Massively Speaking http://massively.joystiq.com This is the Massively podcast http://massively.joystiq.com/media/feedlogo.gif Massively http://massively.joystiq.com en-us Copyright 2013 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/Massively SpeakingJoystiqMassively Speaking<![CDATA[City of Steam opens beta doors at 10 p.m. tonight]]>http://massively.joystiq.com/2013/05/10/city-of-steam-opens-beta-doors-at-10-pm-tonight/http://massively.joystiq.com/2013/05/10/city-of-steam-opens-beta-doors-at-10-pm-tonight/http://massively.joystiq.com/2013/05/10/city-of-steam-opens-beta-doors-at-10-pm-tonight/#commentsFiled under: , , , , , , ,

City of Steam opens beta doors at 10 pm tonight
If you've been eagerly awaiting your chance to get into the browser-based steampunk goodness of City of Steam, your wait is nearly over. Clear your Friday night plans because in just a few hours at 10:00 p.m. EDT, the city of Nexus will be welcoming its new residents. And you won't be needing any early access key, as Mechanist Games is throwing the beta doors open wide for any and all!

Returning testers will notice many new features have been added since the closed beta runs, like events, a plethora of new cosmetic items, and more streamlined skill, talent, and crafting systems. And jetpacks -- who can forget the jetpacks! Players will also find over 80 dungeons, over 100 quests, new PvP maps, open Wilderness levels, customizable gear, and more... and that's only to start! The devs have an aggressive release schedule plan of adding new features and content on an almost bi-weekly basis throughout the beta.

For more details on what you can expect, check out Massively's hands-on experience as well as the official open beta features list.

[Source: Mechanist Games press release]

MassivelyCity of Steam opens beta doors at 10 p.m. tonight originally appeared on Massively on Fri, 10 May 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>city-of-steamfantasygoblinmechanistmechanist-gamesnew-contentopen-betasci-fisteampunkThe-NexusFri, 10 May 2013 11:00:00 EST<![CDATA[City of Steam opens up beta to all on May 10th]]>http://massively.joystiq.com/2013/05/07/city-of-steam-opens-up-beta-to-all/http://massively.joystiq.com/2013/05/07/city-of-steam-opens-up-beta-to-all/http://massively.joystiq.com/2013/05/07/city-of-steam-opens-up-beta-to-all/#commentsFiled under: , , , ,

City of Steam opens up beta to all
You know the special beta keys that you needed to access the upcoming City of Steam test? Yeah, well, you don't need them any longer. Mechanist Games has decided to drop the key concept in order to open up the beta to everyone. So starting on May 10th, anyone who has an interest in checking out this steampunk MMO may do so with no hassle.

The upcoming beta test will be continuous and will feature an improved tutorial, events, wiliderness levels, and the Massively-approved technique of jumping. The team also removed the old faction system and teased the possibility of a MOBA-like addition to the game.

[Source: Mechanist Games press release]

MassivelyCity of Steam opens up beta to all on May 10th originally appeared on Massively on Tue, 07 May 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabeta-keysbeta-testcity-of-steamclosed-betafantasygoblinmechanistmechanist-gamesmobaopen-betasci-fisteampunkTue, 07 May 2013 18:00:00 EST<![CDATA[City of Steam open beta early admission starts May 10]]>http://massively.joystiq.com/2013/04/26/city-of-steam-open-beta-early-admission-starts-may-10/http://massively.joystiq.com/2013/04/26/city-of-steam-open-beta-early-admission-starts-may-10/http://massively.joystiq.com/2013/04/26/city-of-steam-open-beta-early-admission-starts-may-10/#commentsFiled under: , , , , , , , ,

City of Steam open beta early admission starts May 10
Want an early look at steampunk browser MMO City of Steam? Mark May 10th on your calendar, because that's the day that Mechanist is launching an "early admission" ramp up to its forthcoming open beta test.

The testing phase will be continuous (as opposed to that trendy weekend-only tomfoolery), and Mechanist will start with three classes and four races with more to come as the process matures. If you don't have a key already, you can get one by subscribing to the City of Steam newsletter on the official site.

