-gameplay-vid/#commentsFiled under: , , , , , , , , , , ,

                                            Infinite Crisis - Gaslight Joker art
                                            Looking for a beefy enforcer who can dominate close-range combat in Infinite Crisis? Look no further than Gaslight Joker, the newest champion spotlighted in Turbine's ongoing DC-centric MOBA video reveals.

                                            Turbine says its laughing butcher can throw hams at enemies with the Shower of Filth skill, sending them running in fear and debuffing them for good measure. The video touches on a number of other Gaslight Joker skills, too, both passive and active, and it shows off a good bit of Infinite Crisis gameplay footage in the process. See for yourself after the cut.

                                            Continue reading Gaslight Joker spotlighted in new Infinite Crisis gameplay vid

                                            MassivelyGaslight Joker spotlighted in new Infinite Crisis gameplay vid originally appeared on Massively on Fri, 17 May 2013 19:00:00 EST. Please see our terms for use of feeds.

                                            Permalink | Email this | Comments

                                            ]]>                                            dc-mobagaslight-jokerinfinite-crisisinfinite-crisis-videojokermobaturbineFri, 17 May 2013 19:00:00 EST                                            <![CDATA[Star Trek Online fulfills its promise to Klingon players]]>http://massively.joystiq.com/2013/05/17/star-trek-online-fulfills-its-promise-to-klingon-players/http://massively.joystiq.com/2013/05/17/star-trek-online-fulfills-its-promise-to-klingon-players/http://massively.joystiq.com/2013/05/17/star-trek-online-fulfills-its-promise-to-klingon-players/#commentsFiled under: , , , ,

                                            Star Trek Online fulfills its promise to Klingon players
                                            Klingon Defense Force players who have been crying out for years for a significant update to their unfinished faction will have their prayers answered when Star Trek Online's Legacy of Romulus expansion releases next week. Cryptic posted a blog telling these gamers that they have not been forgotten but will be vindicated with a complete experience from level 1 to 50.

                                            "It was always promised that if Star Trek Online was ever going to add a third faction, we would make sure that Klingons would get expanded content first (or at the same time). With Legacy of Romulus adding Romulans as a playable faction, it was a matter of honor that the Klingons get their own content from level 1 to 50," Cryptic wrote.

                                            The devs give slight spoilers to the new, reworked, and revised content that Klingons will be experiencing, such as how players will get their first starship and what iconic locations they'll be visiting (hint: a certain prison planet from Star Trek VI will come into play). The studio is also adding a pair of new KDF ships to the store when the expansion hits.

                                            MassivelyStar Trek Online fulfills its promise to Klingon players originally appeared on Massively on Fri, 17 May 2013 18:00:00 EST. Please see our terms for use of feeds.

                                            Permalink | Email this | Comments

                                            ]]>                                            crypticcryptic-studiosdev-diarydev-postexpansionf2pfree-to-playkdfklingonklingon-defense-forceklingonslegacy-of-romulusperfect-worldperfect-world-entertainmentpweremusromulussci-fistar-trekstar-trek-mmostar-trek-onlinestoFri, 17 May 2013 18:00:00 EST                                            <![CDATA[Trion hit with another round of layoffs [Updated]]]>http://massively.joystiq.com/2013/05/17/trion-reportedly-undergoing-massive-layoffs/http://massively.joystiq.com/2013/05/17/trion-reportedly-undergoing-massive-layoffs/http://massively.joystiq.com/2013/05/17/trion-reportedly-undergoing-massive-layoffs/#commentsFiled under: ,

                                            Trion reportedly undergoing 'massive' layoffs
                                            IGN is reporting "massive" layoffs at Trion. Though the website doesn't cite any sources, it suggests that "well over half the company has been let go," and it also says that those affected may include as much as 80% of the company. An undisclosed IGN source says that "employees are being escorted out of the building and that senior leaders from various Trion teams may not receive severance due to 'undelivered services.'" [These claims have since been rebutted by a Trion Worlds representative, who told Massively directly that while there were indeed layoffs, the 80% number originally suggested by IGN was "grossly exaggerated." She further clarified that no one was escorted out of the building or denied severance as IGN's unnamed source alleged. Additionally, developers emphasized during today's official stream that the RIFT team is not affected by the layoffs.]

                                            Trion recently announced a free-to-play offering for its RIFT MMORPG. It also launched Defiance earlier this year and partnered with Korea's XLGAMES to bring the company's ArcheAge sandbox MMO to western audiences.

                                            Trion also provided the following official statement.
                                            To best position Trion in a rapidly changing industry, we have reorganized our teams and are expanding our free to play offering. With Defiance, we delivered a great game that more than one million gamers registered to play and continue to enjoy. As we progress from launch to ongoing development of the game, we are adjusting our staffing levels to deliver new content and improved features. RIFT, and our other titles in development, were unaffected by these changes. We are very much looking forward to the free to play release of RIFT and are excited by the other new titles currently in development.
                                            [Thank you to everyone who helped us develop this story.]

                                            MassivelyTrion hit with another round of layoffs [Updated] originally appeared on Massively on Fri, 17 May 2013 17:02:00 EST. Please see our terms for use of feeds.

                                            Permalink | Email this | Comments

                                            ]]>                                            breakinglayoffstriontrion-layoffsFri, 17 May 2013 17:02:00 EST