Massively Speaking http://massively.joystiq.com This is the Massively podcast http://massively.joystiq.com/media/feedlogo.gif Massively http://massively.joystiq.com en-us Copyright 2013 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/Massively SpeakingJoystiqMassively Speaking<![CDATA[MechWarrior Online brings out the Firebrand]]>http://massively.joystiq.com/2013/06/04/mechwarrior-online-brings-out-the-firebrand/http://massively.joystiq.com/2013/06/04/mechwarrior-online-brings-out-the-firebrand/http://massively.joystiq.com/2013/06/04/mechwarrior-online-brings-out-the-firebrand/#commentsFiled under: , , , , , ,

MechWarrior Online brings out the Firebrand
MechWarrior Online's latest update is burning up the charts (or really anything else it comes in contact with), as the game has introduced the Firebrand version of the JagerMech for players to try out. This new hero 'mech is all about dual weapons and long-range damage. It's also water-resistant -- or at least we assume from the video.

This patch includes several other little odds and ends, including a World War 2-themed Sherman tank pattern for 'mechs that want to hunker down and pretend that they're a totally innocent hill. Players also have an even larger library of trial 'mechs to test, including the Spider, Hunchback, and Atlas.

You can watch the Firebrand trailer after the jump!

Continue reading MechWarrior Online brings out the Firebrand

MassivelyMechWarrior Online brings out the Firebrand originally appeared on Massively on Tue, 04 Jun 2013 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>f2pfirebrandfree-to-playmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopatchpiranhapiranha-gamessci-fitrailerupdatevideoTue, 04 Jun 2013 16:30:00 EST<![CDATA[MechWarrior Online introduces new map in which players can die painfully]]>http://massively.joystiq.com/2013/05/21/mechwarrior-online-introduces-new-map-in-which-players-can-die-p/http://massively.joystiq.com/2013/05/21/mechwarrior-online-introduces-new-map-in-which-players-can-die-p/http://massively.joystiq.com/2013/05/21/mechwarrior-online-introduces-new-map-in-which-players-can-die-p/#commentsFiled under: , , , , , ,

MechWarrior Online introduces new map with allnew ways to die
MechWarrior Online's newest map, the Canyon Network, is riddled with slot canyons, steep drops, and high plateaus. As part of MWO's latest update, the Canyon Network is meant to provide a playground for snipers and strategic thinkers.

The Blackjack has been named as the new Mech of the Month, with the Jenner donning the mantle of Champion Mech. As part of the content update, new cobra camo patterns and faction cockpit medallions have been added to the store.

Skip below the cut to check out videos of the new Canyon Network and the Blackjack in action.

[Source: MWO press release]

Continue reading MechWarrior Online introduces new map in which players can die painfully

MassivelyMechWarrior Online introduces new map in which players can die painfully originally appeared on Massively on Tue, 21 May 2013 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>blackjackcanyon-networkf2pfree-to-playjennermechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopiranhapiranha-gamessci-fivideovideosTue, 21 May 2013 17:00:00 EST<![CDATA[Not So Massively: Yet another D3 exploit, Star Citizen pay-to-win debate, and MOBA news]]>http://massively.joystiq.com/2013/05/13/not-so-massively-yet-another-d3-exploit-star-citizen-pay-to-wi/http://massively.joystiq.com/2013/05/13/not-so-massively-yet-another-d3-exploit-star-citizen-pay-to-wi/http://massively.joystiq.com/2013/05/13/not-so-massively-yet-another-d3-exploit-star-citizen-pay-to-wi/#commentsFiled under: , , , , , , , , , , , , , , , , , , , , , ,

Not So Massively Yet another D3 exploit, Star Citizen paytowin debate, and MOBA news
Diablo III was hit with yet another exploit this week as players discovered a way to duplicate gold via a bug in the auction house. Blizzard responded by shutting down the auction house but did not perform a server rollback to reverse the damage. Star Citizen clarified its stance on the lifetime insurance available to veteran backers amidst debate over whether it gives early adopters an unfair advantage over other players. Path of Exile also released a new Letters of Wraeclast lore feature in its latest update, and MechWarrior Online's update 15 added a new Misery mech.

