Massively http://massively.joystiq.com Massively http://www.blogsmithmedia.com/www.joystiq.com/media/feedlogo.gif Massively http://massively.joystiq.com en-us Copyright 2013 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[EverQuest Next's official title is... EverQuest Next]]>http://massively.joystiq.com/2013/06/18/everquest-nexts-official-title-let-out-of-the-bag/http://massively.joystiq.com/2013/06/18/everquest-nexts-official-title-let-out-of-the-bag/http://massively.joystiq.com/2013/06/18/everquest-nexts-official-title-let-out-of-the-bag/#commentsFiled under: , , , , ,

EverQuest Next's official title declared
At SOE Live last year, fans were told that the EverQuest Next moniker was only a working title for the upcoming sandbox sequel to the Norrathian franchise. Most believed that the true name would not be revealed until the annual convention this year. However, one fan took to Twitter and point blank asked Dave Georgeson, the franchise director, about the impending title. And Georgeson answered! So the official title for EQ Next is -- *drum roll* -- EverQuest Next!

Yes folks, the working title has now been declared the official title. Surprise! OK, maybe it isn't really a surprise, but there were plenty of creative ideas floating around for possible names that could have been used, not to mention ones I'm sure we haven't even heard yet. But for now, EQN is set in stone... or is it? The game itself was totally blown up and redesigned from scratch, so it stands to reason the name could follow suit.

Tell us, Massively readers, what name would you slap on the side of this sandbox? Give us your best ideas in the comments below.

MassivelyEverQuest Next's official title is... EverQuest Next originally appeared on Massively on Tue, 18 Jun 2013 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments

]]>Dave-Georgesoneqeq-nexteqneverquesteverquest-nextfantasyhad-you-all-goinghahaha-no-reallyofficial-titlesoesony-online-entertainmentTue, 18 Jun 2013 17:00:00 EST<![CDATA[Exclusive: Mabinogi trailer teases new saga in Iria]]>http://massively.joystiq.com/2013/06/18/exclusive-mabinogi-trailer-teases-new-saga-in-iria/http://massively.joystiq.com/2013/06/18/exclusive-mabinogi-trailer-teases-new-saga-in-iria/http://massively.joystiq.com/2013/06/18/exclusive-mabinogi-trailer-teases-new-saga-in-iria/#commentsFiled under: , , , , , ,

Exclusive Mabinogi trailer teases new saga in Iria
A new story is unfolding in the land of Iria in the fantasy free-to-play game Mabinogi and we've got the teaser trailer to kick things off. It all begins when Shamala, who has been imprisoned in Cor Village and purifying the demons, suddenly and mysteriously disappears, leaving players to help defend the village from the demons. In the midst of this, players meet up with Milia, a girl bent on punishing Shamala for the death of her father at the hands of the demons.

What's the full story behind it all? Perhaps players will find out in the new series of quests that will accompany the story when the new episodes begin next week. Until then, check out the teaser trailer after the break.

[Source: Nexon press release]

Continue reading Exclusive: Mabinogi trailer teases new saga in Iria

MassivelyExclusive: Mabinogi trailer teases new saga in Iria originally appeared on Massively on Tue, 18 Jun 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments

    ]]>    exclusivef2pfantasyfree-to-playIria-SagamabinogiMilianexonnexon-americapatchsandboxteaser-trailertrailervideoTue, 18 Jun 2013 11:00:00 EST    <![CDATA[City of Steam dev journal discusses game events]]>http://massively.joystiq.com/2013/06/18/city-of-steam-dev-journal-discusses-game-events/http://massively.joystiq.com/2013/06/18/city-of-steam-dev-journal-discusses-game-events/http://massively.joystiq.com/2013/06/18/city-of-steam-dev-journal-discusses-game-events/#commentsFiled under: , , , , , , , , ,

    City of Steam dev journal discusses game events
    With a name meaning the center, you'd expect City of Steam's Nexus to be a happening place even in beta, right? That means plenty of events for folks to get in on. Well, it just so happens that there are two general events already in game and a third on the way, and Mechanist Games gives players the lowdown on how to get in on the action in the latest dev journal.

    Unlike temporary in-game events, events in CoS are permanent instances you queue for. Of course, victory promises reward. Of the two current events, the Arena is all about survival of the soloist as waves of mobs crash into you whereas Tesla Defense is a five-man tower defense. When patch 1.3 releases, the PvP-based Siege of the Spire will join the event lineup as a MOBA-inspired arena that includes mobs, turrets, and team bases. Players can join the regular events as well as daily and weekly events with larger rewards. For more details, check out the official site.

    MassivelyCity of Steam dev journal discusses game events originally appeared on Massively on Tue, 18 Jun 2013 10:00:00 EST. Please see our terms for use of feeds.

    Permalink | Email this | Comments

    ]]>    Arenabetacity-of-steamdungeondungeonseventsfantasygoblinmechanistmechanist-gamesPvPsci-fiSiege-of-the-SpiresteampunkTesla DefenseTesla-DefenseTue, 18 Jun 2013 10:00:00 EST    <![CDATA[Chaos Theory: A guide to auxiliary weapons in The Secret World]]>http://massively.joystiq.com/2013/06/17/chaos-theory-a-guide-to-auxiliary-weapons-in-the-secret-world/http://massively.joystiq.com/2013/06/17/chaos-theory-a-guide-to-auxiliary-weapons-in-the-secret-world/http://massively.joystiq.com/2013/06/17/chaos-theory-a-guide-to-auxiliary-weapons-in-the-secret-world/#commentsFiled under: , , , , , , ,

    Chaos Theory A guide to getting your auxiliary weapons
    With Issue #7 A Dream to Kill inching closer and closer, my anticipation for the new auxiliary weapon coming to The Secret World is reaching near impossible heights. I'll admit it: As a pyro at heart, I am giddy with the thought of wrapping my hands around a permanent flamethrower! And I'm certainly not alone in that sentiment, either.

    But an excitement for the new weapon doesn't diminish any of the current ones that are already in game; each auxiliary weapon -- the rocket launcher, the chainsaw, the quantum brace, and the whip -- is awesome in its own right with distinct skills and style. Is one right for you? Heck yeah! If you aren't taking advantage of an auxiliary weapon, you are depriving yourself of some extra oomph in your fights, not to mention an eighth active and passive skill on your hot bar.

    How do you know which one is better for you? Honestly, you needn't choose just one; as with regular weapons, you can earn all four. But with a hefty price of 35 SP per weapon, payable all at once, it's impossible to get more than one at a time. So which do you choose first? And then how do you go about getting it? This guide will give a general overview of the four current auxiliary weapons and the paths to acquiring them.

    Continue reading Chaos Theory: A guide to auxiliary weapons in The Secret World

    MassivelyChaos Theory: A guide to auxiliary weapons in The Secret World originally appeared on Massively on Mon, 17 Jun 2013 18:00:00 EST. Please see our terms for use of feeds.

    Permalink | Email this | Comments

      ]]>      3-faction3-factionsA-Dream-to-Killauxiliary-weaponsBig-Trouble-in-the-Big-Applebuy-to-playchainsawchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingDigging-Deeperdragonfactionfaction-pvpfantasyfeaturedfuncomguideguide-to-auxiliary-weaponshorrorilluminatiIssue-2Issue-2-Digging-DeeperIssue-4issue-4-Big-Trouble-in-the-Big-AppleIssue-5Issue-5-The-Vanishing-of-Tyler-FreebornIssue-6Issue-6-The-Last-Train-to-CairoIssue-7Issue-7-A-Dream-to-Killmythologyopinionquantum-bracerocket-launchersci-fantasysecret-worldsecret-world-chaos-theoryskill-basedspolierssubscriptionlesstemplarsThe-Last-Train-to-Cairothe-secret-worldthe-secret-world-chaos-theoryThe-Vanishing-of-Tyler-Freebornthree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonweaponswhipMon, 17 Jun 2013 18:00:00 EST      <![CDATA[FFXIV: A Realm Reborn screenshot video montage shows off beta]]>http://massively.joystiq.com/2013/06/17/ffxiv-a-realm-reborn-screenshot-video-montage-shows-off-beta/http://massively.joystiq.com/2013/06/17/ffxiv-a-realm-reborn-screenshot-video-montage-shows-off-beta/http://massively.joystiq.com/2013/06/17/ffxiv-a-realm-reborn-screenshot-video-montage-shows-off-beta/#commentsFiled under: , , , , , ,

      FFXIV A Realm Reborn screenshot video montage shows off beta
      Although sharing sound, music, and video from the Final Fantasy XIV: A Realm Reborn beta is still prohibited, testers' thoughts and screenshots from phase three are now allowed. Taking advantage of that partial NDA lift, one creative beta participant has put together a montage of stills in video form to show off the upcoming reboot of the game. Wondering if you can glean what's going on from the screenshots alone? Don't worry -- he also added commentary to explain each shot.

      The nearly 33-minute montage includes character creation (all races have two genders to select from), the public quests (Fates), menus and the UI, combat, and a look at the updated graphics. Get a glimpse of the game for yourself in the video after the break.

      [Thanks to Chris for the tip!]

      Continue reading FFXIV: A Realm Reborn screenshot video montage shows off beta

      MassivelyFFXIV: A Realm Reborn screenshot video montage shows off beta originally appeared on Massively on Mon, 17 Jun 2013 11:00:00 EST. Please see our terms for use of feeds.

      Permalink | Email this | Comments

      ]]>      a-realm-rebornbetaconsoleconsolesfantasyffff14ffxivffxiv-a-realm-rebornfinal-fantasyfinal-fantasy-14final-fantasy-xivfinal-fantasy-xiv-a-realm-rebornphase3squaresquare-enixvideo-montageMon, 17 Jun 2013 11:00:00 EST      <![CDATA[The Stream Team: Caveman edition, June 17 - 23, 2013]]>http://massively.joystiq.com/2013/06/17/the-stream-team-caveman-edition-june-17-23-2013/http://massively.joystiq.com/2013/06/17/the-stream-team-caveman-edition-june-17-23-2013/http://massively.joystiq.com/2013/06/17/the-stream-team-caveman-edition-june-17-23-2013/#commentsFiled under: , , ,

      The Stream Team Caveman edition, June 17 23, 2013
      With all the talk about bashing stuff lately, I can't help but envision a certain prehistoric child going around whacking everything with a club, "Bam! Bam! Bam!" Of course, who can blame the little tyke? There are definitely times in game that we've all wanted to swing a cudgel or two, be it a nerf design or a just-quitcher-whining bat.