MassivelyCity of Steam open beta early admission starts May 10 originally appeared on Massively on Fri, 26 Apr 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabrowserbrowser-basedcity-of-steamcity-of-steam-betafantasygoblinmechanistmechanist-gamessci-fisteampunkFri, 26 Apr 2013 11:00:00 EST<![CDATA[City of Steam gets the green light]]>http://massively.joystiq.com/2013/04/19/city-of-steam-gets-the-green-light/http://massively.joystiq.com/2013/04/19/city-of-steam-gets-the-green-light/http://massively.joystiq.com/2013/04/19/city-of-steam-gets-the-green-light/#commentsFiled under: , , , , ,

City of Steam has been greenlit for Steam
The steampunk browser MMO City of Steam is happy to announce today that it has been greenlit by the benevolent members of Steam.

What does this mean? It means that the people have spoken and they want to see City of Steam on... Steam, and the folks at Mechanist Games can now work with Valve to get the game up on the popular game distribution platform, opening the free-to-play title up to much more exposure.

Out of 1195 games campaigning for a spot on Steam, CoS came out in "8th or 9th place," according to the team's recent news post. Up next: getting out of beta and on to a finished client-based version for Steam.

Congratulations to everyone at Mechanist Games!

MassivelyCity of Steam gets the green light originally appeared on Massively on Fri, 19 Apr 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>city-of-steamfantasygoblingreenlitmechanistmechanist-gamessci-fisteamsteampunkvalveFri, 19 Apr 2013 18:00:00 EST<![CDATA[City of Steam going public with wilderness areas]]>http://massively.joystiq.com/2013/04/09/city-of-steam-going-public-with-wilderness-areas/http://massively.joystiq.com/2013/04/09/city-of-steam-going-public-with-wilderness-areas/http://massively.joystiq.com/2013/04/09/city-of-steam-going-public-with-wilderness-areas/#commentsFiled under: , , , , , , , , ,

City of Steam going public with wilderness areas
If you were just thinking to yourself that the one thing City of Steam needed (besides being released already so you can play!) was an open, public hunting area, you're in luck! In the latest dev blog, Mechanist Games announced the addition of wilderness areas -- zones where many players can congregate, kill respawning mobs, and do quests. The wilderness areas give players a travel route that offers XP and loot along the way. Wilderness areas will also host public events and have an occasional rare spawn.

Even more things are in store for these public areas. The dev blog hints at PvP, as also mentioned in Massively's recent interview.

MassivelyCity of Steam going public with wilderness areas originally appeared on Massively on Tue, 09 Apr 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>city-of-steamdev-blogdev-diaryfantasygoblinmechanistmechanist-gamesnew-areapublic-areapublic-eventssci-fisteampunkwildernessTue, 09 Apr 2013 11:00:00 EST<![CDATA[GDC 2013: City of Steam demo showcases crafting and other streamlined features]]>http://massively.joystiq.com/2013/04/05/gdc-2013-city-of-steam-demo-showcases-crafting-and-other-stream/http://massively.joystiq.com/2013/04/05/gdc-2013-city-of-steam-demo-showcases-crafting-and-other-stream/http://massively.joystiq.com/2013/04/05/gdc-2013-city-of-steam-demo-showcases-crafting-and-other-stream/#commentsFiled under: , , , , , , , , , , , ,

GDC 2013 City of Steam demo showcases crafting and other streamlined features
It may seem like a while has passed since we last experienced City of Steam, the fantasy steampunk MMORPG that fits in your browser. That's because it has! The game's last closed beta testing round was back in December, and fans have been eagerly waiting to get back into the city-state of Nexus. Of course there has been some news to tide us over in the meantime while developers have been turning all of that beta feedback into fixes and updates, but that's not the same; people want to play. Luckily, it's GDC to the rescue!