Dota 2 began preparations for its biggest world championship tournament yet with the release of a new Interactive Compendium that players can use to stay up to date with the matches. Rise of Immortals has now officially launched its Battle For Graxia revamp, and Infinite Crisis officially entered closed beta this week with the release of new champion The Joker. Finally, Smashmuck Champions released its hilarious new community-designed champion that's half platypus and half unicorn.

Continue reading Not So Massively: Yet another D3 exploit, Star Citizen pay-to-win debate, and MOBA news

MassivelyNot So Massively: Yet another D3 exploit, Star Citizen pay-to-win debate, and MOBA news originally appeared on Massively on Mon, 13 May 2013 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>action-rpgbatmanbattle-for-graxiabattlenetblizzardblizzard-entertainmentchris-robertscloud-imperiumcompetitive-gamingd3dcdc-comicsdiablodiablo-2diablo-3diablo-iidiablo-iiidotadota-2e-sporte-sportsesportesportsf2pfantasyfeaturedfree-to-playgothic-fantasygraxiaindieinfinite-crisisinsurancejokerkiz-studioslifetime-insurancemobamultiplayernewsnot-so-massivelynsmonline-multiplayeropinionpetroglyphpetroglyph-gamespvprise-of-immortalsroiround-uprounduprpgsandboxsci-fismashmuckstar-citizensupermanthe-jokerturbinevalvevideovideoswarner-broswonder-womanWraeclastMon, 13 May 2013 20:00:00 EST<![CDATA[MechWarrior Online introduces the Misery with Update 15]]>http://massively.joystiq.com/2013/05/07/mechwarrior-online-introduces-the-misery-with-update-15/http://massively.joystiq.com/2013/05/07/mechwarrior-online-introduces-the-misery-with-update-15/http://massively.joystiq.com/2013/05/07/mechwarrior-online-introduces-the-misery-with-update-15/#commentsFiled under: , , , , ,

MechWarrior Online introduces Misery, a 'mech with 'tude
Misery loves company, they say (look it up), but will people actually go seeking it? Piranha Games hopes players will, as it has introduced the Misery 85-ton 'mech into MechWarrior Online. The metal beast has an armament that includes plenty of lasers, a Gauss rifle, and an SRM-6 (again, look it up).

The new update goes beyond the debut of the Misery. There are four additional trial 'mechs to test out, color customization for Hero 'mechs, and a crazy Buccaneer premium pattern.

Read up on our preview of Update 15 and don't miss out on the video showing off the Misery in action after the jump!

Continue reading MechWarrior Online introduces the Misery with Update 15

MassivelyMechWarrior Online introduces the Misery with Update 15 originally appeared on Massively on Tue, 07 May 2013 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>f2pfree-to-playhero-mechmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemiserymwopiranhapiranha-gamessci-fiupdate-15videoTue, 07 May 2013 15:30:00 EST<![CDATA[MechWarrior Online devs talk Update 15, new UI, new mechs]]>http://massively.joystiq.com/2013/04/16/mechwarrior-online-devs-talk-update-15-new-ui-new-mechs/http://massively.joystiq.com/2013/04/16/mechwarrior-online-devs-talk-update-15-new-ui-new-mechs/http://massively.joystiq.com/2013/04/16/mechwarrior-online-devs-talk-update-15-new-ui-new-mechs/#commentsFiled under: , , , , , , , , , ,

MechWarrior Online screenshot
Mechwarrior Online is about to hit its fifth month of open beta, with promises of a late summer launch. With that launch comes continued production, new content, plenty of bug fixes, and tweaks. With all of the new content -- said to be delivered on a regular schedule -- comes plenty of challenges for the developer team.

We sat down with Piranha Games' creative director, Bryan Ekman, and president, Russ Bullock, to talk about how things have been going and where they're going in the future. Not only did we get the scoop on the next community-designed Mech to be released, but we also found out about new HUD improvements, aid for players who suffer from high ping, and much more. Click past the cut for all the details!