      Destructive tendencies can even be harbored in the gentle hearts of your favorite Stream Team hosts. A number of you can surely attest to that. Need proof? Just watch Massively TV and see for yourself. Warning: You may start to feel sympathy for those poor mobs...

      Continue reading The Stream Team: Caveman edition, June 17 - 23, 2013

      MassivelyThe Stream Team: Caveman edition, June 17 - 23, 2013 originally appeared on Massively on Mon, 17 Jun 2013 09:00:00 EST. Please see our terms for use of feeds.

      Permalink | Email this | Comments

        ]]>        activisionagonaionanetArcane-Sagaarenanetascensionaventurinebiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamesconquestconsoleconsolesdarkfalldarkfall-unholy-warsdfDotA-2eaelectronic-artseqeq-2eq-iieq1eq2eqiieveeve-onlineeverquesteverquest-2everquest-iif2pfactionfallen-earthfamilyfantasyfefeaturedfirefallfpsfrfree-realmsfree-to-playfuncomg1gamersfirstguild-wars-2gw2historicalhorrorinternet-spaceshipskid-friendlykidskids-mmokingsislekingsisle-entertainmentlivestreamlivestreaminglivestreamslucasartsmassively-metamassively-tvmetammo-shootermv-guidemv-tvmvguidemvtvmythologyncsoftopen-pvppiratepirate101piratesplaystation-3playstation3pollpost-apocpost-apocalypticps3pvpragnarok-online-2red-5red-5-studiosriftrift-literift-planes-of-telararvrsandboxsci-fantasysci-fisecret-worldshooterskill-basedsoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlessswtortanktankstelonthe-old-republicthe-secret-worldthe-stream-teamThe-Westthird-person-shooterthree-faction-pvpthree-way-pvptorTridektriontrion-worldstruly-freetswtwitchtwitch-tvunholy-warsvanguardvanguard-saga-of-heroesvgwarwarcraftwargaming.netwastelandsworld-of-tanksworld-of-warcraftwotwowMon, 17 Jun 2013 09:00:00 EST        <![CDATA[Wings Over Atreia: Exclusive peek into Aion 4.0's new zones]]>http://massively.joystiq.com/2013/06/15/wings-over-atreia-exclusive-peek-into-aion-4-0s-new-zones/http://massively.joystiq.com/2013/06/15/wings-over-atreia-exclusive-peek-into-aion-4-0s-new-zones/http://massively.joystiq.com/2013/06/15/wings-over-atreia-exclusive-peek-into-aion-4-0s-new-zones/#commentsFiled under: , , , , , , , , ,

        Wings Over Atreia Exclusive Peek into Aion 40's new zones
        I have a pretty standard M.O. when it comes to my MMOs: Regardless of how various tutorials want to direct me, I wander off and explore the new world I find myself in. I love to poke around, look into corners, and see all there is to see. The same goes for any time a patch or expansion opens up new places to meander through. That's really just how I roll/run/fly/shamble/hop. So it should come as no surprise that I am excitedly awaiting the new lands of Katalam and Danaria when Aion: Dark Betrayal launches on the 26th.

        I know that I am not alone in my anticipation, so for all those who are also looking forward to taking off into Aion's new realms, I've got something special for you. No, I can't let you into the game early (but if they ever open the door early for me, I'll prop it for you!), but I do have the next best thing to a first-hand experience: a visual tour.

        I've gotten a hold of -- legitimately, I swear -- a video and a number of screenshots showing off all three (yes, I said three) new zones, and I want to share them with you. On top of that, I also have some highlights of the story behind these new areas that Daevas will soon be soaring into. Join me to take a tour and learn the lore of Katalam, Danaria, and Idian Depths.

        Gallery: Aion: Dark Betrayal

        Continue reading Wings Over Atreia: Exclusive peek into Aion 4.0's new zones

        MassivelyWings Over Atreia: Exclusive peek into Aion 4.0's new zones originally appeared on Massively on Sat, 15 Jun 2013 20:00:00 EST. Please see our terms for use of feeds.

        Permalink | Email this | Comments

          ]]>          4.0aionascensionDanariaDark-Betrayalexclusivef2pfantasyfeaturedfree-to-playIdian-DepthskatalamMassively-exclusivencsoftopiniontrailertrailerstruly-freevideovideo-tourvideoswings-over-atreiaSat, 15 Jun 2013 20:00:00 EST          <![CDATA[EU's Age of Wulin offers FAQ and early character creation for closed beta]]>http://massively.joystiq.com/2013/06/14/eus-age-of-wulin-offers-faq-and-early-character-creation-for-cl/http://massively.joystiq.com/2013/06/14/eus-age-of-wulin-offers-faq-and-early-character-creation-for-cl/http://massively.joystiq.com/2013/06/14/eus-age-of-wulin-offers-faq-and-early-character-creation-for-cl/#commentsFiled under: , , , , , , , , ,

          EU's Age of Wulin offers FAQ and early character creation for closed beta
          The European cousin to Age of Wushu, the martial arts sandbox already released in North America, is finally cracking open its beta doors to let in select players next week. That's right: Age of Wulin starts closed beta on Monday, June 17th. But eligible testers needn't wait until then to make their characters; gPotato has enabled access to the launcher until the evening of the 15th to let players create their avatars and reserve their names. Players should note that CBT characters will be wiped for when beta opens to all.

          Got other questions about Age of Wulin's upcoming closed beta? If so, gPotato has some answers via its new FAQ. For instance, this closed beta will be short but all players will enjoy full VIP status. Another important item to note is that AoW will not have an NDA; players are welcome to talk about, review, livestream, and share their in-game experiences with others. And for those who haven't yet received a closed beta key, don't worry -- more were sent out today. While checking your email, catch the closed beta trailer after the break.

          [Thanks to mad283 for the tip!]

          Continue reading EU's Age of Wulin offers FAQ and early character creation for closed beta

          MassivelyEU's Age of Wulin offers FAQ and early character creation for closed beta originally appeared on Massively on Fri, 14 Jun 2013 12:30:00 EST. Please see our terms for use of feeds.

          Permalink | Email this | Comments

          ]]>          age-of-wulinasiachinachinesechinese-mmoclosed-betagpotatogvgkidnappingmartial-artsming-dynastypvpsandboxtrailertrailersvideovideoswuxiaFri, 14 Jun 2013 12:30:00 EST          <![CDATA[E3 2013: Porting DCUO and PlanetSide 2 to the PlayStation 4]]>http://massively.joystiq.com/2013/06/14/e3-2013-the-good-the-bad-and-the-ps4-porting-dcuo-and-pla/http://massively.joystiq.com/2013/06/14/e3-2013-the-good-the-bad-and-the-ps4-porting-dcuo-and-pla/http://massively.joystiq.com/2013/06/14/e3-2013-the-good-the-bad-and-the-ps4-porting-dcuo-and-pla/#commentsFiled under: , , , , , , , , , ,

          E3 2013 The good, the bad, and the PS4 porting DCUO and PlanetSide 2
          Just because SOE didn't have many new games to showcase at E3 this year doesn't mean that the studio didn't have a lot to talk about. In fact, there was plenty to be said about two of the existing games porting to the new PlayStation 4. And while some of it is good, sadly there's some not-so-good thrown in as well. Joystiq caught up with DC Universe Online's Creative Director Jens Andersen and Adam Clegg, a game designer on PlanetSide 2, to get the scoop.

          Mirroring the executive producer's sentiments from our interview, Andersen noted that DCUO has an advantage thanks to being currently available on the PS3. And while not having specifics to announce, Andersen added that he'd be very surprised if the game didn't take advantage of PS4's social functions. However, the game will not (at least initially) be able to use the console's streaming and quick installation features, remaining a download and install title.

          For PlanetSide 2, the big news is that the console will allow optimization of the graphics "1,000 times better" according to Clegg. The big bad news is that it will be impossible to have cross-platform play, so folks who want to play on the PS4 will not have access to their PC characters. In a separate interview with Rev3Games, Art Director Tramell Isaac noted that the PS4 version would feel like a native console game, not just a jerry-rigged PC game.

          Massively's on the ground in Los Angeles during the week of June 10-13, bringing you all the best news from E3 2013. We're covering everything from WildStar and Elder Scrolls Online and ArcheAge to FFXIV's inbound revamp and TERA's latest update, so stay tuned!

          MassivelyE3 2013: Porting DCUO and PlanetSide 2 to the PlayStation 4 originally appeared on Massively on Fri, 14 Jun 2013 12:00:00 EST. Please see our terms for use of feeds.

          Permalink | Email this | Comments

          ]]>          Adam-Cleggconconsoleconsolesconventionconvention-coveragedc-universedc-universe-onlinedcuoe3e3-2013electronic-entertainment-expoevent-coverageexpof2pfpsfree-to-playInterviewJens-Andersenmassively-event-coveragemmo-shootermmofpsplanetsideplanetside-2playstation-3PlayStation-4playstation3ps2ps3PS4sandboxsci-fishootersoesonysony-online-entertainmentsuperherosuperheroesFri, 14 Jun 2013 12:00:00 EST          <![CDATA[The end of (beta) days invasion is coming to Neverwinter]]>http://massively.joystiq.com/2013/06/14/the-end-of-beta-days-invasion-is-coming-to-neverwinter/http://massively.joystiq.com/2013/06/14/the-end-of-beta-days-invasion-is-coming-to-neverwinter/http://massively.joystiq.com/2013/06/14/the-end-of-beta-days-invasion-is-coming-to-neverwinter/#commentsFiled under: , , , , , , ,

          The end of beta days invasion is coming to Neverwinter
          The "It's only in beta" catchphrase is going to become obsolete for Neverwinter come June 20th. At that time, open beta will go quietly into the night as launch takes its place. Did we say quietly? We mean with the loud crashing sounds of Valindra's army at its heels!