While the rest of the world won't actually get to access City of Steam until it launches open beta (which is anticipated to be within the next two months!), I was able to dive in and explore the fruits of the devs' winter labors. And let me tell you, they've put their time to good use! I met with Communications Manager Gabriel Laforge and Operations Director Andrew Woodruff from Mechanist Games who showed off all the work that has gone into the game since the beta closed, from graphics to crafting to airships. They also highlighted the game's cash shop and revealed numerous rewards players can earn simply by playing the game.

Continue reading GDC 2013: City of Steam demo showcases crafting and other streamlined features

MassivelyGDC 2013: City of Steam demo showcases crafting and other streamlined features originally appeared on Massively on Fri, 05 Apr 2013 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>city-of-steamconconferenceconventioneventevent-coverageeventsfantasyfeaturedgame-developers-conferencegame-developers-conference-2013gdcgdc-2013goblinhands-oninterviewinterviewsmassively-event-coveragemechanistmechanist-gamespreviewpreviewsR2-gamessci-fisteampunkFri, 05 Apr 2013 16:30:00 EST<![CDATA[PAX East 2013: Hands-on with City of Steam]]>http://massively.joystiq.com/2013/03/23/pax-east-2013-hands-on-with-city-of-steam/http://massively.joystiq.com/2013/03/23/pax-east-2013-hands-on-with-city-of-steam/http://massively.joystiq.com/2013/03/23/pax-east-2013-hands-on-with-city-of-steam/#commentsFiled under: , , , , , , , , , , , , , ,

Screenshot -- City of Steam
I don't know what it is about steam engines, brass goggles, and copious amounts of clockwork mechanisms that excites me so much, but the steampunk genre has a special place in my heart. With that in mind, it should be no surprise that when I discovered that Mechanist Games, the
studio behind upcoming F2P browser MMO City of Steam, was going to be at PAX East, I immediately claimed the assignment.

For the uninitiated, City of Steam is a title that mixes the traditional fantasy flavors of magic, elves, and goblins with steampunk staples of industrialism, clockwork automatons, and airships to create what is described as "industrial age fantasy in a fallen world." During my time at PAX East, I got to spend just under an hour exploring the world of City of Steam and chatting with the game's developers who were milling about the booth. It's a fairly ambitious title that's aiming to bring a high-quality, modern MMO experience to players' browsers, but will it run like clockwork or go up in a cloud of steam?

Continue reading PAX East 2013: Hands-on with City of Steam

MassivelyPAX East 2013: Hands-on with City of Steam originally appeared on Massively on Sat, 23 Mar 2013 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>city-of-steamconconventioneventevent-coverageeventsexpof2pfantasyfeaturedfree-to-playgoblinhands-onmassively-event-coveragemechanistmechanist-gamesmicrotransactionmicrotransactionspaxpax-2013pax-eastpax-east-2013penny-arcade-expopreviewpreviewssci-fisteampunkSat, 23 Mar 2013 15:00:00 EST<![CDATA[City of Steam fires up the Colossus]]>http://massively.joystiq.com/2013/02/06/city-of-steam-fires-up-the-colossus/http://massively.joystiq.com/2013/02/06/city-of-steam-fires-up-the-colossus/http://massively.joystiq.com/2013/02/06/city-of-steam-fires-up-the-colossus/#commentsFiled under: , , , , ,

City of Steam fires up the Colossus
There appears to be no shortage of interesting sights and sounds to experience in City of Steam, although one particular landmark looms above the rest. It's the Colossus, a slumbering defensive... thing that rests in the city proper, and Mechanist Games has an amusing post giving a bit of backstory to the machine.

Apparently the Colossus was created a long time ago as a giant mobile fortress tasked with protecting the city in times of dire peril. As the city is more or less at peace, the Colossus is in stand-by mode -- although it could be woken at any moment.

This mega-sized robot features cannons and an arm that's good for punchin' and aught else. The devs revealed that originally it had several more limbs, but revisions turned it into a walking fort instead.