Continue reading MechWarrior Online devs talk Update 15, new UI, new mechs

MassivelyMechWarrior Online devs talk Update 15, new UI, new mechs originally appeared on Massively on Tue, 16 Apr 2013 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>beau-hindmanbryan-ekmanf2pfeaturedfree-to-playinterviewinterviewsmechmechsMechWarriormechwarrior-mmomechwarrior-onlinemwopiranhapiranha-gamespreviewpreviewsruss-bullocksci-fiTue, 16 Apr 2013 13:00:00 EST<![CDATA[Look forward to MechWarrior Online updates through April]]>http://massively.joystiq.com/2013/04/03/look-forward-to-mechwarrior-online-updates-through-april/http://massively.joystiq.com/2013/04/03/look-forward-to-mechwarrior-online-updates-through-april/http://massively.joystiq.com/2013/04/03/look-forward-to-mechwarrior-online-updates-through-april/#commentsFiled under: , , , , , , ,

Still no option to outfit your machine with spinners, sadly.
If you thought that April would bring an overhaul of MechWarrior Online that turned the game into a robust farming simulator... well, no. Why would you even think that? But it will bring a whole lot of other updates to the game as outlined in a new letter from the game's creative director, starting with improved team functionality and UI improvements. That goes along nicely with the addition of air strike and artillery consumables, allowing players (especially scouts) to bring down a little extra firepower in a match.

The development team is also introducing a new class of special 'Mech, the Champions, which are custom configurations that sport a permanent 5% experience boost. That's in addition to improvements to the game's overall performance and more community events for MechWarrior Online players the world over. So that's a no on farming, but a yes on several improvements that should make your days of stomping around in an enormous walking tank more enjoyable.

MassivelyLook forward to MechWarrior Online updates through April originally appeared on Massively on Wed, 03 Apr 2013 19:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>consumablesf2pfree-to-playgame-mechanicsgroup-mechanicsmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopatchespiranhapiranha-gamesquality-of-lifesci-fiuiupcoming-improvementsupcoming-patchesuser-interfaceWed, 03 Apr 2013 19:30:00 EST<![CDATA[PAX East 2013: Say hello to MechWarrior Online's new trailer]]>http://massively.joystiq.com/2013/03/22/pax-east-2013-say-hello-to-mechwarrior-onlines-new-trailer/http://massively.joystiq.com/2013/03/22/pax-east-2013-say-hello-to-mechwarrior-onlines-new-trailer/http://massively.joystiq.com/2013/03/22/pax-east-2013-say-hello-to-mechwarrior-onlines-new-trailer/#commentsFiled under: , , , , , , ,

Say hello to Mechwarrior Online's new trailer
There's nothing quite like convention season for bringing out a bumper crop of new videos and trailers. Today we're bringing you MechWarrior Online's new PAX East 2013 trailer, which shows off some new gameplay and highlights the title's newest features and perks.

MechWarrior Online went into open beta late in 2012 and has had six major content patches since then. New testing grounds, cockpit items and consumables, a whole passel of UI and user control updates, and new 'mechs and maps have been added to the game since the open beta launch. March will also see several in-game events going on, which folks are invited to sign up to enjoy.

Skip below the cut to check out the newest trailer.

Continue reading PAX East 2013: Say hello to MechWarrior Online's new trailer

MassivelyPAX East 2013: Say hello to MechWarrior Online's new trailer originally appeared on Massively on Fri, 22 Mar 2013 08:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>conconventioneventevent-coverageeventsexpof2pfree-to-playmassively-event-coveragemechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopaxpax-2013pax-eastpax-east-2013penny-arcade-expopiranhapiranha-gamessci-fitrailertrailersvideovideosFri, 22 Mar 2013 08:00:00 EST<![CDATA[Mechwarrior Online has big plans for March]]>http://massively.joystiq.com/2013/03/04/mwo-has-big-plans-for-march/http://massively.joystiq.com/2013/03/04/mwo-has-big-plans-for-march/http://massively.joystiq.com/2013/03/04/mwo-has-big-plans-for-march/#commentsFiled under: , , , , , , ,

MWO has big plans for March
March is upon us! March has actually been upon us for a handful of days, but those days were lame. Now is the time of awesome days, and those days will be full of updates and new features for MechWarrior Online. Creative Director Bryan Ekman has laid out the team's plan for the coming month.