          Starting today at 3:00 p.m. EDT, three phases of events will herald the coming of the official launch. Players will enjoy double the rewards of enchantments and runestones until the 17th in the first phase. In the second, lasting the 17th through the 20th, players will have to guardProtector's Enclave from attack by Valindra's army. More dangerous and deadly creatures then join the fray during the third phase running the 19th and concluding at 12:00 p.m. EDT on the 20th.

          Successfully defending Neverwinter through the final two phases can net participants unique rewards, including scrolls, a companion, and more. For full details and exact times, check out the official announcement. Then prepare yourself for war.

          [Source: Perfect World press release]

          MassivelyThe end of (beta) days invasion is coming to Neverwinter originally appeared on Massively on Fri, 14 Jun 2013 10:30:00 EST. Please see our terms for use of feeds.

          Permalink | Email this | Comments

            ]]>            action-mmocrypticcryptic-studiosdndf2pfantasyfree-to-playin-game-eventlaunchlaunch-datelaunch-date-announcedlaunch-eventneverwinterperfect-worldperfect-world-entertainmentpwespecial-eventFri, 14 Jun 2013 10:30:00 EST            <![CDATA[E3 2013: DCUO plans to remain completely free on PS4]]>http://massively.joystiq.com/2013/06/13/e3-2013-dcuo-plans-to-remain-completely-free-on-ps4/http://massively.joystiq.com/2013/06/13/e3-2013-dcuo-plans-to-remain-completely-free-on-ps4/http://massively.joystiq.com/2013/06/13/e3-2013-dcuo-plans-to-remain-completely-free-on-ps4/#commentsFiled under: , , , ,

            E3 2013 DCUO plans to remain completely free on PS4
            The PlayStation 4 made headlines at this year's E3 thanks to its console wars one-upmanship as well as its newly announced launch library. But one previously announced had a live demo at the L.A.-based convention extravaganza; DC Universe Online offered players a chance to experience some next-gen superhero shenanigans for themselves, so we totally jumped in on the action!

            After engrossing ourselves in the world of capes, masks, and super powers, we nabbed Executive Producer Lawrence Liberty to talk with us about DCUO's conversion to the PS4. He shared details about performance, uses for the touchpad on the new controller, a new companion app, and the plan for DCUO to be available at the console's launch. Liberty also noted that the team is working with Sony to keep the game free on the PS4 so players won't have to purchase a PlayStation Plus membership.

            Continue reading E3 2013: DCUO plans to remain completely free on PS4

            MassivelyE3 2013: DCUO plans to remain completely free on PS4 originally appeared on Massively on Thu, 13 Jun 2013 18:00:00 EST. Please see our terms for use of feeds.

            Permalink | Email this | Comments

              ]]>              companion-appconconsoleconsolesconventionconvention-coveragedc-universedc-universe-onlinedcuodemoe3e3-2013electronic-entertainment-expoevent-coverageexpof2pfeaturedfree-to-playLawrence-Libertyleaderboardsmassively-event-coverageplaystation-3PlayStation-4playstation3ps3PS4SCEShu-Yoshidasoesony-online-entertainmentsuperherosuperheroesThu, 13 Jun 2013 18:00:00 EST              <![CDATA[E3 2013: Dragon's Prophet's PvP, raids, and housing]]>http://massively.joystiq.com/2013/06/13/e3-2013-dragons-prophets-pvp-raids-and-housing/http://massively.joystiq.com/2013/06/13/e3-2013-dragons-prophets-pvp-raids-and-housing/http://massively.joystiq.com/2013/06/13/e3-2013-dragons-prophets-pvp-raids-and-housing/#commentsFiled under: , , , , , , ,

              E3 2013 Dragon's Prophet interview details PvP, raids, and housing
              Los Angeles is certainly swarming with a variety of citizenry this week, from zombies to superheroes to martial artists. Even dragons have been spotted! Yes, Dragon's Prophet landed in in the City of Angels for E3 2013, and Massively's Jasmine Hruschak captured Senior Producer Todd Carson to learn more about the the dragon-centric title from Runewaker. (Don't worry folks, we practice catch and release here at Massively.)

              In open beta for less than a month, Dragon's Prophet still has many systems and areas to roll out during testing, and Carson expounded on some of those. He introduced the new zone of Wintertide as well as offered details about raiding. And we certainly couldn't let him go without more information about the frontier system, which encompasses both housing and PvP.

              Continue reading E3 2013: Dragon's Prophet's PvP, raids, and housing

              MassivelyE3 2013: Dragon's Prophet's PvP, raids, and housing originally appeared on Massively on Thu, 13 Jun 2013 13:30:00 EST. Please see our terms for use of feeds.

              Permalink | Email this | Comments

                ]]>                citadelsconconventionconvention-coveragedragondragonsdragons-prophete3e3-2013electronic-entertainment-expoevent-coverageexpofeaturedhousinginfernuminfernum-productionsinterviewinterviewsmassively-event-coveragemassively-exclusivemassively-exclusive0interviewnew-zonepreviewpreviewsPvPrunewakerrunewaker-entertainmentsoesonysony-online-entertainmentterritory-warsTodd-CarsonWintertideThu, 13 Jun 2013 13:30:00 EST                <![CDATA[Aion interview discusses changes in crafting, a new rift, and more]]>http://massively.joystiq.com/2013/06/11/aion-qanda-discusses-changes-in-crafting-a-new-rift-and-more/http://massively.joystiq.com/2013/06/11/aion-qanda-discusses-changes-in-crafting-a-new-rift-and-more/http://massively.joystiq.com/2013/06/11/aion-qanda-discusses-changes-in-crafting-a-new-rift-and-more/#commentsFiled under: , , , , , , ,

                AIon Q&A discussed changed in crafting, a new rift, and more
                With Aion: Dark Betrayal just a short two weeks away, many eyes are turning (and returning) to the world of Atreia. The Gunslinger and Songeweaver have certainly sparked interest in new and veteran players alike. But 4.0 is more than just the new classes; it also includes an updated crafting system (to create items comparable to those in dungeons and the Abyss) and changes to neutral zone mechanics (to prevent invulnerable healers).

                To answer some player questions about 4.0 and beyond, developer Seunguk Baek discussed these topics with Massively, touching on lower-level PvP, racial abilities, and even a new type of rift for higher-level Daevas that opens to another dimension entirely. See what he has to say after the break.

                Continue reading Aion interview discusses changes in crafting, a new rift, and more

                MassivelyAion interview discusses changes in crafting, a new rift, and more originally appeared on Massively on Tue, 11 Jun 2013 15:30:00 EST. Please see our terms for use of feeds.

                Permalink | Email this | Comments

                  ]]>                  aionascensioncraftingcrafting-changesf2pfantasyfeaturedfree-to-playinterviewinterviewsncsoftneutral-zonenew-riftPvPSeunguk-Baektruly-freeTue, 11 Jun 2013 15:30:00 EST                  <![CDATA[Chaos Theory: The Secret World is getting filthy]]>http://massively.joystiq.com/2013/06/10/chaos-theory-the-secret-world-is-getting-filthy/http://massively.joystiq.com/2013/06/10/chaos-theory-the-secret-world-is-getting-filthy/http://massively.joystiq.com/2013/06/10/chaos-theory-the-secret-world-is-getting-filthy/#commentsFiled under: , , , , , , ,

                  Chaos Theory The Secret World is getting filthy
                  So apparently some of you have operatives who have successfully infiltrated the Massively secret lair because someone has gotten a peek at my master plan... I mean, to-do list... and jumped ahead to this week's topic without me! I know we've talked before about how the real-world setting of The Secret World makes it ideal for blurring lines between game and reality, but I wasn't expecting this. Well, no matter. You cannot thwart the master plan; it has already begun. *maniacal laugh*

                  This stage of my brilliant scheme involves taking a closer look at another little nugget found in the May Game Director's Letter. On the surface we see that The Secret World will be getting even filthier at the conclusion of Issue #7 as the nefarious filth will actually break through the Tokyo gate and begin to infect Agartha itself. But more than that, we are witnessing the implementation of a long-term event that will continue to give new content as it progresses. Could this be the harbinger of dynamic events to come that will breathe more life into the world? We can certainly hope!

                  Continue reading Chaos Theory: The Secret World is getting filthy

                  MassivelyChaos Theory: The Secret World is getting filthy originally appeared on Massively on Mon, 10 Jun 2013 16:00:00 EST. Please see our terms for use of feeds.

                  Permalink | Email this | Comments

                    ]]>                    3-faction3-factionsAgarthabuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragondynamic-eventseventfactionfaction-pvpfantasyfeaturedfilthfuncomhorrorilluminatiin-game-eventmythologyopinionsci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonworld-eventMon, 10 Jun 2013 16:00:00 EST                    <![CDATA[The Stream Team: Wedding singer edition, June 10 - 16, 2013]]>http://massively.joystiq.com/2013/06/10/the-stream-team-wedding-singer-edition-june-10-16-2013/http://massively.joystiq.com/2013/06/10/the-stream-team-wedding-singer-edition-june-10-16-2013/http://massively.joystiq.com/2013/06/10/the-stream-team-wedding-singer-edition-june-10-16-2013/#commentsFiled under: , , ,

                    The Stream Team Wedding singer edition, June 10 16, 2013
                    Have you ever been someplace, perhaps at an event, and spontaneously broken into song? And just maybe that wasn't quite an appropriate venue for a favorite heavy tune? Boy, the looks some people give you; I mean, what's really so wrong with injecting a little more groove into a wedding march anyways?

                    Well, luckily there are no such social taboos for spouting random song snippets on Massively TV! I know you understand that urge to just let loose a tune or two, right? It could be that you've belted out a concert-worthy rendition yourself when playing or watching your favorite games. We here at The Stream Team fully support that. We even contribute to the official organization: BOSS (Belting Out Spontaneous Songs). So why not join us where you know you won't be judged. Who knows, you might find a song to sing along with in this weeks streams.

                    Continue reading The Stream Team: Wedding singer edition, June 10 - 16, 2013

                    MassivelyThe Stream Team: Wedding singer edition, June 10 - 16, 2013 originally appeared on Massively on Mon, 10 Jun 2013 10:00:00 EST. Please see our terms for use of feeds.