MassivelyCity of Steam fires up the Colossus originally appeared on Massively on Wed, 06 Feb 2013 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betacanadacanadianscity-of-steamclosed-betacolossusdev-diaryfantasygoblinhumorloremechanistmechanist-gamessci-fisteampunkWed, 06 Feb 2013 16:00:00 EST<![CDATA[City of Steam's bestiary gives pre-launch advantage]]>http://massively.joystiq.com/2013/01/31/city-of-steams-bestiary-gives-pre-launch-advantage/http://massively.joystiq.com/2013/01/31/city-of-steams-bestiary-gives-pre-launch-advantage/http://massively.joystiq.com/2013/01/31/city-of-steams-bestiary-gives-pre-launch-advantage/#commentsFiled under: , , , , ,

City of Steam's beastiary gives prelaunch advantage
While we're twiddling our thumbs waiting for the steampunk City of Steam to finally release, Mechanist Games has a great way that we can prepare for the launch. The team has put a spotlight on the website's bestiary, a helpful encyclopedia of creatures and people that players will be encountering in the game proper.

Beyond just providing some flavor and filling in some lore, the bestiary has a practical purpose by giving players details as to the strengths, weaknesses, and relationships between the mobs. The bestiary can be searched by individual creatures and by species and has plenty of cool pictures to boot.

MassivelyCity of Steam's bestiary gives pre-launch advantage originally appeared on Massively on Thu, 31 Jan 2013 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bestiarybetacity-of-steamdev-diarydev-journalencyclopediafantasygoblinmechanistmechanist-gamessci-fisteampunkThu, 31 Jan 2013 16:00:00 EST<![CDATA[City of Steam partners with publisher R2 Games]]>http://massively.joystiq.com/2013/01/22/city-of-steam-partners-with-publisher-r2-games/http://massively.joystiq.com/2013/01/22/city-of-steam-partners-with-publisher-r2-games/http://massively.joystiq.com/2013/01/22/city-of-steam-partners-with-publisher-r2-games/#commentsFiled under: , , , , ,

City of Steam partners with publisher R2 Games
Although limited in duration, City of Steam's alpha and closed beta sessions last year have helped build a following for Mechanist Games' upcoming steampunk-flavored browser-based MMO. And now, thanks to a publishing partnership with Reality Squared Games, the industrial age fantasy game will have access to a wider audience.

R2 Games already has other free-to-play titles in its portfolio, but City of Steam will be the first using the Unity 3D engine. R2 Games CEO Jared Psigoda stated, "I see a lot of potential in City of Steam. Mechanist Games' approach to making a game is something we're thrilled to be a part of. We want to make sure City of Steam gets the recognition it deserves for being the innovative game that it is."

[Source: Reality Squared Games press release]

MassivelyCity of Steam partners with publisher R2 Games originally appeared on Massively on Tue, 22 Jan 2013 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>city-of-steamfantasygoblinJared-Psigodamechanistmechanist-gamespublishing-partnershipr2-gamesreality-squared-gamessci-fisteampunkUnity-3DUnity-3D-engineTue, 22 Jan 2013 12:00:00 EST<![CDATA[The Perfect Ten: New MMOs to watch in 2013]]>http://massively.joystiq.com/2013/01/03/the-perfect-ten-new-mmos-to-watch-in-2013/http://massively.joystiq.com/2013/01/03/the-perfect-ten-new-mmos-to-watch-in-2013/http://massively.joystiq.com/2013/01/03/the-perfect-ten-new-mmos-to-watch-in-2013/#commentsFiled under: , , , , , , , , , , ,

The Perfect Ten New MMOs to watch in 2013
Oh, I had a great Perfect Ten prepped as the first list of the year, but my meanie-face editor slammed on the veto button and told me, point-blank, that I was going to be counting down the best MMO prospects for the year. Then she drove a lawnmower through a Nordstroms while huffing paint thinner and throwing empty cans at the security personnel. Even so, her idea is probably more interesting than what I had.

Let me give you a few notes on today's list because I sense that I'm going to tick more of you off than normal here. My goal was to sift through the possible releases for 2013 and pick the 10 most promising, both in "will it actually launch this year?" and in its potential for success. The combination makes it a tough call because some of these will undoubtedly be delayed to 2014 or beyond and some of these we still don't know as much as we'd like about them.