Training grounds, an offline game mode that loads a player into a random map with eight enemy targets to test out their current 'Mech, will be made available. This game mode is "just the beginning" of an incoming wealth of training options. Consumables will extend the module system and will be available for C-Bill and MC purchase. A host of UI, user controls, and statistics-tracking improvements are coming in, as is Tourmaline Desert, MWO's largest map to date.

The ability to acquire fuzzy dice for one's cockpit has been hinted at. You know what to do, soldiers.

MassivelyMechwarrior Online has big plans for March originally appeared on Massively on Mon, 04 Mar 2013 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bryan-ekmandev-diaryf2pfree-to-playmarchmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopiranhapiranha-gamessci-fiupdateupdatesMon, 04 Mar 2013 19:00:00 EST<![CDATA[MechWarrior opens up a big map and a medium 'Mech]]>http://massively.joystiq.com/2013/02/19/mechwarrior-opens-up-a-big-map-and-a-medium-mech/http://massively.joystiq.com/2013/02/19/mechwarrior-opens-up-a-big-map-and-a-medium-mech/http://massively.joystiq.com/2013/02/19/mechwarrior-opens-up-a-big-map-and-a-medium-mech/#commentsFiled under: , , , , , ,

The Berkshires, 2/9/13
In the destructive world of MechWarrior Online, every 'Mech has its niche. Some machines thrive on maps with tight corridors and small boundaries, allowing them to get up close and personal. Others live on the ability to reach out and touch their targets at extreme ranges, preferably with missiles. It's the latter type that will enjoy the game's newest map, Alpine Peaks, which is the largest map yet added to the game. As the zone is filled with snowy vistas and sniping points, close-range machines will fare poorly here, but anything with good ranged capacity will find a lot to love.

Not coincidentally, the most recent update also adds a new 'Mech for pilots, the Trebuchet. Available in five variants, this 50-ton machine features twin LRM-15s in all but one variant, allowing players to pack quite a punch at range. It's the perfect sort of 'Mech for tromping around in a snowy environment and spreading damage over a large range, so we can imagine it'll see some use on the new map.

[Source: Piranha Games press release]

MassivelyMechWarrior opens up a big map and a medium 'Mech originally appeared on Massively on Tue, 19 Feb 2013 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>additionsf2pfree-to-playlarge-maplong-range-mechmapmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemedium-mechmwonew-mapnew-mechnewspatchpatchespiranhapiranha-gamessci-fiTue, 19 Feb 2013 19:00:00 EST<![CDATA[MechWarrior Online shows off its pretty new baby]]>http://massively.joystiq.com/2013/02/05/mechwarrior-online-shows-off-its-pretty-new-baby/http://massively.joystiq.com/2013/02/05/mechwarrior-online-shows-off-its-pretty-new-baby/http://massively.joystiq.com/2013/02/05/mechwarrior-online-shows-off-its-pretty-new-baby/#commentsFiled under: , , , , , , , ,

It's not very pretty after all.
Would you call your multi-ton death machine a pretty baby? If you're playing MechWarrior Online you just might, especially since that's the name of the newest hero 'Mech introduced to the game. Considering the machine is loaded with an LRM 15, a PPC, two lasers, and a high top speed for a 80-ton 'Mech, we can see why you might coo affectionately that it's your pretty little darling yes it is.

But maybe your existing 'Mech is already the apple of your eye. That's all right, there's still plenty to like in February. The team at Piranha Games is working on a UI overhaul for the MechLab to allow players a clearer picture of what happens when upgrades are slotted in. There's also the third phase of matchmaking, new patterns for decorating your machine of choice, and performance improvements for all computers. But if you're still excited at the thought of a pretty new machine to pilot, you can check out a trailer for the prettiest of all babies past the cut.