                    Permalink | Email this | Comments

                      ]]>                      activisionagonanetarenanetarkark-hunterarkfallaventurinebiowareblizzardblizzard-entertainmentbuy-to-playccpccp-gamesconquestdarkfalldarkfall-unholy-warsdefiancedfDotA-2eaelectronic-artselsword-onlineeqeq-2eq-iieq1eq2eqiieveeve-onlineeverquesteverquest-2everquest-iif2pfactionfantasyfeaturedfirefallfpsfree-to-playfuncomguild-wars-2gw2hi-rezhi-rez-studioshistoricalhorrorinternet-spaceshipslivestreamlivestreaminglivestreamslucasartsmassively-metamassively-tvmetammo-shootermobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftopen-pvpplaneplanespollpvpragnarok-online-2red-5red-5-studiosriftrift-literift-planes-of-telararvrsandboxsci-fantasysci-fisecret-worldshooterskill-basedSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlessswtorsyfytanktankstelonthe-old-republicthe-secret-worldthe-stream-teamthird-person-shooterthree-faction-pvpthree-way-pvptortpstransmedia-synergytridektriontrion-worldstswtvtwitchtwitch-tvunholy-warsvanguardvanguard-saga-of-heroesvgwarwarcraftwargaming.netwarplanewarplanesworld-of-tanksworld-of-warcraftworld-of-warplaneswotwowwowpxboxMon, 10 Jun 2013 10:00:00 EST                      <![CDATA[Massively Exclusive: Aion 4.0 videos showcase new classes and skills]]>http://massively.joystiq.com/2013/06/08/massively-exclusive-aion-4-0-videos-showcase-new-classes-and-sk/http://massively.joystiq.com/2013/06/08/massively-exclusive-aion-4-0-videos-showcase-new-classes-and-sk/http://massively.joystiq.com/2013/06/08/massively-exclusive-aion-4-0-videos-showcase-new-classes-and-sk/#commentsFiled under: , , , , , ,

                      Massively Exclusive Aion 40 videos showcase new classes and skills
                      The clock is ticking down, and the wait for Aion 4.0 is almost over. But eager Daevas don't have to sit and twiddle their wings until June 26th to see the new classes in action; NCsoft offered Massively a sneak peek with a new trailer depicting the Gunslinger toting guns galore (from pistols to aethercannons) and the Songweaver, who packs a mean treble clef and can heal mana. If you want to blast holes in your opponents or turn them into dancing penguins, this is the video for you.

                      Not interested in a new class? Then how about getting a gander at the new skills coming to the tried and true classes! There's something new for everyone as Daevas advance up to level 65. Take a look at those skills in the second video beyond the break.

                      [Source: NCsoft press release]

                      Continue reading Massively Exclusive: Aion 4.0 videos showcase new classes and skills

                      MassivelyMassively Exclusive: Aion 4.0 videos showcase new classes and skills originally appeared on Massively on Sat, 08 Jun 2013 20:00:00 EST. Please see our terms for use of feeds.

                      Permalink | Email this | Comments

                        ]]>                        4.0aionAion-4.0ascensionDark-Betrayalexclusivef2pfantasyfree-to-playGunslingerlevel-cap-increaseMassively-Exclusivencsoftnew-classesnew-skillsSongweavertrailerstruly-freevideosSat, 08 Jun 2013 20:00:00 EST                        <![CDATA[Tattered Notebook: There's too much to do in EverQuest II!]]>http://massively.joystiq.com/2013/06/08/tattered-notebook-theres-too-much-to-do-in-everquest-ii/http://massively.joystiq.com/2013/06/08/tattered-notebook-theres-too-much-to-do-in-everquest-ii/http://massively.joystiq.com/2013/06/08/tattered-notebook-theres-too-much-to-do-in-everquest-ii/#commentsFiled under: , , , , , , , , ,

                        Tattered Notebook There's too much to do in EverQuest II!
                        For this latest Tattered Notebook, I'd already planned -- and in fact was in the middle of -- writing impressions of Scars of the Awakened, EverQuest II's most recent meaty update. I've collected a slew of notes taken from the adventurer and crafter questlines, including some tips and time-saving tricks. But amidst all that intense update research (I gladly sacrifice myself for you guys!), I got distracted. And no, it wasn't by a shiny!

                        You see, although the land of Cobalt Scar opened up just over a month ago, I've been pulled away and unable to complete everything I want to in that zone. Why? Because in that same time, there have been multiple city festivals, a round of Moonlight Enchantments (with new quests and brand-new housing items that were a must have), a double XP weekend that just begged for some serious crafting advancement, a commissioned housing project to complete, personal houses to decorate, old quests to finally finish up... and that was just to start!

                        As the guilt for not finishing the entirety of GU66 settled in, friends who weren't as high-level as I wanted to play together in areas they had access to, which coincidentally did not include the latest update. So off I ran through older zones and dungeons with lower-leveled friends. Needless to say, my in-game adventures of late have stretched all over the map of Norrath. Sounds busy, no? It was during all this that I had to finally lay my delusions of finishing everything I have planned before EverQuest Next to rest; there's just too much to do in EQII!

                        Continue reading Tattered Notebook: There's too much to do in EverQuest II!

                        MassivelyTattered Notebook: There's too much to do in EverQuest II! originally appeared on Massively on Sat, 08 Jun 2013 18:00:00 EST. Please see our terms for use of feeds.

                        Permalink | Email this | Comments

                          ]]>                          adventuringchronomentoringcraftingdungeonseqeq-2eq-iieq2eqiieverquesteverquest-2everquest-iif2pfantasyfeaturedfestivalsfree-to-playhousingopinionPlayer-Studiosoesonysony-online-entertainmenttattered-notebookthe-tattered-notebookthings-to-doSat, 08 Jun 2013 18:00:00 EST                          <![CDATA[Allods Online updates guild vs guild rules of engagement]]>http://massively.joystiq.com/2013/06/05/allods-online-updates-guild-vs-guild-rules-of-engagement/http://massively.joystiq.com/2013/06/05/allods-online-updates-guild-vs-guild-rules-of-engagement/http://massively.joystiq.com/2013/06/05/allods-online-updates-guild-vs-guild-rules-of-engagement/#commentsFiled under: , , , , , , , , , , ,

                          Allods Online updates guild vs guild rules of engagement
                          Starting today, warriors in Allods Online's guild versus guild territory battles will have new mechanics at their disposal. These new battle mechanics include the ability to set a battle time to improve the organization and coordination of military campaigns as well as a new tournament-based league for sectors. Additionally, a new matchmaking system aims to keep things balanced and fair by using an improved battle points calculation that allows guilds to challenge others with similar power and skill levels.

                          On top of those changes, players with their own allod can now create a dungeon to hide their treasures in a customizable maze that plunderers will have to successfully navigate.

                          Need another reason to log in and check things out? How about this: Allods Online is offering a special event called A Gift a Day. Starting today, each day a player logs in, s/he will receive a gift. Prizes can include exclusive new costumes and a brand-new wolf mount. If you need any more coaxing, check out new images in the gallery below and the update's trailer after the cut.

                          [Source: Webzen press release]

                          Gallery: Allods Online

                          Continue reading Allods Online updates guild vs guild rules of engagement

                          MassivelyAllods Online updates guild vs guild rules of engagement originally appeared on Massively on Wed, 05 Jun 2013 11:00:00 EST. Please see our terms for use of feeds.

                          Permalink | Email this | Comments

                            ]]>                            allodsallods-onlineastrum-nivalf2pfantasyfree-to-playgala-netgallerygpotatoguild-vs-guildmail-ru-gamesmail.ru-gamesmailru-gamesmatchmaking-systemnew-battle-mechanicsplayer-generated-contentplayer-made-dungeonsscreenshotsspecial-eventtrailerupdatevideoWed, 05 Jun 2013 11:00:00 EST                            <![CDATA[Chaos Theory: Increasing The Secret World's replayability with Issue #8]]>http://massively.joystiq.com/2013/06/04/chaos-theory-increasing-the-secret-worlds-replayability-with/http://massively.joystiq.com/2013/06/04/chaos-theory-increasing-the-secret-worlds-replayability-with/http://massively.joystiq.com/2013/06/04/chaos-theory-increasing-the-secret-worlds-replayability-with/#commentsFiled under: , , , , , , , ,

                            Chaos Theory Increasing The Secret World's replayability with Issue #8
                            I've said it before, and I'll say it again: The Secret World just keeps getting better and better. While the horror-themed conspiracy game is obvious not perfect (heaven help the rest of the MMOverse if it were!), it is definitely traveling steadfastly along that long, dusty road of improvement. Every time Funcom delves deeper into the lives and plots of The Secret World's denizens by adding to the story, it gets better. Every time new experiences are offered through new missions or features, it gets better. Ditto every time more choice is added through new weapons or customization.

                            But for all the advancements and added content over the past year, there are a few issues that, when addressed, would get the game really trucking down that road and make for one heck of a ride. Luckily for fans, it just so happens that one of those very issues appears to be getting some attention come Issue #8: replayability. Behold the hope that is scenarios!

                            Continue reading Chaos Theory: Increasing The Secret World's replayability with Issue #8

                            MassivelyChaos Theory: Increasing The Secret World's replayability with Issue #8 originally appeared on Massively on Tue, 04 Jun 2013 18:00:00 EST. Please see our terms for use of feeds.

                            Permalink | Email this | Comments

                              ]]>                              3-faction3-factionsbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingdragondynamic-contentdynamic-elementsfactionfaction-pvpfantasyfeaturedfuncomhorrorilluminatiIssue-7Issue-7-A-Dream-to-KillIssue-8mythologyopinionreplayabilityscenariossci-fantasysecret-worldsecret-world-chaos-theoryskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonTue, 04 Jun 2013 18:00:00 EST                              <![CDATA[Marvel Heroes launch-day roundup and opening cinematic]]>http://massively.joystiq.com/2013/06/04/marvel-heroes-launch-day-roundup/http://massively.joystiq.com/2013/06/04/marvel-heroes-launch-day-roundup/http://massively.joystiq.com/2013/06/04/marvel-heroes-launch-day-roundup/#commentsFiled under: , , , , ,

                              Marvel Heroes launchday roundup
                              Suit up, Marvel Heroes! Today's the day you launch into the fight against evil, so grab your costume and join in on thwarting the dastardly plots of Doctor Doom. What's that, you say? You are stuck at work as your alter ego? Well don't let evil get the upper hand; use the time wisely to prepare for the upcoming battles.