But who cares? Let's have some fun and kick this year off right. Here are my picks for new MMOs to watch in 2013.

Continue reading The Perfect Ten: New MMOs to watch in 2013

MassivelyThe Perfect Ten: New MMOs to watch in 2013 originally appeared on Massively on Thu, 03 Jan 2013 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>aaactionaction-mmoage-of-wulinage-of-wushuarche-agearcheagearkark-hunterarkfallasiabethesdabethesda-softworksbethsoftcarbinecarbine-studiosccpccp-gameschinachinesechinese-mmochris-robertscity-of-steamconsolecrowdfundingcrypticcryptic-studiosdaggerfalldefiancednddustdust-514elder-scrollselder-scrolls-onlineesoeveeve-onlinef2pfactionsfantasyfeaturedfpsfree-to-playgazilliongazillion-entertainmentgoblingpotatogvghistoricalhumorjet-likickstarterkidnappingmartial-artsmarvelmarvel-heroesmarvel-universemarvel-universe-onlinemechanistmechanist-gamesming-dynastymmofpsmorrowindmuoncsoftneverwinteroblivionopinionp10perfect-10perfect-tenperfect-worldperfect-world-entertainmentplaneplanesplaystationplaystation-3please-dont-suckps3pvppwerounduprvrsandboxsandparksci-fantasysci-fisecret-identityshooterskyrimsnail-gamessnail-games-usaspaceshipstar-citizensteampunksuperherosuperheroessyfytamrieltestesothe-elder-scrollsthe-elder-scrolls-onlinethe-perfect-10the-perfect-tenthree-faction-pvpthree-way-pvptop-10top-10-listtop-tentop-ten-listtransmedia-synergytriontrion-worldstvwarwargaming.netwarplanewarplaneswildstarworld-of-warplaneswowpwswushuwuxiaxboxxl-gamesxlgameszenimaxzenimax-mediazenimax-onlinezenimax-online-studiosThu, 03 Jan 2013 13:00:00 EST<![CDATA[Mechanist says no to huge pauldrons, revamps City of Steam NPC duds]]>http://massively.joystiq.com/2013/01/02/mechanist-says-no-to-huge-pauldrons-revamps-city-of-steam-npc-d/http://massively.joystiq.com/2013/01/02/mechanist-says-no-to-huge-pauldrons-revamps-city-of-steam-npc-d/http://massively.joystiq.com/2013/01/02/mechanist-says-no-to-huge-pauldrons-revamps-city-of-steam-npc-d/#commentsFiled under: , , , , , , ,

City of Steam - Nexan guard uniforms
It didn't take Mechanist Games long to release its first City of Steam dev journal for 2013. Today's steampunk browser title update focuses on an NPC uniform revamp, and while clothes aren't quite the stuff of epic MMO legend, we must admit to digging the new Victorian duds.

The NPCs in question are Nexan guards, the original outfits for which featured gigantic shoulder pauldrons and some sort of checkerboard faux pas motif. The new uniform is noticeably sleeker, "much more respectable, and far less gaudy," according to the devs. Have a look for yourself at the official City of Steam website.

MassivelyMechanist says no to huge pauldrons, revamps City of Steam NPC duds originally appeared on Massively on Wed, 02 Jan 2013 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>browserbrowser-basedcity-of-steamcity-of-steam-uniformsdev-diarydev-journaldev-updatefantasymechanistmechanist-gamessci-fisteampunkWed, 02 Jan 2013 11:00:00 EST<![CDATA[City of Steam fans treated to dev humiliation video for reaching goal]]>http://massively.joystiq.com/2012/12/27/city-of-steam-fans-treated-to-dev-humiliation-video-for-reaching/http://massively.joystiq.com/2012/12/27/city-of-steam-fans-treated-to-dev-humiliation-video-for-reaching/http://massively.joystiq.com/2012/12/27/city-of-steam-fans-treated-to-dev-humiliation-video-for-reaching/#commentsFiled under: , , , , , , , , , ,

City of Steam fans treated to dev humiliation video for reaching goal
Whether it was out of love for the game or just a wicked sense of humor, City of Steam fans banded together and supported the steampunk browser game enough to earn their first special dev humiliation reward on the Steam-o-Meter. So what type of public humiliation were the devs subjected to? How about FemGab and AndrewYunk starring in a live-action trailer of the beta itself!