[Source: Piranha Games press release]

Continue reading MechWarrior Online shows off its pretty new baby

MassivelyMechWarrior Online shows off its pretty new baby originally appeared on Massively on Tue, 05 Feb 2013 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>coming-patchesdecorationf2pfree-to-playmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwonew-mechpatchespiranhapiranha-gamespreviewssci-fitrailertrailersuiupcoming-patchesuser-interfacevideovideosTue, 05 Feb 2013 18:30:00 EST<![CDATA[Massively Interview: Piranha Games' Russ Bullock talks MechWarrior Online]]>http://massively.joystiq.com/2013/01/23/massively-interview-piranha-games-russ-bullock-talks-mechwarri/http://massively.joystiq.com/2013/01/23/massively-interview-piranha-games-russ-bullock-talks-mechwarri/http://massively.joystiq.com/2013/01/23/massively-interview-piranha-games-russ-bullock-talks-mechwarri/#commentsFiled under: , , , , , ,

Death's Knell
Is there anything more fun than massive suits of mechanical armor smashing into one another and firing lasers all over the place? MechWarrior Online, the free-to-play MMO-like set in the MechWarrior universe and developed by Piranha Games, would argue that the answer to that question is pretty obvious.

Piranha has just today announced the addition of a new Command Hero Mech, christened Death's Knell. The mech is tiny by MechWarrior standards, weighing in at only 25 tons, but it packs four powerful lasers on each arm and is quite fast to boot. Piranha also confirmed the addition of the familiar Bitching Betty startup sequence, which should give longtime MechWarrior fans a jolt of nostalgia straight through the eardrums.

We sat down with Russ Bullock, president of Piranha Games, to talk mechs, MMOs, and the future of MechWarrior Online. Check out the full interview and a video of Death's Knell in action after the break.

Continue reading Massively Interview: Piranha Games' Russ Bullock talks MechWarrior Online

MassivelyMassively Interview: Piranha Games' Russ Bullock talks MechWarrior Online originally appeared on Massively on Wed, 23 Jan 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>f2pfeaturedfree-to-playfreemiuminterviewinterviewsmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemicrotransactionmicrotransactionsmwopiranhapiranha-gamespremiumsci-fitrailertrailersvideovideosWed, 23 Jan 2013 15:00:00 EST<![CDATA[MechWarrior Online creeps you out with the new Spider mech]]>http://massively.joystiq.com/2013/01/15/mechwarrior-online-creeps-you-out-with-the-new-spider-mech/http://massively.joystiq.com/2013/01/15/mechwarrior-online-creeps-you-out-with-the-new-spider-mech/http://massively.joystiq.com/2013/01/15/mechwarrior-online-creeps-you-out-with-the-new-spider-mech/#commentsFiled under: , , ,

Mechwarrior Online creeps you out with the new Spider mech
OK, so MechWarrior Online's new Spider mech may not look particularly creepy in screenshots, but when you see it in action, you may have a flare up of the old arachnophobia. The Spider is "one of the most maneuverable and agile of the Light Mechs" complete with eight jumpjets and an unmatched turning radius.

In addition to the new mech, Piranha Games and Infinite Game Publishing have announced the game's first double XP event running from Friday, January 18 at 10 a.m. PST until Monday, January 21 at 10 a.m. PST. Previous XP bonuses are stackable with this event, so gather together those Founder benefits and premium game time boosts to get the most out of the weekend.

Also be sure to check out our MechWarrior Online gallery below, complete with five new screenshots of the Spider mech and two of the upcoming Commando Hero Mech known as Death's Knell, available on January 22.

Gallery: MechWarrior Online screenshots


[Source: Piranha Games press release]

MassivelyMechWarrior Online creeps you out with the new Spider mech originally appeared on Massively on Tue, 15 Jan 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>deaths-knellf2pfree-to-playinfinite-game-publishingmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopiranhapiranha-gamessci-fispiderTue, 15 Jan 2013 18:00:00 EST<![CDATA[MechWarrior delivers whopping update with twin dragon 'Mechs]]>http://massively.joystiq.com/2012/12/18/mechwarrior-delivers-whopping-update-with-twin-dragon-mechs/http://massively.joystiq.com/2012/12/18/mechwarrior-delivers-whopping-update-with-twin-dragon-mechs/http://massively.joystiq.com/2012/12/18/mechwarrior-delivers-whopping-update-with-twin-dragon-mechs/#commentsFiled under: , , , , ,

MechWarrior delivers year's largest update with twin dragon 'Mechs
Right in time for the holidays, Piranha Games has delivered a whopping gift for all of its players in the form of the year's largest content update for MechWarrior Online.