                              To help, we've compiled a collection of videos, hands-on experiences, and even a series of motion comics here to brief you on what to expect when you can finally break free of those workplace fetters and fly into the fray. We've also included the game's just-posted opening cinematic!

                              Continue reading Marvel Heroes launch-day roundup and opening cinematic

                              MassivelyMarvel Heroes launch-day roundup and opening cinematic originally appeared on Massively on Tue, 04 Jun 2013 12:00:00 EST. Please see our terms for use of feeds.

                              Permalink | Email this | Comments

                                ]]>                                actionaction-mmof2pfree-to-playgazilliongazillion-entertainmentlaunchlaunch-daylaunch-day-roundupmarvelmarvel-heroesmarvel-universemarvel-universe-onlinemuosecret-identitysuperherosuperheroestrailertrailersvideovideosTue, 04 Jun 2013 12:00:00 EST                                <![CDATA[Massively Exclusive: Witness the betrayal in Aion's 4.0 E3 Trailer -- Beritra's Plot]]>http://massively.joystiq.com/2013/06/04/massively-exclusive-witness-the-betrayal-in-aions-4-0-e3-trai/http://massively.joystiq.com/2013/06/04/massively-exclusive-witness-the-betrayal-in-aions-4-0-e3-trai/http://massively.joystiq.com/2013/06/04/massively-exclusive-witness-the-betrayal-in-aions-4-0-e3-trai/#commentsFiled under: , , , , , ,

                                Massively Exclusive Witness the betrayal in Aion's 40 E3 Trailer Beritra's Plot
                                We've known for some time now that Aion's upcoming expansion, Dark Betrayal, is coming out this month. And thanks to this weekend's announcement, we even have the exact date the new classes and new lands will become available. But one bit of information has still eluded us: The details of this nefarious betrayal. Who exactly betrayed whom? The answer lies in this new 4.0 E3 launch trailer.

                                Dragon Lord Tiamat, defeated by Daevas, was betrayed by one of her own -- one who stole her dark secret to unlocking a powerful weapon for himself. And now that weapon is poised to bring forth a new era for the Balaur by eradicating Elyos and Asmodians alike. Get a glimpse of the newest threat to Daevas and watch the plot unfold in the launch trailer after the break.

                                [Source: NCsoft press release]

                                Continue reading Massively Exclusive: Witness the betrayal in Aion's 4.0 E3 Trailer -- Beritra's Plot

                                MassivelyMassively Exclusive: Witness the betrayal in Aion's 4.0 E3 Trailer -- Beritra's Plot originally appeared on Massively on Tue, 04 Jun 2013 10:00:00 EST. Please see our terms for use of feeds.

                                Permalink | Email this | Comments

                                  ]]>                                  4.0aionAion-4.0ascensionBeritrabetrayalDark-BetrayalE3E3-launch-trailerf2pfantasyfree-to-playMassively-exclusivencsoftSciTechTiamattruly-freeTue, 04 Jun 2013 10:00:00 EST                                  <![CDATA[Watch the plague spread in the newest Defiance trailer]]>http://massively.joystiq.com/2013/06/03/watch-the-plague-spread-in-defiance-trailer/http://massively.joystiq.com/2013/06/03/watch-the-plague-spread-in-defiance-trailer/http://massively.joystiq.com/2013/06/03/watch-the-plague-spread-in-defiance-trailer/#commentsFiled under: , , , , , , , ,

                                  Watch the plague spread in Defiance trailer
                                  Last week, players were warned of a plague that was en route to Defiance. This latest cross-over event between the shooter and the television show involves a mysterious illness that is sweeping San Francisco; players must clear out the infected and find a cure to before it spreads to the town of Defiance in the show. And that race to the cure starts today! Want to see what you are up against? Then check out the plague trailer after the cut.

                                  Also available in today's Defiance update are a new data recorder, eight new emergencies, two new pursuits, and an all-new game mode. A limited-time mission series will also be available from June 10th to 17th.

                                  [Source: Trion Worlds press release]

                                  Continue reading Watch the plague spread in the newest Defiance trailer

                                  MassivelyWatch the plague spread in the newest Defiance trailer originally appeared on Massively on Mon, 03 Jun 2013 13:00:00 EST. Please see our terms for use of feeds.

                                  Permalink | Email this | Comments

                                    ]]>                                    arkark-hunterarkfallcross-over-eventdefiancein-game-eventmmo-shooterplague-trailerpvpsci-fishootersyfythird-person-shootertpstrailertransmedia-synergytriontrion-worldstvxboxMon, 03 Jun 2013 13:00:00 EST                                    <![CDATA[Why MMOs stopped getting bigger]]>http://massively.joystiq.com/2013/06/03/why-mmos-stopped-getting-bigger/http://massively.joystiq.com/2013/06/03/why-mmos-stopped-getting-bigger/http://massively.joystiq.com/2013/06/03/why-mmos-stopped-getting-bigger/#commentsFiled under: , , , , , , ,

                                    Why MMOs stopped getting bigger
                                    If after looking over the state of MMOs lately you've been left singing, "Where have all the big games gone?" to yourself, Ramin Shokrizade has an answer just for you. A virtual world economist, Shokrizade states that up until EVE Online and World of Warcraft, games grew in size and scope and then stopped. Why? Because it was never about getting big; it was about protecting and ensuring the equity of the gamers.

                                    Shokrizade delves into why equity -- the sum of gamers' in-game efforts, such as levels and possessions -- is so important in a game and why those games that ignore protecting this equity don't measure up when it comes to success. He discusses how microtransactions that deal in in-game content destroy equity as well as how expansions that make previous content (such as crafting tiers) obsolete do the same thing. He then goes on to discuss the games that get it right, like League of Legends and World of Tanks.

                                    MassivelyWhy MMOs stopped getting bigger originally appeared on Massively on Mon, 03 Jun 2013 10:00:00 EST. Please see our terms for use of feeds.

                                    Permalink | Email this | Comments

                                    ]]>                                    activisionblizzardblizzard-entertainmentccpccp-gamesdotae-sportesporteveeve-onlinef2pfantasyfree-to-playhistoricalinternet-spaceshipsleagueleague-of-legendslolmobapvpRamin-Shokrizaderiotriot-gamessandboxsci-fispreadsheets-onlinetanktankswarwarcraftwargaming.networld-of-tanksworld-of-warcraftwotwowMon, 03 Jun 2013 10:00:00 EST                                    <![CDATA[The Stream Team: Calorie-free edition, June 3 - 9, 2013]]>http://massively.joystiq.com/2013/06/03/the-stream-team-calorie-free-edition-june-3-9-2013/http://massively.joystiq.com/2013/06/03/the-stream-team-calorie-free-edition-june-3-9-2013/http://massively.joystiq.com/2013/06/03/the-stream-team-calorie-free-edition-june-3-9-2013/#commentsFiled under: , , ,

                                    The Stream Team Caloriefree edition, June 3 9, 2013
                                    With summer right around the corner, a number of folks are thinking of ways to shape up a little more before hitting the beaches. Of course, as gamers we may not understand this strange desire to actually go out in the sunlight, but we, too, can be swept up in the fervor. So The Stream Team is here to offer you some calorie-free treats to help you through your week. Each and every tasty morsel on Massively TV is guaranteed to be 100% calorie-free.

                                    Got cravings in between your livestream meals? Just click on a rerun and snack away anytime you like! Then just sit back and watch the hours just melt away.

                                    Continue reading The Stream Team: Calorie-free edition, June 3 - 9, 2013

                                    MassivelyThe Stream Team: Calorie-free edition, June 3 - 9, 2013 originally appeared on Massively on Mon, 03 Jun 2013 09:00:00 EST. Please see our terms for use of feeds.

                                    Permalink | Email this | Comments

                                      ]]>                                      activisionagonaionanetaq-worldsArcane-Sagaarenanetarkark-hunterarkfallascensionaventurinebiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playccpccp-gamesconquestconsoleconsolesdarkfalldarkfall-unholy-warsdefiancedfdota-2eaelectronic-artselsword-onlineeq-2eq-iieq2eqiieveeve-onlineeverquest-2everquest-iif2pfantasyfeaturedfpsfrfree-realmsfree-to-playguild-wars-2gw2hi-rezhi-rez-studioshistoricalinternet-spaceshipskid-friendlykidskids-mmolivestreamlivestreaminglivestreamslucasartsmassively-metamassively-tvmetammo-shootermmofpsmobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvncsoftopen-pvpplaneplanesplanetsideplanetside-2playstation-3playstation3pollps2ps3pvpriftrift-literift-planes-of-telararvrsandboxsci-fishooterSmitesoesonysony-online-entertainmentspreadsheets-onlinestar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamswtorsyfythe-old-republicthe-stream-teamthird-person-shooterthree-faction-pvpthree-way-pvptortpstransmedia-synergytriontrion-worldstruly-freetvtwitchtwitch-tvunholy-warswarwarcraftwargaming.netwarplanewarplanesworld-of-warcraftworld-of-warplaneswowwowpxboxMon, 03 Jun 2013 09:00:00 EST                                      <![CDATA[Wings Over Atreia Exclusive: Soar into Aion 4.0 June 26th]]>http://massively.joystiq.com/2013/06/01/wings-over-atreia-exclusive-soar-into-aion-4-0-june-26th/http://massively.joystiq.com/2013/06/01/wings-over-atreia-exclusive-soar-into-aion-4-0-june-26th/http://massively.joystiq.com/2013/06/01/wings-over-atreia-exclusive-soar-into-aion-4-0-june-26th/#commentsFiled under: , , , , , ,

                                      Wings Over Atreia Exclusive Soar into Aion 40 June 26th
                                      Could it be? Is that really... it IS! Your eyes do not deceive you; there really is a bonafide date set for the release of Aion's next expansion, Dark Betrayal. And I've got to tell you, it is such a relief to be able to share the news without the chance of that electric shock collar going off. You'll be able to spread your wings in Katalam and Danaria -- or just spread new wings period if you go for one of the new classes -- come June 26th. But here's the catch: If you still have things you want to get in order before the expansion hits (perhaps gain a level or two like some people we know), now you've got a deadline!