Check out the humorous -- yet eerily accurate -- depictions of character creation, the tutorial, looting, and PvP in the video after the break! And if you want to see how well the devs have lived this humiliation down, then tune in to Massively TV this Friday, December 28th, at 9:00 p.m. EST for a dev-filled stream spectacular.

[Source: Mechanist Games press release]

Continue reading City of Steam fans treated to dev humiliation video for reaching goal

MassivelyCity of Steam fans treated to dev humiliation video for reaching goal originally appeared on Massively on Thu, 27 Dec 2012 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>city-of-steamfantasygoalsgoblinhumiliationhumorlive-action-trailermechanistmechanist-gamessci-fiSteam-o-MetersteampunkvideoThu, 27 Dec 2012 20:00:00 EST<![CDATA[City of Steam double feature: A beta trailer and a Steam Greenlight campaign]]>http://massively.joystiq.com/2012/12/12/city-of-steam-double-feature-a-beta-trailer-and-a-steam-greenli/http://massively.joystiq.com/2012/12/12/city-of-steam-double-feature-a-beta-trailer-and-a-steam-greenli/http://massively.joystiq.com/2012/12/12/city-of-steam-double-feature-a-beta-trailer-and-a-steam-greenli/#commentsFiled under: , , , , , , , ,

City of Steam double feature: a beta trailer and a Steam greenlight campaign
If you've been wanting to get a look at the upcoming steampunk MMO City of Steam but haven't been able to procure a closed beta spot, there are still two days until the Autumnwane testing round. However, if you can't wait that long, Mechanist Games has a new trailer showing off the game to tide you over.

On top of that, the studio has announced that City of Steam has kicked off its Greenlight campaign on Steam. What does this mean for fans? It means that if the game gets enough votes, it will be made available on Steam, which will in turn add a number of new features to the game, including pets, new dungeon types, new steambikes, extra character customization options, and more!

To get your City of Steam fix, be sure to watch the creatively done trailer after the break, and then don't forget to watch Massively TV this Friday night, December 14th, at 9:00 p.m. EST to see the game live!

[Source: Mechanist Games press release]

Continue reading City of Steam double feature: A beta trailer and a Steam Greenlight campaign

MassivelyCity of Steam double feature: A beta trailer and a Steam Greenlight campaign originally appeared on Massively on Wed, 12 Dec 2012 17:15:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>beta-trailercity-of-steamfantasygoblinmechanistmechanist-gamessci-fiSteamSteam-greenlightsteampunktrailerWed, 12 Dec 2012 17:15:00 EST<![CDATA[City of Steam hits support goal, revamps hotbars]]>http://massively.joystiq.com/2012/12/11/city-of-steam-hits-support-goal-revamps-hotbars/http://massively.joystiq.com/2012/12/11/city-of-steam-hits-support-goal-revamps-hotbars/http://massively.joystiq.com/2012/12/11/city-of-steam-hits-support-goal-revamps-hotbars/#commentsFiled under: , , , , , ,

City of Steam hits support goal, revamps hotbars
The fanbase has rallied around City of Steam, sending its "Steam-o-Meter" shooting straight to the top. Mechanist Games announced that the community topped the meter with four million points, which means that the company is making good on its promise to include more content for the developing title.

The new content that's coming to the game includes a Marshpuggle pet, a steampunk motorcycle, the Dwarf race, and an as-of-yet-unspecified way of shaming developers. There are pictures for several of these, including a couple teasing a special reward.