Let's tick off the list, shall we? First up is the brand-new conquest mode, which allows players to capture and hold five different locations. Next is the addition of three new 'Mechs: the Twin Dragons and the Stalker Assault. Following that, players will enjoy an economy update, a bonus to currency acquisition for new players, a night map of River City, new ways to customize a 'Mech's look, and cool holiday items. Finally, the team's throwing in plenty of bug and performance fixes free of charge.

If you give one of the new 'Mechs a try, definitely let us know how it handles! We've got the trailer for this update after the cut.

[Source: Piranha Games' press release]

Continue reading MechWarrior delivers whopping update with twin dragon 'Mechs

MassivelyMechWarrior delivers whopping update with twin dragon 'Mechs originally appeared on Massively on Tue, 18 Dec 2012 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>content-updatef2pfree-to-playin-game-eventmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwonew-yearsnew-years-daypatchpiranhapiranha-gamessci-fiupdatevideoTue, 18 Dec 2012 17:00:00 EST<![CDATA[MechWarrior Online and Penny Arcade team up for game promotion]]>http://massively.joystiq.com/2012/12/13/mechwarrior-online-and-penny-arcade-team-up-for-game-promotion/http://massively.joystiq.com/2012/12/13/mechwarrior-online-and-penny-arcade-team-up-for-game-promotion/http://massively.joystiq.com/2012/12/13/mechwarrior-online-and-penny-arcade-team-up-for-game-promotion/#commentsFiled under: , , , , ,

MechWarrior Online and Penny Arcade team up for game promotion
Geek favorite webcomic Penny Arcade and developer Piranha Games have a deal for you, but be warned: Space Ostriches might be involved. Piranha announced that players now can grab a free one-day premium time upgrade for their MechWarrior Online accounts. This premium time awards players with 50% more experience and 50% more C-bills while it lasts.

The Penny Arcade team penned a two-page pilot safety manual with crucial tips for the game to go with the promotion. Comic co-creator Jerry Holkins said that he took the project partially because of his lifelong interest: "I used to play BattleTech at lunch, when I was in high school. There's a lot of meat in MechWarrior Online, a lot to know, and we wanted to see if we could cover some of the basics in a way that could help people get the most out of it."

[Source: Piranha Games press release]

MassivelyMechWarrior Online and Penny Arcade team up for game promotion originally appeared on Massively on Thu, 13 Dec 2012 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>battletechcomicdealf2pfree-to-playgiveawayhumorJerry-Holkinsmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopenny-arcadepilot-safety-instructionspiranhapiranha-gamespremium-timepromotionsci-fiwebcomicThu, 13 Dec 2012 17:00:00 EST<![CDATA[Today's MechWarrior patch features 8v8 matchmaking, Ilya Muramets, lumps of coal]]>http://massively.joystiq.com/2012/12/04/todays-mechwarrior-patch-features-8v8-matchmaking-ilya-muramet/http://massively.joystiq.com/2012/12/04/todays-mechwarrior-patch-features-8v8-matchmaking-ilya-muramet/http://massively.joystiq.com/2012/12/04/todays-mechwarrior-patch-features-8v8-matchmaking-ilya-muramet/#commentsFiled under: , , , , , , , , ,

New MechWarrior Online hero mech
If the thought of running around 8v8 maps in a giant robot exoskeleton blowing up other players in giant robot exoskeletons makes you go "oh cool," then you'll probably want to continue reading this post about MechWarrior Online.

Today's patch introduces a custom matchmaking feature, new electronic countermeasure functionality, and a new hero mech called the Ilya Muramets CTF-IM Cataphract (say that three times fast). And yes, there's definitely a Santa bobblehead available for your cockpit. You'll find it in the cash shop along with an elf, a lump of coal, and some Christmas lights, all of which may used to pimp out the dashboard of your favorite mech.

Check out the new Ilya via the screenshot gallery below or the video after the break.