                                      Luckily, for all those stuck in the position of needing to advance in levels a bit to experience all of what 4.0 offers, Aion's got just the event to help you out. Starting June 5th and going all the way to launch on the 26th, any and all Daevas -- meaning level 10 and above -- can participate in Code Red and receive special enhancements to aid in their adventures.

                                      Continue reading Wings Over Atreia Exclusive: Soar into Aion 4.0 June 26th

                                      MassivelyWings Over Atreia Exclusive: Soar into Aion 4.0 June 26th originally appeared on Massively on Sat, 01 Jun 2013 16:00:00 EST. Please see our terms for use of feeds.

                                      Permalink | Email this | Comments

                                        ]]>                                        4.04.0-launch-dateaionAion-4.0ascensionBlack-Cloud-MarketplaceBlackCloud-MarketplaceCode-RedCode-Red-eventDanariaDark-Betrayalf2pfantasyfeaturedfree-to-playKatalammassively-exclusivencsoftopinionspecial-dealsspecial-eventtruly-freewings-over-atreiaSat, 01 Jun 2013 16:00:00 EST                                        <![CDATA[New Elder Scrolls Online video shows off gameplay]]>http://massively.joystiq.com/2013/05/31/new-elder-scrolls-online-video-shows-off-gameplay/http://massively.joystiq.com/2013/05/31/new-elder-scrolls-online-video-shows-off-gameplay/http://massively.joystiq.com/2013/05/31/new-elder-scrolls-online-video-shows-off-gameplay/#commentsFiled under: , , , , ,

                                        New Elder Scrolls Online video shows off gameplay footage
                                        Have you been itching to feast your eyes on actual The Elder Scrolls Online game footage from the eyes of a player, but you haven't managed to find your way into the Bethesda offices? Thanks to Marty Sliva and Caleb Lawson of IGN, you can; the pair had the opportunity to jump in and play a couple hours of the upcoming fantasy MMO and created a video with some highlights of their adventures.

                                        As a non-MMO player, Lawson described the draw to the game and an Elder Scrolls fan. He noted that it felt like being back in that world, from Daedric quests to being dropped into Oblivion. Sliva added, "[TESO] captures that same sort of spirit of exploration and adventure of Skyrim and Oblivion, but there is this great MMO attached to it."

                                        Lawson also shared that developers stated that hands will be added to the game to give the first-person experience even more of a Skyrim feel. Hear more of their thoughts and see the gameplay in the video after the break.

                                        Continue reading New Elder Scrolls Online video shows off gameplay

                                        MassivelyNew Elder Scrolls Online video shows off gameplay originally appeared on Massively on Fri, 31 May 2013 14:00:00 EST. Please see our terms for use of feeds.

                                        Permalink | Email this | Comments

                                        ]]>                                        bethesdabethesda-softworksbethsoftdaggerfallelder-scrollselder-scrolls-onlineesofactionsgameplay-footagemorrowindoblivionpvprvrsandboxskyrimtamrieltestesothe-elder-scrollsthe-elder-scrolls-onlinethree-faction-pvpthree-way-pvpvideozenimaxzenimax-mediazenimax-onlinezenimax-online-studiosFri, 31 May 2013 14:00:00 EST                                        <![CDATA[Story trailers spotlight two Dragon's Prophet EU zones]]>http://massively.joystiq.com/2013/05/31/story-trailers-spotlight-two-dragons-prophet-eu-zones/http://massively.joystiq.com/2013/05/31/story-trailers-spotlight-two-dragons-prophet-eu-zones/http://massively.joystiq.com/2013/05/31/story-trailers-spotlight-two-dragons-prophet-eu-zones/#commentsFiled under: , , , , , ,

                                        Story trailers spotlight two Dragon's Prophet EU zones
                                        Dragon's Prophet launched into open beta yesterday on both sides of the pond, and players are jumping into the world of Auratia to try their hand at domesticating the various dragon-kind. But there's more to Dragon's Prophet than just taming dragons, there's also a fight against the evil threatening to take over the land. So what's the story on this invading evil?

                                        To give players a glimpse of what they are fighting for and against, Infernum Productions has released two videos delving into the story of two zones, Laedis and Satuma. You can catch both trailers after the cut.

                                        [Source: Infernum press release]

                                        Continue reading Story trailers spotlight two Dragon's Prophet EU zones

                                        MassivelyStory trailers spotlight two Dragon's Prophet EU zones originally appeared on Massively on Fri, 31 May 2013 12:00:00 EST. Please see our terms for use of feeds.

                                        Permalink | Email this | Comments

                                          ]]>                                          dragondragonsdragons-prophetDragons-Prophet-EUdragons-prophet-videohousinginfernuminfernum-productionsLaedisloreopen-betarunewakerrunewaker-entertainmentSatumasoesonysony-online-entertainmentstory-trailertrailersvideoFri, 31 May 2013 12:00:00 EST                                          <![CDATA[The Secret World Game Director's letter dishes more details on Issues 7 & 8]]>http://massively.joystiq.com/2013/05/31/the-secret-world-game-directors-letter-dishes-more-details-on-i/http://massively.joystiq.com/2013/05/31/the-secret-world-game-directors-letter-dishes-more-details-on-i/http://massively.joystiq.com/2013/05/31/the-secret-world-game-directors-letter-dishes-more-details-on-i/#commentsFiled under: , , , , , ,

                                          TSW Game Director's letter dishes more details on Issues #7 & 8 We already knew that Issue #7 would bring The Secret World a spy-like experience. And now, thanks to the Game Director's letter for May, we also have the title, snazzy cover art, and a glimpse at the climactic ending. We even get an expected time-frame for release; while an exact date is not given, it appears that it will hit the end of June, according to the cover art, and Director Joel Bylos himself states it will coincide with TSW's first anniversary.

                                          Issue #7: A Dream to Kill ends with filth infiltrating Agartha itself through the newly discovered Tokyo entrance, and players will continue to fight this threat with group and solo content until Tokyo can finally be entered.

                                          Bylos also reveals information about Issue #8, including the Virtual Training Scenarios and the Augment System. To prove readiness to enter Tokyo to the Council of Venice, players will have to complete training scenarios that will have random elements thrown in, making each experience different. The Augment system is a new advancement system that will allow players to improve their existing abilities by providing customization in the roles of damage, support, healing, and survivability.

                                          MassivelyThe Secret World Game Director's letter dishes more details on Issues 7 & 8 originally appeared on Massively on Fri, 31 May 2013 10:00:00 EST. Please see our terms for use of feeds.

                                          Permalink | Email this | Comments

                                          ]]>                                          A-Dream-to-Killbuy-to-playfactionfantasyfuncomGame-Directors-letterhorrorIssue-7Issue-7-A-Dream-to-Killissue-8Joel-Bylosmythologysci-fantasysecret-worldskill-basedsubscriptionlessthe-secret-worldTokyotswFri, 31 May 2013 10:00:00 EST                                          <![CDATA[Infinite Crisis joins competitive arena with Major League Gaming]]>http://massively.joystiq.com/2013/05/30/infinite-crisis-joins-competitive-arena-with-major-league-gaming/http://massively.joystiq.com/2013/05/30/infinite-crisis-joins-competitive-arena-with-major-league-gaming/http://massively.joystiq.com/2013/05/30/infinite-crisis-joins-competitive-arena-with-major-league-gaming/#commentsFiled under: , , , , , , ,

                                          Infinite Crisis joins competitive arena with Major League Gaming
                                          Some folks may wonder whether the upcoming superhero title Infinite Crisis can make it in the big leagues of MOBA gaming, but it is already assured a place in the majors. Major League Gaming has announced a partnership with Turbine's DC Comic-based game, one that will kick off at E3 with a live competition between two top teams. Fans wanting to check out the action can stop by the WB Games booth (South Hall 1637) beginning at 3 p.m. EDT (12 p.m. PDT) on Tuesday, June 11th, or watch it livestreamed on MLG's and Infinite Crisis' official sites.

                                          This collaboration will introduce Infinite Crisis to the e-sports community and ultimately lead to Infinite Crisis' inclusion at MLG Pro Circuit competitions. The game's executive producer, Jeffrey Steefel, is quoted as saying, "We look forward to working closely with MLG to introduce players to the DC Multiverse and building a world-class gaming community."

                                          [Source: Warner Bros. Interactive Entertainment press release]

                                          MassivelyInfinite Crisis joins competitive arena with Major League Gaming originally appeared on Massively on Thu, 30 May 2013 13:00:00 EST. Please see our terms for use of feeds.

                                          Permalink | Email this | Comments

                                            ]]>                                            betacompetitive-gamingDC-ComicsInfinite-Crisisjeffrey-steefelmajor-league-gamingMLGMOBApartnershipTurbineTurbine-EntertainmentWarner-Bros-Interactive-EntertainmentThu, 30 May 2013 13:00:00 EST                                            <![CDATA[Rhode Island explores ditching 38 Studios debt]]>http://massively.joystiq.com/2013/05/30/rhode-island-explores-ditching-38-studios-debt/http://massively.joystiq.com/2013/05/30/rhode-island-explores-ditching-38-studios-debt/http://massively.joystiq.com/2013/05/30/rhode-island-explores-ditching-38-studios-debt/#commentsFiled under: , , ,

                                            Rhode Island explores ditching 38 studios debt
                                            To pay back or not to back, that is the question that Rhode Island is exploring after being saddled with $112.6 million in combined debt and interest when 38 Studios went kaput, taking Project Copernicus with it. RI governor Lincoln Chafee still believes that lenders should get their due according to his spokeswoman Christine Hunsinger, but the administration is gathering data to explore the cost of not paying back to get an understanding of "the ramifications of what that decision would be."

                                            Currently the state is planning to pay investors back over the course of 10 years, with a $2.5 million payment the first year and subsequent installments of $12.5 million thereafter.