The team also overhauled the game's hotbar, saying that while the old design was functional and aesthetically pleasing, the devs thought they could do better. The new hotbar not only has more of that gear-happy look but has a convenient button for emotes.

MassivelyCity of Steam hits support goal, revamps hotbars originally appeared on Massively on Tue, 11 Dec 2012 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betacity-of-steamdev-humiliationdwarvesfantasygoblinguihotbarmechanistmechanist-gamesmotorcyclesci-fisteam-o-metersteampunkuiuser-interfaceTue, 11 Dec 2012 18:00:00 EST<![CDATA[City of Steam beta coming to the Middle East, Turkey, and North Africa]]>http://massively.joystiq.com/2012/11/30/city-of-steam-beta-coming-to-the-middle-east-turkey-and-north/http://massively.joystiq.com/2012/11/30/city-of-steam-beta-coming-to-the-middle-east-turkey-and-north/http://massively.joystiq.com/2012/11/30/city-of-steam-beta-coming-to-the-middle-east-turkey-and-north/#commentsFiled under: , , , , , , , ,

City of Steam beta coming to the Middle East, Turkey, and North Africa
If you're looking for a steampunk-flavored browser MMO, look no further than Mechanist Games' City of Steam. If you're looking for a steampunk-flavored browser MMO localized in both Arabic and Turkish, well, we'll point you toward CoS yet again.

Mechanist's latest press release trumpets the game's closed beta, which is coming to the Middle East, North Africa, and Turkey in the first quarter of 2013. To join the beta and take part in what Mechanist dubs "MMORPG history," head to the game's official website and sign up.

[Source: Mechanist Games press release]

MassivelyCity of Steam beta coming to the Middle East, Turkey, and North Africa originally appeared on Massively on Fri, 30 Nov 2012 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betacity-of-steamcity-of-steam-betafantasygoblinmechanistmechanist-gamessci-fisteampunkFri, 30 Nov 2012 13:00:00 EST<![CDATA[City of Steam shows player collaborations]]>http://massively.joystiq.com/2012/11/26/city-of-steam-shows-player-collaborations/http://massively.joystiq.com/2012/11/26/city-of-steam-shows-player-collaborations/http://massively.joystiq.com/2012/11/26/city-of-steam-shows-player-collaborations/#commentsFiled under: , , , , , ,

City of Steam shows player collaborations
As part of its pre-launch fundraising efforts, Mechanist Games continues to offer players the chance to design their own in-game item for City of Steam if they kick in $500. It turns out at least four players have done so, and the devs whipped up a new blog post to show the journey from concept to completion for each of these items.

The items include a Darth Vader-style mask with cool steampunk goggles, a "Swiss Army Knife" of one-handed swords, a skull-adorned sword with an engine powering it, and a pair of sleek firearms.

Mechanist Games says that there are plenty of additional player items being designed and implemented. If you're thinking about making a mark on this upcoming game, you might want to move fast: donors will only have access to the design-an-item perk until December 5th.

If you're curious about City of Steam, check out Massively's recent hands-on with the title!

MassivelyCity of Steam shows player collaborations originally appeared on Massively on Mon, 26 Nov 2012 11:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betacity-of-steamdev-blogdev-diarydev-journalfantasyfundraisergeargoblinitemsmechanistmechanist-gamesplayer-created-itemsplayer-itemssci-fisteampunkweaponsMon, 26 Nov 2012 11:00:00 EST<![CDATA[Browser beauty: Hands-on with City of Steam]]>http://massively.joystiq.com/2012/11/16/browser-beauty-hands-on-with-city-of-steam/http://massively.joystiq.com/2012/11/16/browser-beauty-hands-on-with-city-of-steam/http://massively.joystiq.com/2012/11/16/browser-beauty-hands-on-with-city-of-steam/#commentsFiled under: , , , , , , , , ,

City of Steam
Browser games aren't supposed to be like this. Browser games are supposed to be Flash-based trifles and social "gaming" money printers. They're supposed to have simple graphics, shallow gameplay and zero narrative. Put simply, browser-based games are supposed to be bad.