[Source: Piranha Games press release]

Gallery: MechWarrior Online screenshots

Continue reading Today's MechWarrior patch features 8v8 matchmaking, Ilya Muramets, lumps of coal

MassivelyToday's MechWarrior patch features 8v8 matchmaking, Ilya Muramets, lumps of coal originally appeared on Massively on Tue, 04 Dec 2012 14:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>f2pfree-to-playgalleryIlya MurametsIlyaMurametsmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwomwo-trailerpiranhapiranha-gamessci-fiscreenshotstrailervideoTue, 04 Dec 2012 14:30:00 EST<![CDATA[MechWarrior Online gives players control over their looks]]>http://massively.joystiq.com/2012/11/27/mechwarrior-online-gives-players-control-over-their-looks/http://massively.joystiq.com/2012/11/27/mechwarrior-online-gives-players-control-over-their-looks/http://massively.joystiq.com/2012/11/27/mechwarrior-online-gives-players-control-over-their-looks/#commentsFiled under: , , , ,

Clown makeup would be way scarier.
Maybe you want your machine of choice to have a careful camouflage pattern to make it harder for your MechWarrior Online opponents to spot you at range. Maybe you just want to cover it in inherently terrifying clown patterns. However you like to decorate your multi-ton 'Mech, you're now able to do so with the release of the game's new Camo Spec patch. This patch adds paint shop functionality to the game and allows players to enjoy a variety of external decorative options as well as cockpit decorations.

Not enough for you? The patch also adds the classic battle announcer from the original MechWarrior computer games as well as the option for Premium players to choose the start date of their enhanced play time. Only a few decorative options are available at launch, but players can expect more in the future, both earned and (presumably) purchased in the game's cash shop.

[Source: Piranha Games press release]

MassivelyMechWarrior Online gives players control over their looks originally appeared on Massively on Tue, 27 Nov 2012 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>camo-speccustomizationdecorationf2pfree-to-playlooking-prettymechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwopaintpatchpatchespiranhapiranha-gamessci-fiupdateupdatesTue, 27 Nov 2012 18:30:00 EST<![CDATA[MechWarrior brings out a new 'Mech and new events]]>http://massively.joystiq.com/2012/11/20/mechwarrior-brings-out-a-new-mech-and-new-events/http://massively.joystiq.com/2012/11/20/mechwarrior-brings-out-a-new-mech-and-new-events/http://massively.joystiq.com/2012/11/20/mechwarrior-brings-out-a-new-mech-and-new-events/#commentsFiled under: , , , ,

AC/5 rounds are how I say thank you.
Sometimes you want to give thanks for the many positive things happening in your life. Other times, you want to give thanks that you're the one piloting a 70-ton marching tank and the other guy isn't. MechWarrior Online is celebrating the latter feeling with the introduction of the Cataphract 'Mech, a heavy unit available with four different loadouts in the game's latest update.

In addition to the new machine, the game has also added a new map, the Frozen City at Night, featuring large shooting lanes and patches of shadow to hide within. There are also two new modules and a new piece of equipment, all of which should help keep a better lock on your target even as they dart around the battlefield.

Last but not least, the development team is hosting a live event tomorrow at 9 p.m. EST on the official livestream channel. If you're a player and want to see how your 'Mech skills hold up against those of the designers, be prepared to throw down with some autocannons tomorrow night.

[Source: Piranha Games press release]

MassivelyMechWarrior brings out a new 'Mech and new events originally appeared on Massively on Tue, 20 Nov 2012 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>cataphractf2pfree-to-playholiday-eventslive-eventlivestreamsmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwonew-mechspatchpatchespiranhapiranha-gamesplay-against-developerssci-fiupdatesTue, 20 Nov 2012 18:30:00 EST<![CDATA[MechWarrior Online celebrates open beta with a new trailer]]>http://massively.joystiq.com/2012/11/05/mechwarrior-online-celebrates-open-beta-with-a-new-trailer/http://massively.joystiq.com/2012/11/05/mechwarrior-online-celebrates-open-beta-with-a-new-trailer/http://massively.joystiq.com/2012/11/05/mechwarrior-online-celebrates-open-beta-with-a-new-trailer/#commentsFiled under: , , , , , , , ,

Shiny new MWO trailer in celebration of glorious beta testing
MechWarrior Online has been in open beta testing for a week now. What better way to celebrate than with a snazzy new trailer? (There is no better way.)