                                            MassivelyRhode Island explores ditching 38 Studios debt originally appeared on Massively on Thu, 30 May 2013 11:00:00 EST. Please see our terms for use of feeds.

                                            Permalink | Email this | Comments

                                            ]]>                                            38-studiosChristine-HunsingerdebtGovenor-Lincoln-Chafeeproject-copernicusRhode-IslandThu, 30 May 2013 11:00:00 EST                                            <![CDATA[Choose My Adventure: Putting the finishing touches on our Darkfall project]]>http://massively.joystiq.com/2013/05/29/choose-my-adventure-putting-the-finishing-touches-on-our-darkf/http://massively.joystiq.com/2013/05/29/choose-my-adventure-putting-the-finishing-touches-on-our-darkf/http://massively.joystiq.com/2013/05/29/choose-my-adventure-putting-the-finishing-touches-on-our-darkf/#commentsFiled under: , , , , , , ,

                                            Choose My Adventure Putting the finishing touches on our Darkfall project
                                            Well, that just about does it. After weeks of your directing me through Darkfall Unholy Wars, our Choose My Adventure project is almost completed. We just have a few finishing touches to add before wrapping up -- namely, sieges! What romp through the wilds of Agon would be complete without experiencing the thrill of clan territorial warfare? You all couldn't let me leave without participating in a few sieges (which won over warfare on water by a narrow margin), and the server seemed more than willing to oblige.

                                            From small skirmishes infiltrating the cities of enemies to an all-out war to protect our own, I had the chance to fight -- and occasionally die -- in a few different sieges this past week. Considering I was still fairly new and fighting against a number of vets from the original Darkfall with years of practice under their belts, I didn't do too shabbily. Perhaps more importantly, I had fun through it all.

                                            Gallery: Choose My Adventure: Darkfall Unholy Wars

                                            Continue reading Choose My Adventure: Putting the finishing touches on our Darkfall project

                                            MassivelyChoose My Adventure: Putting the finishing touches on our Darkfall project originally appeared on Massively on Wed, 29 May 2013 14:00:00 EST. Please see our terms for use of feeds.

                                            Permalink | Email this | Comments

                                              ]]>                                              agonaventurinechoose-my-adventurechoose-my-adventure-darkfallchoose-my-adventure-mj-guthriecmadarkfalldarkfall-unholy-warsdffantasyfeaturedhands-onopen-pvpopinionpollpollspvpreaders-choicesandboxsiegesiegessiegingunholy-warsvotevotingWed, 29 May 2013 14:00:00 EST                                              <![CDATA[Scarlet Blade reveals first major content update]]>http://massively.joystiq.com/2013/05/29/scarlet-blade-reveals-first-major-content-update/http://massively.joystiq.com/2013/05/29/scarlet-blade-reveals-first-major-content-update/http://massively.joystiq.com/2013/05/29/scarlet-blade-reveals-first-major-content-update/#commentsFiled under: , , , , , , ,

                                              Scarlet Blade reveals first major content update
                                              Though it's a game best-known for removing things (clothing in particular), Scarlet Blade is actually adding something this time around: Aeria Games has announced the free-to-play game's first major content update. Players in Scarlet Blade can now reach level 34 and venture into a new zone called Barbiron. New gear also accompanies the level cap increase, as do new dungeons, including the aptly named Subterranean Factory, which sits underground.

                                              PvP also received attention in this update with the opening of Viledon, an all new open-world zone capable of holding hundreds of combatants. This zone, which contains quests to complete, bosses to fight over, and escort missions to complete or sabotage, can be entered and exited at will.

                                              [Source Aeria Games press release]

                                              MassivelyScarlet Blade reveals first major content update originally appeared on Massively on Wed, 29 May 2013 13:00:00 EST. Please see our terms for use of feeds.

                                              Permalink | Email this | Comments

                                                ]]>                                                aeria-gamesf2pfantasyfree-to-playfreemiummicrotransactionmicrotransactionsnew-dungeonsnew-zonesopen-world-PvP-zonepremiumPvPScarlet-Bladesci-fiupdateWed, 29 May 2013 13:00:00 EST                                                <![CDATA[Dragon's Prophet EU soars into open beta]]>http://massively.joystiq.com/2013/05/29/dragons-prophet-eu-soars-into-open-beta/http://massively.joystiq.com/2013/05/29/dragons-prophet-eu-soars-into-open-beta/http://massively.joystiq.com/2013/05/29/dragons-prophet-eu-soars-into-open-beta/#commentsFiled under: , , , , , , , ,

                                                Dragon's Prophet EU soars into open beta
                                                It's a bird! It's a plane! No -- it's a dragon... and it shall be mine!

                                                European players eager to tame their own dragons will finally be able to utter those words as Dragon's Prophet EU launches into open beta tomorrow. Founders can enter the world of Auratia today and get a head start on training, riding, and fighting alongside (or against) the over 300 unique dragons in game.

                                                The open beta launch introduces a new starting zone, Puretia. Full of waterfalls and airships fighting in the sky, Puretia gives way to a volcanic landscape and deep canyons as players journey on to the region's capital of Arboran. More updates and expansions are already in the works and will continue to release regularly throughout open beta.

                                                If you need something to distract you from the launch count-down timer on the official site, check out this new trailer after the break.

                                                [Source: Infernum Productions press release]

                                                Continue reading Dragon's Prophet EU soars into open beta

                                                MassivelyDragon's Prophet EU soars into open beta originally appeared on Massively on Wed, 29 May 2013 12:00:00 EST. Please see our terms for use of feeds.

                                                Permalink | Email this | Comments

                                                  ]]>                                                  dragondragonsdragons-prophetDragons-prophet-EUDragons-Prophet-Europehousinginfernuminfernum-productionsopen-betarunewakerrunewaker-entertainmentsoesonysony-online-entertainmenttrailervideoWed, 29 May 2013 12:00:00 EST                                                  <![CDATA[Lindvior touches down in Lineage 2 today]]>http://massively.joystiq.com/2013/05/29/lindvior-touches-down-in-lineage-2-today/http://massively.joystiq.com/2013/05/29/lindvior-touches-down-in-lineage-2-today/http://massively.joystiq.com/2013/05/29/lindvior-touches-down-in-lineage-2-today/#commentsFiled under: , , , , ,

                                                  Lindvior touches down today in Lineage 2
                                                  Today's the day that the goddess Shilen unleashes her fury on the world of Aden in the form of her champion, the dragon Lindvior, Lord of the Western Winds. But Lineage II's latest update, Lindvior Goddess of Destruction, brings more than just this epic dragon boss to test the mettle of players. It also adds more Awakened classes (bringing the total from eight to 34), three new zones, and plenty of new armor and weapons. On top of that, players will have a new character customization system with over 100 new looks.

                                                  Gon Namkung, L2's development director, stated, "This is by far the most intricate challenge that players have ever faced in Lineage II throughout its long and storied history. The entire Lineage II development team is proud of this achievement and we are confident only the best players will defeat Lindvior." He continued, "We issue this challenge to all our players, who will defeat Lindvior first!?"

                                                  [Sourse: NCsoft press release]

                                                  MassivelyLindvior touches down in Lineage 2 today originally appeared on Massively on Wed, 29 May 2013 11:00:00 EST. Please see our terms for use of feeds.

                                                  Permalink | Email this | Comments

                                                    ]]>                                                    Awakened-classesexpansionf2pfantasyfree-to-playGon-NamkungLindviorLindvior-Goddess-of-Destructionlineagelineage-2lineage-iincsoftnew-raid-bossnew-zonesraidWed, 29 May 2013 11:00:00 EST                                                    <![CDATA[Infinite Crisis adds Cyborg to the mix]]>http://massively.joystiq.com/2013/05/28/infinite-crisis-adds-cyborg-to-the-mix/http://massively.joystiq.com/2013/05/28/infinite-crisis-adds-cyborg-to-the-mix/http://massively.joystiq.com/2013/05/28/infinite-crisis-adds-cyborg-to-the-mix/#commentsFiled under: , , , , , , , ,

                                                    Infniite Crisis new dude
                                                    While the last superhero to join the Infinite Crisis lineup was mystically imbued, the newest member is a mix of man and machine. Today Turbine announced the addition of Cyborg to the roster of champions as well as released new art for the Green Lantern.

                                                    Like you'd expect a man with an energy cannon for an arm, Cyborg is a ranged fighter, doling out powerful blasts while dodging direct confrontation with melee. His various skills include Cybernetic Targeting, Cascade, and Plasma Cannon. Charged Burst is an AoE attack and Tracer Shot marks opponents and adds a debuff that can be triggered for additional effects by his other skills.

                                                    Check out the reveal video after the break for some tips on fighting as -- and fighting against -- this newest champion. After the video, take a look at the newest Infinite Crisis art, showing off Arcane, Prime, and Atomic versions of Green Lantern.

                                                    [Source: Turbine press release]

                                                    Continue reading Infinite Crisis adds Cyborg to the mix

                                                    MassivelyInfinite Crisis adds Cyborg to the mix originally appeared on Massively on Tue, 28 May 2013 12:00:00 EST. Please see our terms for use of feeds.

                                                    Permalink | Email this | Comments

                                                      ]]>                                                      betaCyborgDC-ComicsInfinite-Crisisinfinite-crisis-videoMOBAnew-championranged-classTurbineTue, 28 May 2013 12:00:00 EST                                                      <![CDATA[Guild Wars 2 video highlights Last Stand at Southsun]]>http://massively.joystiq.com/2013/05/28/guild-wars-2-video-highlights-last-stand-at-southsun/http://massively.joystiq.com/2013/05/28/guild-wars-2-video-highlights-last-stand-at-southsun/http://massively.joystiq.com/2013/05/28/guild-wars-2-video-highlights-last-stand-at-southsun/#commentsFiled under: , , , , , ,

                                                      Guild Wars 2 video highlights Last Stand at Southsun
                                                      Later today, Guild Wars 2 players will get to enjoy new content when the Last Stand at Southsun update goes live. But why wait to see what's in store? ArenaNet has released a gameplay video showing off footage of some of this update's highlights, including a glimpse of a new boss encounter and a glance at the limited-time achievements and rewards available.

                                                      Not enough detail in that short clip nestled after the break? Then join the ArenaNet community team on the studio's official Twitch.tv channel at 3:00 p.m. EDT today (May 28th) for a livestream look.