City of Steam, a free-to-play, browser-based MMO developed by Mechanist Games, isn't content to live in this world of assumed browser-based inferiority. In fact, the game almost feels like a challenge to the industry: If this is what browsers can do, why isn't everyone doing it? City of Steam has the potential to shake the foundation of the MMO world by proving that full, engaging game experiences can be delivered instantly and on-demand, as long as its final execution lives up to its current promise.

From what's been revealed so far, Mechanist appears to be on the right track.

Continue reading Browser beauty: Hands-on with City of Steam

MassivelyBrowser beauty: Hands-on with City of Steam originally appeared on Massively on Fri, 16 Nov 2012 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabrowserbrowser-basedbrowser-gamecity-of-steamclosed-betaf2pfantasyfeaturedfree-to-playgoblinhands-onimpressionsmechanistmechanist-gamespreviewpreviewssci-fisteampunkFri, 16 Nov 2012 13:00:00 EST<![CDATA[City of Steam posts beta schedule]]>http://massively.joystiq.com/2012/10/26/city-of-steam-posts-beta-schedule/http://massively.joystiq.com/2012/10/26/city-of-steam-posts-beta-schedule/http://massively.joystiq.com/2012/10/26/city-of-steam-posts-beta-schedule/#commentsFiled under: , , , , ,

City of Steam posts beta schedule
The time is neigh to gear up and test the heck out of City of Steam! Mechanist Games' steampunk MMO is nearing its closed beta phase and has posted a schedule for testing through the remainder of the year.

The team breaks down the closed beta cycle into four "seasons": Springtide (November 16th to the 20th), Summercrest (November 30th to the December 4th), Autumnwane (December 14th to the 18th), and Winter Festival (December 23rd to the 28th).

For those of you looking for a way to guarantee a beta invite or would like to support the game, the devs also announced several beta collaborator packs to purchase. Each pack includes a beta key, name reservation, and other goodies. Mechanist Games is also posting a "Steam-o-Meter" that will trigger additional development on the game once certain support goals are met.

MassivelyCity of Steam posts beta schedule originally appeared on Massively on Fri, 26 Oct 2012 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betabeta-collaborator-packsbeta-schedulecity-of-steamclosed-betaclosed-beta-schedulefantasygoblinmechanistmechanist-gamespromotionsci-fisteam-o-metersteampunkFri, 26 Oct 2012 15:00:00 EST<![CDATA[City of Steam reveals journey from turn-based to real-time combat]]>http://massively.joystiq.com/2012/10/17/city-of-steam-reveals-journey-from-turn-based-to-real-time-comba/http://massively.joystiq.com/2012/10/17/city-of-steam-reveals-journey-from-turn-based-to-real-time-comba/http://massively.joystiq.com/2012/10/17/city-of-steam-reveals-journey-from-turn-based-to-real-time-comba/#commentsFiled under: , , , , ,

City of Steam regales with journey from turnbased to realtime action
The saga of City of Steam's creation continues to grow more impressive with a new behind-the-scenes story. In it, the devs tell the little-known tale about how the game used to be turn-based. This was originally due to a very limited team and budget, although the devs further justified the decision by saying that the MMO was based on a turn-based pen-and-paper game anyway.

City of Steam managed to make the transition to real-time action with the help of some surprise financing prior to alpha. Over 90% of the code had to be reworked to make it happen, but the team pulled it off prior to the game's alpha and any actual players' eyes.

It might be easy for us to take for granted how studios can whip up real-time combat in MMOs, but this post illustrates how incredibly complicated it can be, especially for teams with limited resources.

City of Steam heads into beta next month.

MassivelyCity of Steam reveals journey from turn-based to real-time combat originally appeared on Massively on Wed, 17 Oct 2012 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>actionbehind-the-scenesbetacity-of-steamcombatdev-diarydev-journaldeveloper-diarydeveloper-journalfantasygoblinmechanistmechanist-gamesreal-timesci-fisteampunkturn-basedWed, 17 Oct 2012 16:00:00 EST