If you're a fan of MWO and its franchise, you're probably part of the open beta already. If you're not already partaking, consider this your official reminder that this is likely the best way to get a sample of the game -- and you'll be helping the team make the game better at the same time! And if you're not a fan, perhaps this trailer can entice you.

Skip below the cut to see the video in all its mech-on-mech glory.

Continue reading MechWarrior Online celebrates open beta with a new trailer

MassivelyMechWarrior Online celebrates open beta with a new trailer originally appeared on Massively on Mon, 05 Nov 2012 14:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabeta-testbeta-testingbeta-testsbetasf2pfree-to-playmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwoobtopen-betaopen-beta-testingpiranhapiranha-gamessci-fitrailertrailersvideovideosMon, 05 Nov 2012 14:00:00 EST<![CDATA[MechWarrior Online: The story of how one MMO got crowd-funded without Kickstarter]]>http://massively.joystiq.com/2012/10/29/mechwarrior-online-the-story-of-how-one-mmo-got-crowd-funded-wi/http://massively.joystiq.com/2012/10/29/mechwarrior-online-the-story-of-how-one-mmo-got-crowd-funded-wi/http://massively.joystiq.com/2012/10/29/mechwarrior-online-the-story-of-how-one-mmo-got-crowd-funded-wi/#commentsFiled under: , , , , ,

MechWarrior Online The story of how one MMO got crowdfunded without Kickstarter
Kickstarter is kind of A Thing now. Oodles of companies are turning to it for all their crowd-funding needs, to varying levels of success. MechWarrior Online has distinguished itself by raising over $5 million in crowd-funding without touching Kickstarter.

If not Kickstarter, where could all that money have come from? Fans, of course! MWO has the advantage of belonging to an existing franchise with fans, and those fans bought over 70,000 of the game's Founder's packages. The Founder's program allowed fans to buy in at any of three price levels ($30, $60, and $120) with varying perks at each level.

Nick Foster, CEO of Infinite Game Publishing's parent company 7G Entertainment, explained some of the rationale behind this approach to funding. "The product will be a lot better for players because of the crowdfunding. It's allowed us to maintain a higher level of ongoing development in the product than if we were waiting for momentum to build immediately after going live. In the next few months, we'll be able to release a lot more features."

MWO hit open beta today, which means you have the perfect opportunity to see for yourself whether they put fans' funds to good use. To read more about MWO's road to funding, check out Gamasutra's full article.

MassivelyMechWarrior Online: The story of how one MMO got crowd-funded without Kickstarter originally appeared on Massively on Mon, 29 Oct 2012 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabusiness-modelscrowd-fundingf2pfree-to-playfundingigpinfinite-game-publishingkickstartermechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwonick-fosteropen-betapiranhapiranha-gamessci-fiMon, 29 Oct 2012 16:00:00 EST<![CDATA[MechWarrior Online launches open beta on Monday]]>http://massively.joystiq.com/2012/10/26/mechwarrior-online-launches-open-beta-on-monday/http://massively.joystiq.com/2012/10/26/mechwarrior-online-launches-open-beta-on-monday/http://massively.joystiq.com/2012/10/26/mechwarrior-online-launches-open-beta-on-monday/#commentsFiled under: , , , ,

Mechwarrior Online launches open beta on Monday
After a bit of a delay last week, MechWarrior Online has announced that it will be entering open beta -- for real this time -- on October 29th.

The delay decision was made after beta player feedback presented concerns for the studio. Lag issues, new player tutorials, balance tweaks, and more have been improved for this open beta launch. To help boost the game's production, over $5M was raised through the game's pre-order Founder's program since July.

MechWarrior Online is set to launch in Q1 2013.

[Source: Infinite Game Publishing press release]

MassivelyMechWarrior Online launches open beta on Monday originally appeared on Massively on Fri, 26 Oct 2012 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betaf2pfree-to-playinfinite-game-publishingmechmechsmechwarriormechwarrior-mmomechwarrior-onlinemwoopen-betapiranhapiranha-gamessci-fiFri, 26 Oct 2012 17:30:00 EST