                                                      [Source: ArenaNet press release]

                                                      Continue reading Guild Wars 2 video highlights Last Stand at Southsun

                                                      MassivelyGuild Wars 2 video highlights Last Stand at Southsun originally appeared on Massively on Tue, 28 May 2013 11:00:00 EST. Please see our terms for use of feeds.

                                                      Permalink | Email this | Comments

                                                        ]]>                                                        anetarenanetbuy-to-playfantasyguild-wars-2gw2Last-Stand-at-Southsunlimited-time-achievementslivestreamncsoftpatchupdateTue, 28 May 2013 11:00:00 EST                                                        <![CDATA[Chaos Theory: Throwing TSW's next themed party]]>http://massively.joystiq.com/2013/05/27/chaos-theory-throwing-tsws-next-themed-party/http://massively.joystiq.com/2013/05/27/chaos-theory-throwing-tsws-next-themed-party/http://massively.joystiq.com/2013/05/27/chaos-theory-throwing-tsws-next-themed-party/#commentsFiled under: , , , , , ,

                                                        Chaos Theory Throwing TSW's next themed party
                                                        I spy with my little eye... a trend! With last month's announcement of The Secret World's next update, I noticed a certain motif. It appears that beyond just adding new content, the conspiracy game is getting in on the party planning business, throwing themed bashes for players to enjoy. And the players themselves get to arrive as iconic guests of honor! While not making you the exact person, the two most recent DLCs effectively give you the chance to participate in adventures with the persona of a beloved and/or well-known character: Indiana Jones headlined Issue #6, and James Bond will be the star of Issue #7. That leads me to wonder: What -- or who -- will we meet next?

                                                        We've already offered some suggestions for new locales for future TSW updates, so why not toss out a few ideas on the next major icons to represent? I know you all have some favorite role you'd love to slip into, so come add your suggestions to these possibilities.

                                                        Continue reading Chaos Theory: Throwing TSW's next themed party

                                                        MassivelyChaos Theory: Throwing TSW's next themed party originally appeared on Massively on Mon, 27 May 2013 18:00:00 EST. Please see our terms for use of feeds.

                                                        Permalink | Email this | Comments

                                                          ]]>                                                          3-faction3-factionsBladebuffybuffy-the-vampire-slayerbuy-to-playchaos-theoryconspiracyconspiracy-thriillerdark-days-are-comingDLC-ideasdragonfactionfaction-pvpfantasyfeaturedfuncomhorrorilluminatiinspector-gadgetissue-1issue-1-unleashedIssue-6Issue-6-The-Last-Train-to-CairoIssue-7jackie-ChanJediJohn-McLanemythologyopinionRockysci-fantasysecret-worldsecret-world-chaos-theorysherlock-holmesSithskill-basedsubscriptionlesstemplarsthe-secret-worldthe-secret-world-chaos-theorythree-factionthree-faction-pvpthree-factionstswtsw-chaos-theorytsw-dragonUnleashedwho-to-playMon, 27 May 2013 18:00:00 EST                                                          <![CDATA[Fan brings SWTOR's Darth Malgus to life]]>http://massively.joystiq.com/2013/05/27/fan-brings-swtors-darth-malgus-to-life/http://massively.joystiq.com/2013/05/27/fan-brings-swtors-darth-malgus-to-life/http://massively.joystiq.com/2013/05/27/fan-brings-swtors-darth-malgus-to-life/#commentsFiled under: , , , , ,

                                                          Fan brings SWTOR's Darth Malgus to life
                                                          It's no secret that as players, we can really get into our favorite MMOs. But some folks have the skills and dedication to take this much further than the rest of us mere mortals! Such is the case with Julian Checkley, who sent us a video in which he plucked Darth Malgus from Star Wars: The Old Republic's Deceived trailer right off the screen and plunked him down in real life.

                                                          Built from scratch in his workshop in Ireland, the costume took six weeks to complete. This footage was actually a spur of the moment idea to show off the just-complete project, and Checkley noted that no CGI was used. He did, however, lament that the costume was lacking a sexy blue Twi'lek partner. Watch him don the costume for the first time after the break, and tell us if that isn't just the definition of awesome!

                                                          [Thanks to our tipster!]

                                                          Continue reading Fan brings SWTOR's Darth Malgus to life

                                                          MassivelyFan brings SWTOR's Darth Malgus to life originally appeared on Massively on Mon, 27 May 2013 11:20:00 EST. Please see our terms for use of feeds.

                                                          Permalink | Email this | Comments

                                                            ]]>                                                            biowarecosplaycostumecostumeseaelectronic-artsf2pfree-to-playlucasartssci-fistar-warsstar-wars-the-old-republicswtorthe-old-republictorMon, 27 May 2013 11:20:00 EST                                                            <![CDATA[The Stream Team: Day off edition, May 27 - June 2, 2013]]>http://massively.joystiq.com/2013/05/27/the-stream-team-day-off-edition-may-27-june-2-2013/http://massively.joystiq.com/2013/05/27/the-stream-team-day-off-edition-may-27-june-2-2013/http://massively.joystiq.com/2013/05/27/the-stream-team-day-off-edition-may-27-june-2-2013/#commentsFiled under: , ,

                                                            The Stream Team Day off edition, May 27 June 2, 2013
                                                            Oh, glorious day! With the exception of those chaps (and chapettes) working in emergency services and the like, many folks all over the U.S. get the chance this week to experience that all-too-rare phenomenon: the Extra Day Off. And all I can say is Hallelujah!

                                                            Extra days off are free time to sit back and do nothing without a care in the world... oh, whom are we kidding? They are often filled with all those chores and tasks you just don't have time to get to during the work week and are too exhausted to deal with during the weekend. And in the case of holidays with special meaning, perhaps your thoughts and activities are turned toward some type of special observance.

                                                            Whether your day is filled with frolicking and festivities, food and family, some combination thereof, or even none of the above, Massively TV will be right here when you have a spare moment. With plenty of live shows and lively reruns, The Stream Team will help you make the most of your day off, not to mention help you get through the rest of the week as well!

                                                            Continue reading The Stream Team: Day off edition, May 27 - June 2, 2013

                                                            MassivelyThe Stream Team: Day off edition, May 27 - June 2, 2013 originally appeared on Massively on Mon, 27 May 2013 10:00:00 EST. Please see our terms for use of feeds.

                                                            Permalink | Email this | Comments

                                                              ]]>                                                              achaeaactivisionagonaionanetAnno-Onlineaq-worldsarenanetarkark-hunterarkfallascensionaventurinebiowareblizzardblizzard-entertainmentbrowserbrowser-basedbuy-to-playconsoleconsolesdarkfalldarkfall-unholy-warsdefiancedfDotA-2dragondragonsdragons-propheteaelectronic-artseq-2eq-iieq2eqiieverquest-2everquest-iif2pfactionfantasyfeaturedfpsfrfree-realmsfree-to-playfuncomguild-warsguild-wars-2gwgw2hi-rezhi-rez-studioshorrorhousinginfernuminfernum-productionskid-friendlykidskids-mmolivestreamlivestreaminglivestreamslucasartsmassively-metamassively-tvmetammo-shootermmofpsmobamultiplayer-online-battle-arenamv-guidemv-tvmvguidemvtvmythologyncsoftopen-pvpplanetsideplanetside-2playstation-3playstation3pollps2ps3pvprunewakerrunewaker-entertainmentsandboxsci-fantasysci-fisecret-worldshooterskill-basedSmitesoesonysony-online-entertainmentstar-warsstar-wars-the-old-republicstreamstream-schedulestream-teamstreamersstreamingstreamteamsubscriptionlessswtorsyfythe-old-republicthe-secret-worldthe-stream-teamthird-person-shooterthreshold-rpgtortpstransmedia-synergytriontrion-worldstruly-freetswtvtwitchtwitch-tvunholy-warswarcraftworld-of-warcraftwowxboxMon, 27 May 2013 10:00:00 EST                                                              <![CDATA[The Tattered Notebook: EQ Next scoops up Emily 'Domino' Taylor]]>http://massively.joystiq.com/2013/05/25/the-tattered-notebook-eq-next-ranks-swell-with-the-known/http://massively.joystiq.com/2013/05/25/the-tattered-notebook-eq-next-ranks-swell-with-the-known/http://massively.joystiq.com/2013/05/25/the-tattered-notebook-eq-next-ranks-swell-with-the-known/#commentsFiled under: , , , , , ,

                                                              The Tattered Notebook EQ Next ranks swell with the known
                                                              A curious thing happened as I was strolling through EverQuest II this past week. It seems there was a bit of commotion in the Norrathian community, with races good and evil cheering and dancing in the streets. Personally, I didn't even know Sarnak could move like that! What was the catalyst of this celebration? Why, didn't you hear -- there was news about EverQuest Next! And with the scarcity of that kind of treasure, it's understandable that folks went a'frolicking. But this wasn't just any old news, either. This week, fans learned that Emily "Domino" Taylor, also known as Pentapod, was returning to the EverQuest franchise as the producer for EQ Next.

                                                              Can the presence of just one person really send prospective players into a tizzy of anticipation? Yes, it can. I watched as a number of EQII players, once ambivalent or on the fence about EQN, not only look twice at the upcoming sandbox but hop right on over into the newest Norrath's camp. More eyes than ever are watching the development of this game (even though there is scant little to watch at the moment). And this is why.

                                                              Continue reading The Tattered Notebook: EQ Next scoops up Emily 'Domino' Taylor

                                                              MassivelyThe Tattered Notebook: EQ Next scoops up Emily 'Domino' Taylor originally appeared on Massively on Sat, 25 May 2013 18:00:00 EST. Please see our terms for use of feeds.

                                                              Permalink | Email this | Comments

                                                                ]]>                                                                craftingDominoEmily-Domino-TaylorEmily-Tayloreqeq-2eq-iieq-nexteq2eqiieqneverquesteverquest-2everquest-iieverquest-nextf2pfantasyfeaturedfree-to-playopinionSmedleysoesonysony-online-entertainmenttattered-notebookthe-tattered-notebookSat, 25 May 2013 18:00:00 EST